3DPFA

Crystal structure of the complex between mmp-8 and a non-zinc chelating inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil collagenase
publication title Extra Binding Region Induced by Non-Zinc Chelating Inhibitors into the S(1)' Subsite of Matrix Metalloproteinase 8 (MMP-8)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dpfA00
3V96B 3VI1A 3LE9A 1XFVA 3G42A 1GKDA 2W15A 3B2ZA 1BQOA 4G0DA 4G9LA 3B8ZA 3LUMA 3SHIA 1XUDA 1IADA 2OW2A 3HY7A 4XM6A 3L0VA 5B5PA 4H30A 1BUVM 2L0RA 3K7NA 3LIKA 1BQQM 2JT5A 1ZS0A 1BM6A 3TT4A 2OW9A 2YB9A 1FLSA 2I47A 4WZVA 3F15A 1AYKA 1KUFA 1MMPA 1OM7A 4GR3A 4HX3A 4ZR5A 2YIGA 1C7KA 2DDYA 1GO7P 2OW1A 1SMPA 3HB2P 1O0TA 3EDZA 3USNA 4PKUA 4WKIA 1YOUA 1RMZA 5I43A 4XCTA 3HBUP 1HFSA 2WO9A 2K2GA 1CAQA 2D1NA 2D1OA 4DPEA 1QUAA 2EROA 2W12A 2OXZA 1CQRA 3LUNA 4L6TA 4AXQA 1R1HA 1MNCA 2OY4A 4FVLA 1PWUA 3O64A 1G4KA 1KUKA 3G5CA 3F1AA 2OW0A 4GWMA 2OI0A 2RJQA 3OHOA 5LABA 1IACA 2XS3A 4HMAA 4GQLA 3WV2A 3U1RA 1K7GA 4AUOA 3LGPA 5L7FA 1JKYA 1CXVA 1CGFA 2O36A 1K7IA 2DW0A 3UVCA 2WO8A 1BKCI 2DW2A 3CKIA 1JAOA 1H71P 1HOVA 5D1TA 5JMYA 3AIGA 1XFYA 4DF9A 5CZMA 3B92A 4GR8A 4XM7A 3F18A 3OHLA 2X3BA 4AIGA 2O3EA 1OS9A 3O2XA 1FM1A 2WOAA 1R54A 3ZVSA 5D7WA 4H84A 1I73A 2XS4A 5D1UA 3KMEA 3P24A 2Y6CA 1Y93A 1OO9A 3EHXA 5I4OA 3LMCA 3Q2HA 3ZXHA 2DW1A 4A7BA 4GR0A 2PJTA 3MA2A 1XURA 2JT6A 830CA 1Y0VA 3KECA 4H49A 4JA1A 5BOYA 1QICA 2J83A 4WF6A 1QJJA 2OY2A 4GF1A 3LEAA 4QKZA 1J7NA 1A85A 3F16A 4JP4A 1ZTQA 2AIGP 3HY9A 2SRTA 1R55A 4DD8A 1G9KA 1R1JA 2AYKA 1G12A 1KBCA 4GWNA 4R3VA 3LQ0A 4XBHA 4H82A 1S4BP 1C8TA 4DV8A 3TS4A 1BKCE 3WV1A 5BOTA 2DDFA 4H2EA 1PWQA 2X3AA 3DL1A 4ILWD 3TVCA 1BSWA 4L19A 4PKWA 3P1VA 2X3CA 1D8MA 1EB6A 3AYKA 2HU6A 5BPAA 3VTGA 1IABA 3E8RA 5CUHA 1GKCA 3EDIA 1SLMA 3F17A 1A86A 3KHIA 1C3IA 4JQGA 3ZUKA 1JH1A 1IAGA 1XFWA 1CK7A 1BIWA 1PWPA 5D1SA 1FBLA 1OS2A 1AKLA 4JPAA 4IUWA 3DWBA 5H8XA 4XM8A 1SATA 4H76A 4PKTA 1JIZA 3LKAA 4Q1LA 1DTHA 3I7IA 4JIJA 2X7MA 3NX7A 4FU4A 3I7GA 2K9CA 2JSDA 2J0TA 4PKRA 2RJPA 1XFUA 3EHYA 4CTHA 1USNA 4PKQA 1BUDA 1UTTA 3HDBA 3K7LA 1KUHA 3DNGA 3TSKA 1UTZA 5I12A 1GE6A 4AYKA 3BA0A 1Q3AA 2FV5A 3DSLA 1R1IA 3F19A 1D8FA 4WKEA 1HTDA 2ERQA 2CLTA 3HBVP 2KRJA 5L79A 3L0TA 1YQYA 1HV5A 3KMCA 3HYGA 3RTSA 3HDAP 1PWWA 4PKVA 1CIZA 3N2VA 1OM6A 2TCLA 1Y8JA 4A3WA 1BKCA 1ZXCA 2Y6DA 2V4BA 1KAPP 2QPJA 1G49A 3KWVC 1JANA 2N8RA 2ERPA 1ZVXA 1XUCA 3AYUA 5I3MA 1HY7A 1PWVA 2OZRA 2JNPA 1GE7A 1GO8P 1JIWP 1Z3JA 2MZEA 1UEAA 966CA 3EWJA 1L6JA 1K7QA 3RTTA 1ND1A 5I2ZA 1EUBA 2FV9A 4H3XA 4WK7A 1UMSA 3Q2GA 1BZSA 1B3DA 1OMJA 2CKIA 1RM8A 4H1QA 1SU3A 3N2UA 2MZIA 2MZHA 1D7XA 1OM8A 2E3XA 4IJOA 1CGLA 1YCMA 4IN9A 3EDHA 4PKSA 1O0QA 3GBOA 1ZP5A 1XFXA 3KEKA 2E2DA 4GUYA 3LIRA 4I03A 3LK8A 2JIHA 1JK3A 1GXDA 1JAPA 2W0DA 2USNA 5D3CA 2OVZA 5D2BA 1SLNA 1ROSA 1WNIA 5CXAA 1QIAA 3LILA 4L63A 1ZXVA 2Z2DA 2POJA 2OXUA 3EDGA 1B8YA 4I35A 3LJTA 1IAEA 1XFZA 2OVXA 1ATLA 456CA 5I0LA 1D5JA 5B5OA 1G05A 1I1IP 1GE5A 3LJZA 1KUGA 3LJGA 1QIBA 2OXWA 2MLRA 3KEJA 4FXQA 3ELMA 1IAAA 2MLSA 1EAKA 1JAQA 1KUIA 1MMRA 3DPEA 1QJIA 1ASTA 4EFSA 1CGEA 4ON1A 1MMBA 4FXYP 1DMTA 3WV3A 1AF0A 1UMTA 1YP1A 3LQBA 2A8HA 1MMQA 4J4MA 1HFCA 1SRPA 1JJ9A 3KRYA 1I76A 2W14A 3DPFA 2W13A
chains in the Genus database with same CATH superfamily
3V96B 3VI1A 3LE9A 1XFVA 3G42A 1GKDA 2W15A 3B2ZA 1BQOA 4G0DA 4G9LA 3B8ZA 3LUMA 3SHIA 1XUDA 1IADA 2OW2A 3HY7A 4XM6A 3L0VA 5B5PA 4H30A 1BUVM 2L0RA 3K7NA 3LIKA 1BQQM 2JT5A 1ZS0A 1BM6A 3TT4A 2OW9A 2YB9A 1XAXA 1FLSA 2I47A 4WZVA 3F15A 1AYKA 1KUFA 1MMPA 1OM7A 4GR3A 4HX3A 4ZR5A 2YIGA 1C7KA 2DDYA 1GO7P 2OW1A 1SMPA 3HB2P 1O0TA 3EDZA 3USNA 4PKUA 4WKIA 1YOUA 4L7AA 1RMZA 5I43A 4XCTA 3HBUP 1HFSA 2WO9A 2K2GA 1CAQA 2D1NA 2YUFA 2D1OA 4DPEA 1QUAA 2EROA 2W12A 2OXZA 1CQRA 3LUNA 4L6TA 4AXQA 1R1HA 1MNCA 2OY4A 4FVLA 1PWUA 3O64A 1G4KA 1KUKA 3DTIA 3G5CA 3F1AA 2OW0A 4GWMA 2OI0A 2RJQA 3OHOA 5LABA 1IACA 2XS3A 4HMAA 4GQLA 3WV2A 3U1RA 1K7GA 4AUOA 3LGPA 5L7FA 1JKYA 1CXVA 1CGFA 2O36A 1K7IA 2DW0A 3UVCA 3DTEA 2WO8A 1BKCI 2DW2A 3CKIA 1JAOA 1H71P 1HOVA 5D1TA 5JMYA 3AIGA 1XFYA 4DF9A 5CZMA 3B92A 4GR8A 4XM7A 3F18A 3OHLA 2X3BA 4AIGA 2O3EA 1OS9A 3O2XA 1FM1A 2WOAA 1R54A 3ZVSA 5D7WA 4H84A 1I73A 3DTKA 2XS4A 5D1UA 3KMEA 3P24A 2Y6CA 1Y93A 1OO9A 3EHXA 5I4OA 3LMCA 3Q2HA 3ZXHA 2DW1A 4A7BA 4GR0A 2PJTA 3MA2A 1XURA 2JT6A 830CA 1Y0VA 3KECA 4H49A 4JA1A 5BOYA 1QICA 2J83A 4WF6A 1QJJA 2OY2A 4GF1A 3LEAA 4QKZA 1J7NA 1A85A 3F16A 4JP4A 1ZTQA 2AIGP 3HY9A 2SRTA 1R55A 4DD8A 1G9KA 1R1JA 2AYKA 1G12A 1KBCA 4GWNA 4R3VA 3LQ0A 4XBHA 4H82A 1S4BP 1C8TA 4DV8A 3TS4A 1BKCE 3WV1A 5BOTA 2DDFA 4H2EA 1PWQA 2X3AA 3DL1A 4ILWD 3TVCA 1BSWA 4L19A 1OZ9A 4PKWA 3P1VA 2X3CA 1D8MA 1EB6A 3AYKA 2HU6A 5BPAA 3VTGA 1IABA 3E8RA 5CUHA 1GKCA 3EDIA 1SLMA 3F17A 1A86A 3KHIA 1C3IA 4JQGA 3ZUKA 1JH1A 1IAGA 1XFWA 1CK7A 1BIWA 1PWPA 5D1SA 1FBLA 1OS2A 1AKLA 4JPAA 4IUWA 3DWBA 5H8XA 4XM8A 1SATA 4H76A 4PKTA 1JIZA 3LKAA 4Q1LA 1DTHA 3I7IA 4JIJA 2X7MA 3NX7A 4FU4A 3I7GA 2K9CA 2JSDA 2J0TA 4PKRA 2RJPA 1XFUA 3EHYA 4CTHA 1USNA 4PKQA 1BUDA 1TVIA 1UTTA 3HDBA 3K7LA 1KUHA 3DNGA 3TSKA 1UTZA 5I12A 1GE6A 4AYKA 3BA0A 1Q3AA 2FV5A 3DSLA 1R1IA 3F19A 1D8FA 4WKEA 1HTDA 2ERQA 2CLTA 3HBVP 2KRJA 5L79A 3L0TA 1YQYA 1HV5A 3KMCA 3HYGA 3RTSA 3HDAP 1PWWA 4PKVA 1CIZA 3N2VA 1OM6A 2TCLA 1Y8JA 4A3WA 1BKCA 1ZXCA 2Y6DA 2V4BA 1KAPP 2QPJA 1G49A 3KWVC 1JANA 2N8RA 2ERPA 1ZVXA 1XUCA 3AYUA 5I3MA 1HY7A 1PWVA 2OZRA 2JNPA 1GE7A 1GO8P 1JIWP 1Z3JA 2MZEA 1UEAA 966CA 3EWJA 1L6JA 1K7QA 3RTTA 1ND1A 5I2ZA 1EUBA 2FV9A 4H3XA 4WK7A 1UMSA 3Q2GA 1BZSA 1B3DA 1OMJA 2CKIA 1RM8A 4H1QA 1SU3A 1XM5A 3N2UA 2MZIA 2MZHA 1D7XA 1OM8A 2E3XA 4IJOA 1CGLA 1YCMA 4IN9A 3EDHA 4PKSA 1O0QA 3GBOA 1ZP5A 1XFXA 3KEKA 2E2DA 4GUYA 3LIRA 4I03A 3LK8A 2JIHA 1JK3A 1GXDA 1JAPA 2W0DA 2USNA 5D3CA 2OVZA 5D2BA 1SLNA 1ROSA 1WNIA 5CXAA 1QIAA 3LILA 4L63A 1ZXVA 2Z2DA 2POJA 2OXUA 3EDGA 1B8YA 4I35A 1IAEA 1XFZA 2OVXA 3LJTA 1ATLA 456CA 5I0LA 1D5JA 5B5OA 1G05A 1I1IP 1GE5A 3LJZA 1KUGA 3LJGA 1QIBA 2OXWA 2MLRA 3KEJA 4FXQA 3ELMA 1IAAA 2MLSA 1EAKA 1JAQA 1KUIA 1MMRA 3DPEA 1QJIA 1ASTA 4EFSA 1CGEA 4ON1A 1MMBA 4FXYP 1DMTA 3WV3A 1AF0A 1UMTA 1YP1A 3LQBA 2A8HA 1MMQA 4J4MA 1HFCA 1SRPA 1JJ9A 3KRYA 1I76A 2W14A 3DPFA 2W13A
chains in the Genus database with same CATH topology
3V96B 3VI1A 3LE9A 1XFVA 3G42A 1GKDA 2W15A 3B2ZA 1BQOA 4G0DA 4G9LA 3B8ZA 3LUMA 3SHIA 1XUDA 1IADA 2OW2A 3HY7A 4XM6A 3L0VA 5B5PA 4H30A 1BUVM 2L0RA 3K7NA 3LIKA 1BQQM 2JT5A 1ZS0A 1BM6A 3TT4A 2OW9A 2YB9A 1FLSA 2I47A 4WZVA 3F15A 1AYKA 1KUFA 1MMPA 1OM7A 4GR3A 4HX3A 4ZR5A 2YIGA 1C7KA 2DDYA 1GO7P 2OW1A 1SMPA 3HB2P 1O0TA 3EDZA 3USNA 4PKUA 4WKIA 1YOUA 4L7AA 1RMZA 5I43A 4XCTA 3HBUP 1HFSA 2WO9A 2K2GA 1CAQA 2D1NA 2YUFA 2D1OA 4DPEA 1QUAA 2EROA 2W12A 2OXZA 1CQRA 3LUNA 4L6TA 4AXQA 1R1HA 1MNCA 2OY4A 4FVLA 1PWUA 3O64A 1G4KA 1KUKA 3DTIA 3G5CA 3F1AA 2OW0A 4GWMA 2OI0A 2RJQA 3OHOA 5LABA 1IACA 2XS3A 4HMAA 4GQLA 3WV2A 3U1RA 1K7GA 4AUOA 3LGPA 5L7FA 1JKYA 1CXVA 1CGFA 2O36A 1K7IA 2DW0A 3UVCA 3DTEA 2WO8A 1BKCI 2DW2A 3CKIA 1JAOA 1H71P 1HOVA 5D1TA 5JMYA 3AIGA 1XFYA 4DF9A 5CZMA 3B92A 4GR8A 4XM7A 3F18A 3OHLA 2X3BA 4AIGA 2O3EA 1OS9A 3O2XA 1FM1A 2WOAA 1R54A 3ZVSA 5D7WA 4H84A 1I73A 3DTKA 2XS4A 5D1UA 3KMEA 3P24A 2Y6CA 1Y93A 1OO9A 3EHXA 5I4OA 3LMCA 3Q2HA 3ZXHA 2DW1A 4A7BA 4GR0A 2PJTA 3MA2A 1XURA 2JT6A 830CA 1Y0VA 3KECA 4H49A 4JA1A 5BOYA 1QICA 2J83A 4WF6A 1QJJA 2OY2A 4GF1A 3LEAA 4QKZA 1J7NA 1A85A 3F16A 4JP4A 1ZTQA 2AIGP 3HY9A 2SRTA 1R55A 4DD8A 1G9KA 1R1JA 2AYKA 1G12A 1KBCA 4GWNA 4R3VA 3LQ0A 4XBHA 4H82A 1S4BP 1C8TA 4DV8A 3TS4A 1BKCE 3WV1A 5BOTA 2DDFA 4H2EA 1PWQA 2X3AA 3DL1A 4ILWD 3TVCA 1BSWA 4L19A 4PKWA 3P1VA 2X3CA 1D8MA 1EB6A 3AYKA 2HU6A 5BPAA 3VTGA 1IABA 3E8RA 5CUHA 1GKCA 3EDIA 1SLMA 3F17A 1A86A 3KHIA 1C3IA 4JQGA 3ZUKA 1JH1A 1IAGA 1XFWA 1CK7A 1BIWA 1PWPA 5D1SA 1FBLA 1OS2A 1AKLA 4JPAA 4IUWA 3DWBA 5H8XA 4XM8A 1SATA 4H76A 4PKTA 1JIZA 3LKAA 4Q1LA 1DTHA 3I7IA 4JIJA 2X7MA 3NX7A 4FU4A 3I7GA 2K9CA 2JSDA 2J0TA 4PKRA 2RJPA 1XFUA 3EHYA 4CTHA 1USNA 4PKQA 1BUDA 1UTTA 3HDBA 3K7LA 1KUHA 3DNGA 3TSKA 1UTZA 5I12A 1GE6A 4AYKA 3BA0A 1Q3AA 2FV5A 3DSLA 1R1IA 3F19A 1D8FA 4WKEA 1HTDA 2ERQA 2CLTA 3HBVP 2KRJA 5L79A 3L0TA 1YQYA 1HV5A 3KMCA 3HYGA 3RTSA 3HDAP 1PWWA 4PKVA 1CIZA 3N2VA 1OM6A 2TCLA 1Y8JA 4A3WA 1BKCA 1ZXCA 2Y6DA 2V4BA 1KAPP 2QPJA 1G49A 3KWVC 1JANA 2N8RA 2ERPA 1ZVXA 1XUCA 3AYUA 5I3MA 1HY7A 1PWVA 2OZRA 2JNPA 1GE7A 1GO8P 1JIWP 1Z3JA 2MZEA 1UEAA 966CA 3EWJA 1L6JA 1K7QA 3RTTA 1ND1A 5I2ZA 1EUBA 2FV9A 4H3XA 4WK7A 1UMSA 3Q2GA 1BZSA 1B3DA 1OMJA 2CKIA 1RM8A 4H1QA 1SU3A 3N2UA 2MZIA 2MZHA 1D7XA 1OM8A 2E3XA 4IJOA 1CGLA 1YCMA 4IN9A 3EDHA 4PKSA 1O0QA 3GBOA 1ZP5A 1XFXA 3KEKA 2E2DA 4GUYA 3LIRA 4I03A 3LK8A 2JIHA 1JK3A 1GXDA 1JAPA 2W0DA 2USNA 5D3CA 2OVZA 5D2BA 1SLNA 1ROSA 1WNIA 5CXAA 1QIAA 3LILA 4L63A 1ZXVA 2Z2DA 2POJA 2OXUA 3EDGA 1B8YA 4I35A 1IAEA 1XFZA 2OVXA 3LJTA 1ATLA 456CA 5I0LA 1D5JA 5B5OA 1G05A 1I1IP 1GE5A 3LJZA 1KUGA 3LJGA 1QIBA 2OXWA 2MLRA 3KEJA 4FXQA 3ELMA 1IAAA 2MLSA 1EAKA 1JAQA 1KUIA 1MMRA 3DPEA 1QJIA 1ASTA 4EFSA 1CGEA 4ON1A 1MMBA 4FXYP 1DMTA 3WV3A 1AF0A 1UMTA 1YP1A 3LQBA 2A8HA 1MMQA 4J4MA 1HFCA 1SRPA 1JJ9A 3KRYA 1I76A 2W14A 3DPFA 2W13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V96 B;  3VI1 A;  3LE9 A;  1XFV A;  3G42 A;  1GKD A;  2W15 A;  3B2Z A;  1BQO A;  4G0D A;  4G9L A;  3B8Z A;  3LUM A;  3SHI A;  1XUD A;  1IAD A;  2OW2 A;  3HY7 A;  4XM6 A;  3L0V A;  5B5P A;  4H30 A;  1BUV M;  2L0R A;  3K7N A;  3LIK A;  1BQQ M;  2JT5 A;  1ZS0 A;  1BM6 A;  3TT4 A;  2OW9 A;  2YB9 A;  1FLS A;  2I47 A;  4WZV A;  3F15 A;  1AYK A;  1KUF A;  1MMP A;  1OM7 A;  4GR3 A;  4HX3 A;  4ZR5 A;  2YIG A;  1C7K A;  2DDY A;  1GO7 P;  2OW1 A;  1SMP A;  3HB2 P;  1O0T A;  3EDZ A;  3USN A;  4PKU A;  4WKI A;  1YOU A;  1RMZ A;  5I43 A;  4XCT A;  3HBU P;  1HFS A;  2WO9 A;  2K2G A;  1CAQ A;  2D1N A;  2D1O A;  4DPE A;  1QUA A;  2ERO A;  2W12 A;  2OXZ A;  1CQR A;  3LUN A;  4L6T A;  4AXQ A;  1R1H A;  1MNC A;  2OY4 A;  4FVL A;  1PWU A;  3O64 A;  1G4K A;  1KUK A;  3G5C A;  3F1A A;  2OW0 A;  4GWM A;  2OI0 A;  2RJQ A;  3OHO A;  5LAB A;  1IAC A;  2XS3 A;  4HMA A;  4GQL A;  3WV2 A;  3U1R A;  1K7G A;  4AUO A;  3LGP A;  5L7F A;  1JKY A;  1CXV A;  1CGF A;  2O36 A;  1K7I A;  2DW0 A;  3UVC A;  2WO8 A;  1BKC I;  2DW2 A;  3CKI A;  1JAO A;  1H71 P;  1HOV A;  5D1T A;  5JMY A;  3AIG A;  1XFY A;  4DF9 A;  5CZM A;  3B92 A;  4GR8 A;  4XM7 A;  3F18 A;  3OHL A;  2X3B A;  4AIG A;  2O3E A;  1OS9 A;  3O2X A;  1FM1 A;  2WOA A;  1R54 A;  3ZVS A;  5D7W A;  4H84 A;  1I73 A;  2XS4 A;  5D1U A;  3KME A;  3P24 A;  2Y6C A;  1Y93 A;  1OO9 A;  3EHX A;  5I4O A;  3LMC A;  3Q2H A;  3ZXH A;  2DW1 A;  4A7B A;  4GR0 A;  2PJT A;  3MA2 A;  1XUR A;  2JT6 A;  830C A;  1Y0V A;  3KEC A;  4H49 A;  4JA1 A;  5BOY A;  1QIC A;  2J83 A;  4WF6 A;  1QJJ A;  2OY2 A;  4GF1 A;  3LEA A;  4QKZ A;  1J7N A;  1A85 A;  3F16 A;  4JP4 A;  1ZTQ A;  2AIG P;  3HY9 A;  2SRT A;  1R55 A;  4DD8 A;  1G9K A;  1R1J A;  2AYK A;  1G12 A;  1KBC A;  4GWN A;  4R3V A;  3LQ0 A;  4XBH A;  4H82 A;  1S4B P;  1C8T A;  4DV8 A;  3TS4 A;  1BKC E;  3WV1 A;  5BOT A;  2DDF A;  4H2E A;  1PWQ A;  2X3A A;  3DL1 A;  4ILW D;  3TVC A;  1BSW A;  4L19 A;  4PKW A;  3P1V A;  2X3C A;  1D8M A;  1EB6 A;  3AYK A;  2HU6 A;  5BPA A;  3VTG A;  1IAB A;  3E8R A;  5CUH A;  1GKC A;  3EDI A;  1SLM A;  3F17 A;  1A86 A;  3KHI A;  1C3I A;  4JQG A;  3ZUK A;  1JH1 A;  1IAG A;  1XFW A;  1CK7 A;  1BIW A;  1PWP A;  5D1S A;  1FBL A;  1OS2 A;  1AKL A;  4JPA A;  4IUW A;  3DWB A;  5H8X A;  4XM8 A;  1SAT A;  4H76 A;  4PKT A;  1JIZ A;  3LKA A;  4Q1L A;  1DTH A;  3I7I A;  4JIJ A;  2X7M A;  3NX7 A;  4FU4 A;  3I7G A;  2K9C A;  2JSD A;  2J0T A;  4PKR A;  2RJP A;  1XFU A;  3EHY A;  4CTH A;  1USN A;  4PKQ A;  1BUD A;  1UTT A;  3HDB A;  3K7L A;  1KUH A;  3DNG A;  3TSK A;  1UTZ A;  5I12 A;  1GE6 A;  4AYK A;  3BA0 A;  1Q3A A;  2FV5 A;  3DSL A;  1R1I A;  3F19 A;  1D8F A;  4WKE A;  1HTD A;  2ERQ A;  2CLT A;  3HBV P;  2KRJ A;  5L79 A;  3L0T A;  1YQY A;  1HV5 A;  3KMC A;  3HYG A;  3RTS A;  3HDA P;  1PWW A;  4PKV A;  1CIZ A;  3N2V A;  1OM6 A;  2TCL A;  1Y8J A;  4A3W A;  1BKC A;  1ZXC A;  2Y6D A;  2V4B A;  1KAP P;  2QPJ A;  1G49 A;  3KWV C;  1JAN A;  2N8R A;  2ERP A;  1ZVX A;  1XUC A;  3AYU A;  5I3M A;  1HY7 A;  1PWV A;  2OZR A;  2JNP A;  1GE7 A;  1GO8 P;  1JIW P;  1Z3J A;  2MZE A;  1UEA A;  966C A;  3EWJ A;  1L6J A;  1K7Q A;  3RTT A;  1ND1 A;  5I2Z A;  1EUB A;  2FV9 A;  4H3X A;  4WK7 A;  1UMS A;  3Q2G A;  1BZS A;  1B3D A;  1OMJ A;  2CKI A;  1RM8 A;  4H1Q A;  1SU3 A;  3N2U A;  2MZI A;  2MZH A;  1D7X A;  1OM8 A;  2E3X A;  4IJO A;  1CGL A;  1YCM A;  4IN9 A;  3EDH A;  4PKS A;  1O0Q A;  3GBO A;  1ZP5 A;  1XFX A;  3KEK A;  2E2D A;  4GUY A;  3LIR A;  4I03 A;  3LK8 A;  2JIH A;  1JK3 A;  1GXD A;  1JAP A;  2W0D A;  2USN A;  5D3C A;  2OVZ A;  5D2B A;  1SLN A;  1ROS A;  1WNI A;  5CXA A;  1QIA A;  3LIL A;  4L63 A;  1ZXV A;  2Z2D A;  2POJ A;  2OXU A;  3EDG A;  1B8Y A;  4I35 A;  3LJT A;  1IAE A;  1XFZ A;  2OVX A;  1ATL A;  456C A;  5I0L A;  1D5J A;  5B5O A;  1G05 A;  1I1I P;  1GE5 A;  3LJZ A;  1KUG A;  3LJG A;  1QIB A;  2OXW A;  2MLR A;  3KEJ A;  4FXQ A;  3ELM A;  1IAA A;  2MLS A;  1EAK A;  1JAQ A;  1KUI A;  1MMR A;  3DPE A;  1QJI A;  1AST A;  4EFS A;  1CGE A;  4ON1 A;  1MMB A;  4FXY P;  1DMT A;  3WV3 A;  1AF0 A;  1UMT A;  1YP1 A;  3LQB A;  2A8H A;  1MMQ A;  4J4M A;  1HFC A;  1SRP A;  1JJ9 A;  3KRY A;  1I76 A;  2W14 A;  3DPF A;  2W13 A; 
#chains in the Genus database with same CATH topology
 3V96 B;  3VI1 A;  3LE9 A;  1XFV A;  3G42 A;  1GKD A;  2W15 A;  3B2Z A;  1BQO A;  4G0D A;  4G9L A;  3B8Z A;  3LUM A;  3SHI A;  1XUD A;  1IAD A;  2OW2 A;  3HY7 A;  4XM6 A;  3L0V A;  5B5P A;  4H30 A;  1BUV M;  2L0R A;  3K7N A;  3LIK A;  1BQQ M;  2JT5 A;  1ZS0 A;  1BM6 A;  3TT4 A;  2OW9 A;  2YB9 A;  1XAX A;  1FLS A;  2I47 A;  4WZV A;  3F15 A;  1AYK A;  1KUF A;  1MMP A;  1OM7 A;  4GR3 A;  4HX3 A;  4ZR5 A;  2YIG A;  1C7K A;  2DDY A;  1GO7 P;  2OW1 A;  1SMP A;  3HB2 P;  1O0T A;  3EDZ A;  3USN A;  4PKU A;  4WKI A;  1YOU A;  4L7A A;  1RMZ A;  5I43 A;  4XCT A;  3HBU P;  1HFS A;  2WO9 A;  2K2G A;  1CAQ A;  2D1N A;  2YUF A;  2D1O A;  4DPE A;  1QUA A;  2ERO A;  2W12 A;  2OXZ A;  1CQR A;  3LUN A;  4L6T A;  4AXQ A;  1R1H A;  1MNC A;  2OY4 A;  4FVL A;  1PWU A;  3O64 A;  1G4K A;  1KUK A;  3DTI A;  3G5C A;  3F1A A;  2OW0 A;  4GWM A;  2OI0 A;  2RJQ A;  3OHO A;  5LAB A;  1IAC A;  2XS3 A;  4HMA A;  4GQL A;  3WV2 A;  3U1R A;  1K7G A;  4AUO A;  3LGP A;  5L7F A;  1JKY A;  1CXV A;  1CGF A;  2O36 A;  1K7I A;  2DW0 A;  3UVC A;  3DTE A;  2WO8 A;  1BKC I;  2DW2 A;  3CKI A;  1JAO A;  1H71 P;  1HOV A;  5D1T A;  5JMY A;  3AIG A;  1XFY A;  4DF9 A;  5CZM A;  3B92 A;  4GR8 A;  4XM7 A;  3F18 A;  3OHL A;  2X3B A;  4AIG A;  2O3E A;  1OS9 A;  3O2X A;  1FM1 A;  2WOA A;  1R54 A;  3ZVS A;  5D7W A;  4H84 A;  1I73 A;  3DTK A;  2XS4 A;  5D1U A;  3KME A;  3P24 A;  2Y6C A;  1Y93 A;  1OO9 A;  3EHX A;  5I4O A;  3LMC A;  3Q2H A;  3ZXH A;  2DW1 A;  4A7B A;  4GR0 A;  2PJT A;  3MA2 A;  1XUR A;  2JT6 A;  830C A;  1Y0V A;  3KEC A;  4H49 A;  4JA1 A;  5BOY A;  1QIC A;  2J83 A;  4WF6 A;  1QJJ A;  2OY2 A;  4GF1 A;  3LEA A;  4QKZ A;  1J7N A;  1A85 A;  3F16 A;  4JP4 A;  1ZTQ A;  2AIG P;  3HY9 A;  2SRT A;  1R55 A;  4DD8 A;  1G9K A;  1R1J A;  2AYK A;  1G12 A;  1KBC A;  4GWN A;  4R3V A;  3LQ0 A;  4XBH A;  4H82 A;  1S4B P;  1C8T A;  4DV8 A;  3TS4 A;  1BKC E;  3WV1 A;  5BOT A;  2DDF A;  4H2E A;  1PWQ A;  2X3A A;  3DL1 A;  4ILW D;  3TVC A;  1BSW A;  4L19 A;  1OZ9 A;  4PKW A;  3P1V A;  2X3C A;  1D8M A;  1EB6 A;  3AYK A;  2HU6 A;  5BPA A;  3VTG A;  1IAB A;  3E8R A;  5CUH A;  1GKC A;  3EDI A;  1SLM A;  3F17 A;  1A86 A;  3KHI A;  1C3I A;  4JQG A;  3ZUK A;  1JH1 A;  1IAG A;  1XFW A;  1CK7 A;  1BIW A;  1PWP A;  5D1S A;  1FBL A;  1OS2 A;  1AKL A;  4JPA A;  4IUW A;  3DWB A;  5H8X A;  4XM8 A;  1SAT A;  4H76 A;  4PKT A;  1JIZ A;  3LKA A;  4Q1L A;  1DTH A;  3I7I A;  4JIJ A;  2X7M A;  3NX7 A;  4FU4 A;  3I7G A;  2K9C A;  2JSD A;  2J0T A;  4PKR A;  2RJP A;  1XFU A;  3EHY A;  4CTH A;  1USN A;  4PKQ A;  1BUD A;  1TVI A;  1UTT A;  3HDB A;  3K7L A;  1KUH A;  3DNG A;  3TSK A;  1UTZ A;  5I12 A;  1GE6 A;  4AYK A;  3BA0 A;  1Q3A A;  2FV5 A;  3DSL A;  1R1I A;  3F19 A;  1D8F A;  4WKE A;  1HTD A;  2ERQ A;  2CLT A;  3HBV P;  2KRJ A;  5L79 A;  3L0T A;  1YQY A;  1HV5 A;  3KMC A;  3HYG A;  3RTS A;  3HDA P;  1PWW A;  4PKV A;  1CIZ A;  3N2V A;  1OM6 A;  2TCL A;  1Y8J A;  4A3W A;  1BKC A;  1ZXC A;  2Y6D A;  2V4B A;  1KAP P;  2QPJ A;  1G49 A;  3KWV C;  1JAN A;  2N8R A;  2ERP A;  1ZVX A;  1XUC A;  3AYU A;  5I3M A;  1HY7 A;  1PWV A;  2OZR A;  2JNP A;  1GE7 A;  1GO8 P;  1JIW P;  1Z3J A;  2MZE A;  1UEA A;  966C A;  3EWJ A;  1L6J A;  1K7Q A;  3RTT A;  1ND1 A;  5I2Z A;  1EUB A;  2FV9 A;  4H3X A;  4WK7 A;  1UMS A;  3Q2G A;  1BZS A;  1B3D A;  1OMJ A;  2CKI A;  1RM8 A;  4H1Q A;  1SU3 A;  1XM5 A;  3N2U A;  2MZI A;  2MZH A;  1D7X A;  1OM8 A;  2E3X A;  4IJO A;  1CGL A;  1YCM A;  4IN9 A;  3EDH A;  4PKS A;  1O0Q A;  3GBO A;  1ZP5 A;  1XFX A;  3KEK A;  2E2D A;  4GUY A;  3LIR A;  4I03 A;  3LK8 A;  2JIH A;  1JK3 A;  1GXD A;  1JAP A;  2W0D A;  2USN A;  5D3C A;  2OVZ A;  5D2B A;  1SLN A;  1ROS A;  1WNI A;  5CXA A;  1QIA A;  3LIL A;  4L63 A;  1ZXV A;  2Z2D A;  2POJ A;  2OXU A;  3EDG A;  1B8Y A;  4I35 A;  1IAE A;  1XFZ A;  2OVX A;  3LJT A;  1ATL A;  456C A;  5I0L A;  1D5J A;  5B5O A;  1G05 A;  1I1I P;  1GE5 A;  3LJZ A;  1KUG A;  3LJG A;  1QIB A;  2OXW A;  2MLR A;  3KEJ A;  4FXQ A;  3ELM A;  1IAA A;  2MLS A;  1EAK A;  1JAQ A;  1KUI A;  1MMR A;  3DPE A;  1QJI A;  1AST A;  4EFS A;  1CGE A;  4ON1 A;  1MMB A;  4FXY P;  1DMT A;  3WV3 A;  1AF0 A;  1UMT A;  1YP1 A;  3LQB A;  2A8H A;  1MMQ A;  4J4M A;  1HFC A;  1SRP A;  1JJ9 A;  3KRY A;  1I76 A;  2W14 A;  3DPF A;  2W13 A; 
#chains in the Genus database with same CATH homology
 3V96 B;  3VI1 A;  3LE9 A;  1XFV A;  3G42 A;  1GKD A;  2W15 A;  3B2Z A;  1BQO A;  4G0D A;  4G9L A;  3B8Z A;  3LUM A;  3SHI A;  1XUD A;  1IAD A;  2OW2 A;  3HY7 A;  4XM6 A;  3L0V A;  5B5P A;  4H30 A;  1BUV M;  2L0R A;  3K7N A;  3LIK A;  1BQQ M;  2JT5 A;  1ZS0 A;  1BM6 A;  3TT4 A;  2OW9 A;  2YB9 A;  1FLS A;  2I47 A;  4WZV A;  3F15 A;  1AYK A;  1KUF A;  1MMP A;  1OM7 A;  4GR3 A;  4HX3 A;  4ZR5 A;  2YIG A;  1C7K A;  2DDY A;  1GO7 P;  2OW1 A;  1SMP A;  3HB2 P;  1O0T A;  3EDZ A;  3USN A;  4PKU A;  4WKI A;  1YOU A;  4L7A A;  1RMZ A;  5I43 A;  4XCT A;  3HBU P;  1HFS A;  2WO9 A;  2K2G A;  1CAQ A;  2D1N A;  2YUF A;  2D1O A;  4DPE A;  1QUA A;  2ERO A;  2W12 A;  2OXZ A;  1CQR A;  3LUN A;  4L6T A;  4AXQ A;  1R1H A;  1MNC A;  2OY4 A;  4FVL A;  1PWU A;  3O64 A;  1G4K A;  1KUK A;  3DTI A;  3G5C A;  3F1A A;  2OW0 A;  4GWM A;  2OI0 A;  2RJQ A;  3OHO A;  5LAB A;  1IAC A;  2XS3 A;  4HMA A;  4GQL A;  3WV2 A;  3U1R A;  1K7G A;  4AUO A;  3LGP A;  5L7F A;  1JKY A;  1CXV A;  1CGF A;  2O36 A;  1K7I A;  2DW0 A;  3UVC A;  3DTE A;  2WO8 A;  1BKC I;  2DW2 A;  3CKI A;  1JAO A;  1H71 P;  1HOV A;  5D1T A;  5JMY A;  3AIG A;  1XFY A;  4DF9 A;  5CZM A;  3B92 A;  4GR8 A;  4XM7 A;  3F18 A;  3OHL A;  2X3B A;  4AIG A;  2O3E A;  1OS9 A;  3O2X A;  1FM1 A;  2WOA A;  1R54 A;  3ZVS A;  5D7W A;  4H84 A;  1I73 A;  3DTK A;  2XS4 A;  5D1U A;  3KME A;  3P24 A;  2Y6C A;  1Y93 A;  1OO9 A;  3EHX A;  5I4O A;  3LMC A;  3Q2H A;  3ZXH A;  2DW1 A;  4A7B A;  4GR0 A;  2PJT A;  3MA2 A;  1XUR A;  2JT6 A;  830C A;  1Y0V A;  3KEC A;  4H49 A;  4JA1 A;  5BOY A;  1QIC A;  2J83 A;  4WF6 A;  1QJJ A;  2OY2 A;  4GF1 A;  3LEA A;  4QKZ A;  1J7N A;  1A85 A;  3F16 A;  4JP4 A;  1ZTQ A;  2AIG P;  3HY9 A;  2SRT A;  1R55 A;  4DD8 A;  1G9K A;  1R1J A;  2AYK A;  1G12 A;  1KBC A;  4GWN A;  4R3V A;  3LQ0 A;  4XBH A;  4H82 A;  1S4B P;  1C8T A;  4DV8 A;  3TS4 A;  1BKC E;  3WV1 A;  5BOT A;  2DDF A;  4H2E A;  1PWQ A;  2X3A A;  3DL1 A;  4ILW D;  3TVC A;  1BSW A;  4L19 A;  4PKW A;  3P1V A;  2X3C A;  1D8M A;  1EB6 A;  3AYK A;  2HU6 A;  5BPA A;  3VTG A;  1IAB A;  3E8R A;  5CUH A;  1GKC A;  3EDI A;  1SLM A;  3F17 A;  1A86 A;  3KHI A;  1C3I A;  4JQG A;  3ZUK A;  1JH1 A;  1IAG A;  1XFW A;  1CK7 A;  1BIW A;  1PWP A;  5D1S A;  1FBL A;  1OS2 A;  1AKL A;  4JPA A;  4IUW A;  3DWB A;  5H8X A;  4XM8 A;  1SAT A;  4H76 A;  4PKT A;  1JIZ A;  3LKA A;  4Q1L A;  1DTH A;  3I7I A;  4JIJ A;  2X7M A;  3NX7 A;  4FU4 A;  3I7G A;  2K9C A;  2JSD A;  2J0T A;  4PKR A;  2RJP A;  1XFU A;  3EHY A;  4CTH A;  1USN A;  4PKQ A;  1BUD A;  1UTT A;  3HDB A;  3K7L A;  1KUH A;  3DNG A;  3TSK A;  1UTZ A;  5I12 A;  1GE6 A;  4AYK A;  3BA0 A;  1Q3A A;  2FV5 A;  3DSL A;  1R1I A;  3F19 A;  1D8F A;  4WKE A;  1HTD A;  2ERQ A;  2CLT A;  3HBV P;  2KRJ A;  5L79 A;  3L0T A;  1YQY A;  1HV5 A;  3KMC A;  3HYG A;  3RTS A;  3HDA P;  1PWW A;  4PKV A;  1CIZ A;  3N2V A;  1OM6 A;  2TCL A;  1Y8J A;  4A3W A;  1BKC A;  1ZXC A;  2Y6D A;  2V4B A;  1KAP P;  2QPJ A;  1G49 A;  3KWV C;  1JAN A;  2N8R A;  2ERP A;  1ZVX A;  1XUC A;  3AYU A;  5I3M A;  1HY7 A;  1PWV A;  2OZR A;  2JNP A;  1GE7 A;  1GO8 P;  1JIW P;  1Z3J A;  2MZE A;  1UEA A;  966C A;  3EWJ A;  1L6J A;  1K7Q A;  3RTT A;  1ND1 A;  5I2Z A;  1EUB A;  2FV9 A;  4H3X A;  4WK7 A;  1UMS A;  3Q2G A;  1BZS A;  1B3D A;  1OMJ A;  2CKI A;  1RM8 A;  4H1Q A;  1SU3 A;  3N2U A;  2MZI A;  2MZH A;  1D7X A;  1OM8 A;  2E3X A;  4IJO A;  1CGL A;  1YCM A;  4IN9 A;  3EDH A;  4PKS A;  1O0Q A;  3GBO A;  1ZP5 A;  1XFX A;  3KEK A;  2E2D A;  4GUY A;  3LIR A;  4I03 A;  3LK8 A;  2JIH A;  1JK3 A;  1GXD A;  1JAP A;  2W0D A;  2USN A;  5D3C A;  2OVZ A;  5D2B A;  1SLN A;  1ROS A;  1WNI A;  5CXA A;  1QIA A;  3LIL A;  4L63 A;  1ZXV A;  2Z2D A;  2POJ A;  2OXU A;  3EDG A;  1B8Y A;  4I35 A;  1IAE A;  1XFZ A;  2OVX A;  3LJT A;  1ATL A;  456C A;  5I0L A;  1D5J A;  5B5O A;  1G05 A;  1I1I P;  1GE5 A;  3LJZ A;  1KUG A;  3LJG A;  1QIB A;  2OXW A;  2MLR A;  3KEJ A;  4FXQ A;  3ELM A;  1IAA A;  2MLS A;  1EAK A;  1JAQ A;  1KUI A;  1MMR A;  3DPE A;  1QJI A;  1AST A;  4EFS A;  1CGE A;  4ON1 A;  1MMB A;  4FXY P;  1DMT A;  3WV3 A;  1AF0 A;  1UMT A;  1YP1 A;  3LQB A;  2A8H A;  1MMQ A;  4J4M A;  1HFC A;  1SRP A;  1JJ9 A;  3KRY A;  1I76 A;  2W14 A;  3DPF A;  2W13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...