2W0DA

Does a fast nuclear magnetic resonance spectroscopy- and x-ray crystallography hybrid approach provide reliable structural information of ligand-protein complexes? a case study of metalloproteinases.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title Does a Fast Nuclear Magnetic Resonance Spectroscopy- and X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information of Ligand-Protein Complexes? a Case Study of Metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2w0dA00
1SMPA 1Z3JA 1XFVA 1BM6A 1YCMA 1JK3A 4PKSA 1XUDA 2I47A 1PWUA 1QIAA 5D2BA 4H3XA 4DPEA 1QIBA 3VTGA 1HFSA 3HDAP 2AIGP 3CKIA 2WO8A 5BOTA 5L7FA 3KWVC 3AIGA 4DD8A 1MNCA 3L0VA 3TT4A 3HDBA 2WOAA 1BKCA 3LIRA 4XM7A 1G05A 1IABA 1ND1A 3WV2A 4H2EA 1DTHA 1JKYA 2X3AA 1BIWA 3I7IA 2OW9A 4XM8A 1D8FA 1HY7A 1RM8A 4ILWD 1KAPP 1K7GA 1OS9A 4AIGA 2MZHA 3V96B 1SLMA 966CA 1OS2A 5I0LA 2O3EA 1O0TA 2J0TA 3DWBA 5B5PA 2W12A 1MMPA 1YP1A 4I03A 1R55A 4GR0A 3UVCA 3HY7A 3E8RA 3Q2HA 4AXQA 3P24A 3EDIA 3KECA 1XFXA 1JAOA 1OMJA 3EHYA 2MLSA 3AYUA 3K7LA 1PWQA 3HBVP 2J83A 5CUHA 3KEJA 3I7GA 3EDHA 3EDZA 2OW2A 1SRPA 3LKAA 1IACA 3DNGA 1ASTA 1BUVM 4ON1A 3LEAA 5BPAA 5L79A 2DDYA 2MLRA 2OXZA 4H30A 5D3CA 3F18A 3LK8A 2EROA 1ZXVA 4ZR5A 2A8HA 2DW2A 4GR8A 1GE5A 5I4OA 2FV9A 3OHLA 1CAQA 2E3XA 2POJA 3LILA 3Q2GA 3G42A 4WKIA 2W14A 1KUHA 3F1AA 1ZP5A 2JT6A 4WF6A 1S4BP 3F19A 1PWPA 3TS4A 1FLSA 3TVCA 1KUFA 1R1JA 1OM8A 3ZXHA 1IAEA 4GF1A 3TSKA 1GO7P 2WO9A 1OO9A 1GKDA 3B92A 4HMAA 4FXYP 2OW0A 4PKRA 2W15A 2KRJA 1YOUA 4JPAA 4HX3A 2W0DA 4JIJA 2OY2A 3KMCA 2MZEA 1ZVXA 1XFWA 3DL1A 1R54A 5CXAA 1I1IP 5BOYA 3KMEA 1BUDA 1CK7A 1CQRA 2SRTA 1B8YA 1I76A 4JP4A 2JNPA 2L0RA 1HFCA 3G5CA 3LUMA 5I12A 3KHIA 2RJPA 3EHXA 1G4KA 4L63A 3DPEA 2CLTA 3LQ0A 4H84A 3DPFA 5I2ZA 3MA2A 2OI0A 3F15A 3U1RA 2OZRA 4PKTA 1USNA 3LIKA 2OW1A 3LQBA 3B8ZA 3L0TA 1O0QA 4JA1A 2O36A 4WZVA 1JAPA 456CA 1IAAA 2XS3A 2X3BA 1C7KA 2FV5A 1BKCI 3ZVSA 1BSWA 1EAKA 1PWVA 4PKQA 4EFSA 2Y6CA 1HV5A 4JQGA 3AYKA 3EDGA 3LE9A 2RJQA 4IJOA 1I73A 5D1UA 1L6JA 1G12A 4XCTA 3O64A 1JANA 2YIGA 3NX7A 4A3WA 5H8XA 1MMQA 5D1SA 4A7BA 2QPJA 1GE7A 4WKEA 1GO8P 1CGLA 2AYKA 1QJIA 4AYKA 1IAGA 4H82A 4WK7A 1Y8JA 2DDFA 1Y93A 4FXQA 1CXVA 4GWMA 2JIHA 3F16A 1UEAA 1RMZA 2W13A 2Y6DA 1C8TA 5D1TA 1HTDA 1FBLA 2D1NA 1ZS0A 1XFUA 1B3DA 1DMTA 2OXWA 3GBOA 3BA0A 3KRYA 4L19A 2TCLA 3USNA 1KUIA 1ZTQA 4IN9A 3ZUKA 2USNA 3HBUP 2PJTA 1SU3A 1PWWA 3LJGA 1CGFA 4GR3A 3WV1A 4L6TA 1ROSA 5I43A 4G9LA 2JSDA 1JIZA 4H1QA 1BQQM 4PKWA 1WNIA 1G49A 1SLNA 1AKLA 3HB2P 1YQYA 4CTHA 1A85A 5JMYA 1XURA 1QJJA 1XUCA 3LJTA 2K2GA 2YB9A 4FU4A 5I3MA 3B2ZA 4FVLA 4PKVA 1A86A 3LUNA 3VI1A 1FM1A 3K7NA 1R1IA 1QUAA 1CGEA 1MMBA 2X3CA 4AUOA 2K9CA 2E2DA 2HU6A 1K7IA 2X7MA 1KBCA 1XFYA 4GUYA 5LABA 2DW0A 1UMSA 1J7NA 1ATLA 1JH1A 2OY4A 2MZIA 3F17A 1Q3AA 1OM6A 1Y0VA 2N8RA 1AF0A 2Z2DA 1BZSA 1OM7A 1JIWP 4IUWA 4G0DA 1UTTA 4Q1LA 3WV3A 1D7XA 2ERPA 2ERQA 1H71P 1EUBA 3RTTA 5CZMA 1ZXCA 3N2UA 4XBHA 4H76A 2CKIA 4DF9A 1JAQA 1AYKA 1R1HA 3LMCA 1UTZA 1SATA 1D5JA 4GQLA 2OVZA 2D1OA 1K7QA 1GKCA 2DW1A 2V4BA 1D8MA 1UMTA 4H49A 4PKUA 2XS4A 4GWNA 4R3VA 1GXDA 1CIZA 3ELMA 5D7WA 1EB6A 1C3IA 1IADA 1BQOA 4I35A 3SHIA 1KUKA 3LJZA 1BKCE 3P1VA 3HYGA 1GE6A 3OHOA 4QKZA 1HOVA 3EWJA 2OVXA 4XM6A 1QICA 1MMRA 830CA 1G9KA 2JT5A 3RTSA 1JJ9A 4DV8A 1KUGA 2OXUA 3N2VA 1XFZA 3HY9A 5B5OA 3O2XA 3DSLA 3KEKA 3LGPA 4J4MA
chains in the Genus database with same CATH superfamily
1SMPA 1Z3JA 1XFVA 1BM6A 1YCMA 1JK3A 4PKSA 1XUDA 2I47A 1PWUA 1QIAA 5D2BA 4H3XA 4DPEA 1QIBA 3VTGA 1HFSA 3HDAP 2AIGP 3CKIA 2WO8A 5BOTA 5L7FA 3KWVC 3AIGA 4DD8A 1MNCA 3L0VA 3TT4A 3HDBA 2WOAA 1BKCA 3LIRA 4XM7A 1G05A 1IABA 1ND1A 3WV2A 4H2EA 1DTHA 1JKYA 2X3AA 1BIWA 3I7IA 2OW9A 4XM8A 1D8FA 1HY7A 1RM8A 4ILWD 1KAPP 1K7GA 1OS9A 4AIGA 2MZHA 3V96B 1SLMA 966CA 1OS2A 5I0LA 2O3EA 3DTKA 1O0TA 2J0TA 3DWBA 5B5PA 2W12A 1MMPA 1YP1A 4I03A 1R55A 4GR0A 3UVCA 3HY7A 3E8RA 3Q2HA 4AXQA 3P24A 3EDIA 3KECA 1XFXA 1JAOA 1OMJA 3EHYA 2MLSA 3AYUA 3K7LA 1PWQA 3HBVP 2J83A 5CUHA 3KEJA 3I7GA 3EDHA 3EDZA 2OW2A 1SRPA 3LKAA 1IACA 3DNGA 1ASTA 1BUVM 4ON1A 1XM5A 3LEAA 5BPAA 5L79A 2DDYA 2MLRA 2OXZA 4H30A 5D3CA 3F18A 3LK8A 2EROA 1ZXVA 4ZR5A 2A8HA 2DW2A 4GR8A 1GE5A 5I4OA 1TVIA 2FV9A 3OHLA 1CAQA 2E3XA 2POJA 3LILA 3Q2GA 3G42A 4WKIA 2W14A 1KUHA 3F1AA 1ZP5A 2JT6A 4WF6A 1S4BP 3F19A 1PWPA 3TS4A 1OZ9A 1FLSA 3TVCA 1KUFA 1R1JA 1OM8A 3ZXHA 1IAEA 4GF1A 3TSKA 1GO7P 2WO9A 1OO9A 1XAXA 1GKDA 3B92A 4HMAA 4FXYP 2OW0A 4PKRA 2W15A 2KRJA 1YOUA 4JPAA 4HX3A 2W0DA 4JIJA 2OY2A 3KMCA 2MZEA 1ZVXA 1XFWA 3DL1A 1R54A 5CXAA 1I1IP 5BOYA 3KMEA 1BUDA 1CK7A 1CQRA 2SRTA 1B8YA 1I76A 4JP4A 2JNPA 2L0RA 1HFCA 3G5CA 3LUMA 5I12A 3KHIA 2RJPA 3EHXA 1G4KA 4L63A 3DPEA 2CLTA 3LQ0A 4H84A 3DPFA 5I2ZA 3MA2A 2OI0A 3F15A 3U1RA 2OZRA 4PKTA 1USNA 3LIKA 2OW1A 3LQBA 3B8ZA 3L0TA 1O0QA 4JA1A 2O36A 4WZVA 1JAPA 456CA 1IAAA 2XS3A 2X3BA 1C7KA 2FV5A 1BKCI 3ZVSA 1BSWA 1EAKA 1PWVA 4PKQA 4EFSA 2Y6CA 1HV5A 4JQGA 3AYKA 3EDGA 3LE9A 2RJQA 4IJOA 1I73A 5D1UA 1L6JA 1G12A 4XCTA 3O64A 1JANA 2YIGA 3NX7A 4A3WA 5H8XA 1MMQA 5D1SA 4A7BA 2QPJA 1GE7A 4WKEA 1GO8P 1CGLA 2AYKA 1QJIA 4AYKA 1IAGA 4H82A 4WK7A 1Y8JA 2DDFA 1Y93A 4FXQA 1CXVA 4GWMA 2JIHA 3F16A 1UEAA 1RMZA 2W13A 2Y6DA 1C8TA 5D1TA 1HTDA 1FBLA 2D1NA 1ZS0A 1XFUA 1B3DA 1DMTA 2OXWA 3GBOA 3BA0A 3KRYA 4L19A 2TCLA 3USNA 1KUIA 1ZTQA 4IN9A 3ZUKA 2USNA 3HBUP 2PJTA 1SU3A 1PWWA 3LJGA 1CGFA 4GR3A 3WV1A 3DTIA 4L6TA 1ROSA 5I43A 4G9LA 2JSDA 1JIZA 4H1QA 1BQQM 4PKWA 1WNIA 1G49A 1SLNA 1AKLA 3HB2P 1YQYA 4CTHA 1A85A 5JMYA 1XURA 1QJJA 1XUCA 3LJTA 2K2GA 2YB9A 4FU4A 5I3MA 3B2ZA 4FVLA 4PKVA 1A86A 3LUNA 3VI1A 1FM1A 3K7NA 1R1IA 1QUAA 1CGEA 1MMBA 2X3CA 4AUOA 2K9CA 2E2DA 2HU6A 1K7IA 2X7MA 1KBCA 1XFYA 4GUYA 5LABA 2DW0A 1UMSA 1J7NA 1ATLA 1JH1A 2OY4A 2MZIA 3F17A 1Q3AA 1OM6A 1Y0VA 2N8RA 1AF0A 2Z2DA 1BZSA 1OM7A 1JIWP 4IUWA 4G0DA 1UTTA 4Q1LA 3WV3A 1D7XA 2ERPA 2ERQA 1H71P 1EUBA 3RTTA 5CZMA 1ZXCA 3N2UA 4XBHA 4H76A 2CKIA 4DF9A 1JAQA 1AYKA 1R1HA 3LMCA 1UTZA 1SATA 1D5JA 2YUFA 4GQLA 2OVZA 2D1OA 1K7QA 1GKCA 2DW1A 2V4BA 1D8MA 1UMTA 4H49A 4PKUA 2XS4A 4GWNA 4R3VA 1GXDA 4L7AA 1CIZA 3ELMA 5D7WA 1EB6A 1C3IA 1IADA 1BQOA 4I35A 3SHIA 1KUKA 3LJZA 1BKCE 3P1VA 3HYGA 1GE6A 3OHOA 4QKZA 1HOVA 3DTEA 3EWJA 2OVXA 4XM6A 1QICA 1MMRA 830CA 1G9KA 2JT5A 3RTSA 1JJ9A 4DV8A 1KUGA 2OXUA 3N2VA 1XFZA 3HY9A 5B5OA 3O2XA 3DSLA 3KEKA 3LGPA 4J4MA
chains in the Genus database with same CATH topology
1SMPA 1Z3JA 1XFVA 1BM6A 1YCMA 1JK3A 4PKSA 1XUDA 2I47A 1PWUA 1QIAA 5D2BA 4H3XA 4DPEA 1QIBA 3VTGA 1HFSA 3HDAP 2AIGP 3CKIA 2WO8A 5BOTA 5L7FA 3KWVC 3AIGA 4DD8A 1MNCA 3L0VA 3TT4A 3HDBA 2WOAA 1BKCA 3LIRA 4XM7A 1G05A 1IABA 1ND1A 3WV2A 4H2EA 1DTHA 1JKYA 2X3AA 1BIWA 3I7IA 2OW9A 4XM8A 1D8FA 1HY7A 1RM8A 4ILWD 1KAPP 1K7GA 1OS9A 4AIGA 2MZHA 3V96B 1SLMA 966CA 1OS2A 5I0LA 2O3EA 3DTKA 1O0TA 2J0TA 3DWBA 5B5PA 2W12A 1MMPA 1YP1A 4I03A 1R55A 4GR0A 3UVCA 3HY7A 3E8RA 3Q2HA 4AXQA 3P24A 3EDIA 3KECA 1XFXA 1JAOA 1OMJA 3EHYA 2MLSA 3AYUA 3K7LA 1PWQA 3HBVP 2J83A 5CUHA 3KEJA 3I7GA 3EDHA 3EDZA 2OW2A 1SRPA 3LKAA 1IACA 3DNGA 1ASTA 1BUVM 4ON1A 3LEAA 5BPAA 5L79A 2DDYA 2MLRA 2OXZA 4H30A 5D3CA 3F18A 3LK8A 2EROA 1ZXVA 4ZR5A 2A8HA 2DW2A 4GR8A 1GE5A 5I4OA 2FV9A 3OHLA 1CAQA 2E3XA 2POJA 3LILA 3Q2GA 3G42A 4WKIA 2W14A 1KUHA 3F1AA 1ZP5A 2JT6A 4WF6A 1S4BP 3F19A 1PWPA 3TS4A 1FLSA 3TVCA 1KUFA 1R1JA 1OM8A 3ZXHA 1IAEA 4GF1A 3TSKA 1GO7P 2WO9A 1OO9A 1GKDA 3B92A 4HMAA 4FXYP 2OW0A 4PKRA 2W15A 2KRJA 1YOUA 4JPAA 4HX3A 2W0DA 4JIJA 2OY2A 3KMCA 2MZEA 1ZVXA 1XFWA 3DL1A 1R54A 5CXAA 1I1IP 5BOYA 3KMEA 1BUDA 1CK7A 1CQRA 2SRTA 1B8YA 1I76A 4JP4A 2JNPA 2L0RA 1HFCA 3G5CA 3LUMA 5I12A 3KHIA 2RJPA 3EHXA 1G4KA 4L63A 3DPEA 2CLTA 3LQ0A 4H84A 3DPFA 5I2ZA 3MA2A 2OI0A 3F15A 3U1RA 2OZRA 4PKTA 1USNA 3LIKA 2OW1A 3LQBA 3B8ZA 3L0TA 1O0QA 4JA1A 2O36A 4WZVA 1JAPA 456CA 1IAAA 2XS3A 2X3BA 1C7KA 2FV5A 1BKCI 3ZVSA 1BSWA 1EAKA 1PWVA 4PKQA 4EFSA 2Y6CA 1HV5A 4JQGA 3AYKA 3EDGA 3LE9A 2RJQA 4IJOA 1I73A 5D1UA 1L6JA 1G12A 4XCTA 3O64A 1JANA 2YIGA 3NX7A 4A3WA 5H8XA 1MMQA 5D1SA 4A7BA 2QPJA 1GE7A 4WKEA 1GO8P 1CGLA 2AYKA 1QJIA 4AYKA 1IAGA 4H82A 4WK7A 1Y8JA 2DDFA 1Y93A 4FXQA 1CXVA 4GWMA 2JIHA 3F16A 1UEAA 1RMZA 2W13A 2Y6DA 1C8TA 5D1TA 1HTDA 1FBLA 2D1NA 1ZS0A 1XFUA 1B3DA 1DMTA 2OXWA 3GBOA 3BA0A 3KRYA 4L19A 2TCLA 3USNA 1KUIA 1ZTQA 4IN9A 3ZUKA 2USNA 3HBUP 2PJTA 1SU3A 1PWWA 3LJGA 1CGFA 4GR3A 3WV1A 3DTIA 4L6TA 1ROSA 5I43A 4G9LA 2JSDA 1JIZA 4H1QA 1BQQM 4PKWA 1WNIA 1G49A 1SLNA 1AKLA 3HB2P 1YQYA 4CTHA 1A85A 5JMYA 1XURA 1QJJA 1XUCA 3LJTA 2K2GA 2YB9A 4FU4A 5I3MA 3B2ZA 4FVLA 4PKVA 1A86A 3LUNA 3VI1A 1FM1A 3K7NA 1R1IA 1QUAA 1CGEA 1MMBA 2X3CA 4AUOA 2K9CA 2E2DA 2HU6A 1K7IA 2X7MA 1KBCA 1XFYA 4GUYA 5LABA 2DW0A 1UMSA 1J7NA 1ATLA 1JH1A 2OY4A 2MZIA 3F17A 1Q3AA 1OM6A 1Y0VA 2N8RA 1AF0A 2Z2DA 1BZSA 1OM7A 1JIWP 4IUWA 4G0DA 1UTTA 4Q1LA 3WV3A 1D7XA 2ERPA 2ERQA 1H71P 1EUBA 3RTTA 5CZMA 1ZXCA 3N2UA 4XBHA 4H76A 2CKIA 4DF9A 1JAQA 1AYKA 1R1HA 3LMCA 1UTZA 1SATA 1D5JA 2YUFA 4GQLA 2OVZA 2D1OA 1K7QA 1GKCA 2DW1A 2V4BA 1D8MA 1UMTA 4H49A 4PKUA 2XS4A 4GWNA 4R3VA 1GXDA 4L7AA 1CIZA 3ELMA 5D7WA 1EB6A 1C3IA 1IADA 1BQOA 4I35A 3SHIA 1KUKA 3LJZA 1BKCE 3P1VA 3HYGA 1GE6A 3OHOA 4QKZA 1HOVA 3DTEA 3EWJA 2OVXA 4XM6A 1QICA 1MMRA 830CA 1G9KA 2JT5A 3RTSA 1JJ9A 4DV8A 1KUGA 2OXUA 3N2VA 1XFZA 3HY9A 5B5OA 3O2XA 3DSLA 3KEKA 3LGPA 4J4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMP A;  1Z3J A;  1XFV A;  1BM6 A;  1YCM A;  1JK3 A;  4PKS A;  1XUD A;  2I47 A;  1PWU A;  1QIA A;  5D2B A;  4H3X A;  4DPE A;  1QIB A;  3VTG A;  1HFS A;  3HDA P;  2AIG P;  3CKI A;  2WO8 A;  5BOT A;  5L7F A;  3KWV C;  3AIG A;  4DD8 A;  1MNC A;  3L0V A;  3TT4 A;  3HDB A;  2WOA A;  1BKC A;  3LIR A;  4XM7 A;  1G05 A;  1IAB A;  1ND1 A;  3WV2 A;  4H2E A;  1DTH A;  1JKY A;  2X3A A;  1BIW A;  3I7I A;  2OW9 A;  4XM8 A;  1D8F A;  1HY7 A;  1RM8 A;  4ILW D;  1KAP P;  1K7G A;  1OS9 A;  4AIG A;  2MZH A;  3V96 B;  1SLM A;  966C A;  1OS2 A;  5I0L A;  2O3E A;  1O0T A;  2J0T A;  3DWB A;  5B5P A;  2W12 A;  1MMP A;  1YP1 A;  4I03 A;  1R55 A;  4GR0 A;  3UVC A;  3HY7 A;  3E8R A;  3Q2H A;  4AXQ A;  3P24 A;  3EDI A;  3KEC A;  1XFX A;  1JAO A;  1OMJ A;  3EHY A;  2MLS A;  3AYU A;  3K7L A;  1PWQ A;  3HBV P;  2J83 A;  5CUH A;  3KEJ A;  3I7G A;  3EDH A;  3EDZ A;  2OW2 A;  1SRP A;  3LKA A;  1IAC A;  3DNG A;  1AST A;  1BUV M;  4ON1 A;  3LEA A;  5BPA A;  5L79 A;  2DDY A;  2MLR A;  2OXZ A;  4H30 A;  5D3C A;  3F18 A;  3LK8 A;  2ERO A;  1ZXV A;  4ZR5 A;  2A8H A;  2DW2 A;  4GR8 A;  1GE5 A;  5I4O A;  2FV9 A;  3OHL A;  1CAQ A;  2E3X A;  2POJ A;  3LIL A;  3Q2G A;  3G42 A;  4WKI A;  2W14 A;  1KUH A;  3F1A A;  1ZP5 A;  2JT6 A;  4WF6 A;  1S4B P;  3F19 A;  1PWP A;  3TS4 A;  1FLS A;  3TVC A;  1KUF A;  1R1J A;  1OM8 A;  3ZXH A;  1IAE A;  4GF1 A;  3TSK A;  1GO7 P;  2WO9 A;  1OO9 A;  1GKD A;  3B92 A;  4HMA A;  4FXY P;  2OW0 A;  4PKR A;  2W15 A;  2KRJ A;  1YOU A;  4JPA A;  4HX3 A;  2W0D A;  4JIJ A;  2OY2 A;  3KMC A;  2MZE A;  1ZVX A;  1XFW A;  3DL1 A;  1R54 A;  5CXA A;  1I1I P;  5BOY A;  3KME A;  1BUD A;  1CK7 A;  1CQR A;  2SRT A;  1B8Y A;  1I76 A;  4JP4 A;  2JNP A;  2L0R A;  1HFC A;  3G5C A;  3LUM A;  5I12 A;  3KHI A;  2RJP A;  3EHX A;  1G4K A;  4L63 A;  3DPE A;  2CLT A;  3LQ0 A;  4H84 A;  3DPF A;  5I2Z A;  3MA2 A;  2OI0 A;  3F15 A;  3U1R A;  2OZR A;  4PKT A;  1USN A;  3LIK A;  2OW1 A;  3LQB A;  3B8Z A;  3L0T A;  1O0Q A;  4JA1 A;  2O36 A;  4WZV A;  1JAP A;  456C A;  1IAA A;  2XS3 A;  2X3B A;  1C7K A;  2FV5 A;  1BKC I;  3ZVS A;  1BSW A;  1EAK A;  1PWV A;  4PKQ A;  4EFS A;  2Y6C A;  1HV5 A;  4JQG A;  3AYK A;  3EDG A;  3LE9 A;  2RJQ A;  4IJO A;  1I73 A;  5D1U A;  1L6J A;  1G12 A;  4XCT A;  3O64 A;  1JAN A;  2YIG A;  3NX7 A;  4A3W A;  5H8X A;  1MMQ A;  5D1S A;  4A7B A;  2QPJ A;  1GE7 A;  4WKE A;  1GO8 P;  1CGL A;  2AYK A;  1QJI A;  4AYK A;  1IAG A;  4H82 A;  4WK7 A;  1Y8J A;  2DDF A;  1Y93 A;  4FXQ A;  1CXV A;  4GWM A;  2JIH A;  3F16 A;  1UEA A;  1RMZ A;  2W13 A;  2Y6D A;  1C8T A;  5D1T A;  1HTD A;  1FBL A;  2D1N A;  1ZS0 A;  1XFU A;  1B3D A;  1DMT A;  2OXW A;  3GBO A;  3BA0 A;  3KRY A;  4L19 A;  2TCL A;  3USN A;  1KUI A;  1ZTQ A;  4IN9 A;  3ZUK A;  2USN A;  3HBU P;  2PJT A;  1SU3 A;  1PWW A;  3LJG A;  1CGF A;  4GR3 A;  3WV1 A;  4L6T A;  1ROS A;  5I43 A;  4G9L A;  2JSD A;  1JIZ A;  4H1Q A;  1BQQ M;  4PKW A;  1WNI A;  1G49 A;  1SLN A;  1AKL A;  3HB2 P;  1YQY A;  4CTH A;  1A85 A;  5JMY A;  1XUR A;  1QJJ A;  1XUC A;  3LJT A;  2K2G A;  2YB9 A;  4FU4 A;  5I3M A;  3B2Z A;  4FVL A;  4PKV A;  1A86 A;  3LUN A;  3VI1 A;  1FM1 A;  3K7N A;  1R1I A;  1QUA A;  1CGE A;  1MMB A;  2X3C A;  4AUO A;  2K9C A;  2E2D A;  2HU6 A;  1K7I A;  2X7M A;  1KBC A;  1XFY A;  4GUY A;  5LAB A;  2DW0 A;  1UMS A;  1J7N A;  1ATL A;  1JH1 A;  2OY4 A;  2MZI A;  3F17 A;  1Q3A A;  1OM6 A;  1Y0V A;  2N8R A;  1AF0 A;  2Z2D A;  1BZS A;  1OM7 A;  1JIW P;  4IUW A;  4G0D A;  1UTT A;  4Q1L A;  3WV3 A;  1D7X A;  2ERP A;  2ERQ A;  1H71 P;  1EUB A;  3RTT A;  5CZM A;  1ZXC A;  3N2U A;  4XBH A;  4H76 A;  2CKI A;  4DF9 A;  1JAQ A;  1AYK A;  1R1H A;  3LMC A;  1UTZ A;  1SAT A;  1D5J A;  4GQL A;  2OVZ A;  2D1O A;  1K7Q A;  1GKC A;  2DW1 A;  2V4B A;  1D8M A;  1UMT A;  4H49 A;  4PKU A;  2XS4 A;  4GWN A;  4R3V A;  1GXD A;  1CIZ A;  3ELM A;  5D7W A;  1EB6 A;  1C3I A;  1IAD A;  1BQO A;  4I35 A;  3SHI A;  1KUK A;  3LJZ A;  1BKC E;  3P1V A;  3HYG A;  1GE6 A;  3OHO A;  4QKZ A;  1HOV A;  3EWJ A;  2OVX A;  4XM6 A;  1QIC A;  1MMR A;  830C A;  1G9K A;  2JT5 A;  3RTS A;  1JJ9 A;  4DV8 A;  1KUG A;  2OXU A;  3N2V A;  1XFZ A;  3HY9 A;  5B5O A;  3O2X A;  3DSL A;  3KEK A;  3LGP A;  4J4M A; 
#chains in the Genus database with same CATH topology
 1SMP A;  1Z3J A;  1XFV A;  1BM6 A;  1YCM A;  1JK3 A;  4PKS A;  1XUD A;  2I47 A;  1PWU A;  1QIA A;  5D2B A;  4H3X A;  4DPE A;  1QIB A;  3VTG A;  1HFS A;  3HDA P;  2AIG P;  3CKI A;  2WO8 A;  5BOT A;  5L7F A;  3KWV C;  3AIG A;  4DD8 A;  1MNC A;  3L0V A;  3TT4 A;  3HDB A;  2WOA A;  1BKC A;  3LIR A;  4XM7 A;  1G05 A;  1IAB A;  1ND1 A;  3WV2 A;  4H2E A;  1DTH A;  1JKY A;  2X3A A;  1BIW A;  3I7I A;  2OW9 A;  4XM8 A;  1D8F A;  1HY7 A;  1RM8 A;  4ILW D;  1KAP P;  1K7G A;  1OS9 A;  4AIG A;  2MZH A;  3V96 B;  1SLM A;  966C A;  1OS2 A;  5I0L A;  2O3E A;  3DTK A;  1O0T A;  2J0T A;  3DWB A;  5B5P A;  2W12 A;  1MMP A;  1YP1 A;  4I03 A;  1R55 A;  4GR0 A;  3UVC A;  3HY7 A;  3E8R A;  3Q2H A;  4AXQ A;  3P24 A;  3EDI A;  3KEC A;  1XFX A;  1JAO A;  1OMJ A;  3EHY A;  2MLS A;  3AYU A;  3K7L A;  1PWQ A;  3HBV P;  2J83 A;  5CUH A;  3KEJ A;  3I7G A;  3EDH A;  3EDZ A;  2OW2 A;  1SRP A;  3LKA A;  1IAC A;  3DNG A;  1AST A;  1BUV M;  4ON1 A;  1XM5 A;  3LEA A;  5BPA A;  5L79 A;  2DDY A;  2MLR A;  2OXZ A;  4H30 A;  5D3C A;  3F18 A;  3LK8 A;  2ERO A;  1ZXV A;  4ZR5 A;  2A8H A;  2DW2 A;  4GR8 A;  1GE5 A;  5I4O A;  1TVI A;  2FV9 A;  3OHL A;  1CAQ A;  2E3X A;  2POJ A;  3LIL A;  3Q2G A;  3G42 A;  4WKI A;  2W14 A;  1KUH A;  3F1A A;  1ZP5 A;  2JT6 A;  4WF6 A;  1S4B P;  3F19 A;  1PWP A;  3TS4 A;  1OZ9 A;  1FLS A;  3TVC A;  1KUF A;  1R1J A;  1OM8 A;  3ZXH A;  1IAE A;  4GF1 A;  3TSK A;  1GO7 P;  2WO9 A;  1OO9 A;  1XAX A;  1GKD A;  3B92 A;  4HMA A;  4FXY P;  2OW0 A;  4PKR A;  2W15 A;  2KRJ A;  1YOU A;  4JPA A;  4HX3 A;  2W0D A;  4JIJ A;  2OY2 A;  3KMC A;  2MZE A;  1ZVX A;  1XFW A;  3DL1 A;  1R54 A;  5CXA A;  1I1I P;  5BOY A;  3KME A;  1BUD A;  1CK7 A;  1CQR A;  2SRT A;  1B8Y A;  1I76 A;  4JP4 A;  2JNP A;  2L0R A;  1HFC A;  3G5C A;  3LUM A;  5I12 A;  3KHI A;  2RJP A;  3EHX A;  1G4K A;  4L63 A;  3DPE A;  2CLT A;  3LQ0 A;  4H84 A;  3DPF A;  5I2Z A;  3MA2 A;  2OI0 A;  3F15 A;  3U1R A;  2OZR A;  4PKT A;  1USN A;  3LIK A;  2OW1 A;  3LQB A;  3B8Z A;  3L0T A;  1O0Q A;  4JA1 A;  2O36 A;  4WZV A;  1JAP A;  456C A;  1IAA A;  2XS3 A;  2X3B A;  1C7K A;  2FV5 A;  1BKC I;  3ZVS A;  1BSW A;  1EAK A;  1PWV A;  4PKQ A;  4EFS A;  2Y6C A;  1HV5 A;  4JQG A;  3AYK A;  3EDG A;  3LE9 A;  2RJQ A;  4IJO A;  1I73 A;  5D1U A;  1L6J A;  1G12 A;  4XCT A;  3O64 A;  1JAN A;  2YIG A;  3NX7 A;  4A3W A;  5H8X A;  1MMQ A;  5D1S A;  4A7B A;  2QPJ A;  1GE7 A;  4WKE A;  1GO8 P;  1CGL A;  2AYK A;  1QJI A;  4AYK A;  1IAG A;  4H82 A;  4WK7 A;  1Y8J A;  2DDF A;  1Y93 A;  4FXQ A;  1CXV A;  4GWM A;  2JIH A;  3F16 A;  1UEA A;  1RMZ A;  2W13 A;  2Y6D A;  1C8T A;  5D1T A;  1HTD A;  1FBL A;  2D1N A;  1ZS0 A;  1XFU A;  1B3D A;  1DMT A;  2OXW A;  3GBO A;  3BA0 A;  3KRY A;  4L19 A;  2TCL A;  3USN A;  1KUI A;  1ZTQ A;  4IN9 A;  3ZUK A;  2USN A;  3HBU P;  2PJT A;  1SU3 A;  1PWW A;  3LJG A;  1CGF A;  4GR3 A;  3WV1 A;  3DTI A;  4L6T A;  1ROS A;  5I43 A;  4G9L A;  2JSD A;  1JIZ A;  4H1Q A;  1BQQ M;  4PKW A;  1WNI A;  1G49 A;  1SLN A;  1AKL A;  3HB2 P;  1YQY A;  4CTH A;  1A85 A;  5JMY A;  1XUR A;  1QJJ A;  1XUC A;  3LJT A;  2K2G A;  2YB9 A;  4FU4 A;  5I3M A;  3B2Z A;  4FVL A;  4PKV A;  1A86 A;  3LUN A;  3VI1 A;  1FM1 A;  3K7N A;  1R1I A;  1QUA A;  1CGE A;  1MMB A;  2X3C A;  4AUO A;  2K9C A;  2E2D A;  2HU6 A;  1K7I A;  2X7M A;  1KBC A;  1XFY A;  4GUY A;  5LAB A;  2DW0 A;  1UMS A;  1J7N A;  1ATL A;  1JH1 A;  2OY4 A;  2MZI A;  3F17 A;  1Q3A A;  1OM6 A;  1Y0V A;  2N8R A;  1AF0 A;  2Z2D A;  1BZS A;  1OM7 A;  1JIW P;  4IUW A;  4G0D A;  1UTT A;  4Q1L A;  3WV3 A;  1D7X A;  2ERP A;  2ERQ A;  1H71 P;  1EUB A;  3RTT A;  5CZM A;  1ZXC A;  3N2U A;  4XBH A;  4H76 A;  2CKI A;  4DF9 A;  1JAQ A;  1AYK A;  1R1H A;  3LMC A;  1UTZ A;  1SAT A;  1D5J A;  2YUF A;  4GQL A;  2OVZ A;  2D1O A;  1K7Q A;  1GKC A;  2DW1 A;  2V4B A;  1D8M A;  1UMT A;  4H49 A;  4PKU A;  2XS4 A;  4GWN A;  4R3V A;  1GXD A;  4L7A A;  1CIZ A;  3ELM A;  5D7W A;  1EB6 A;  1C3I A;  1IAD A;  1BQO A;  4I35 A;  3SHI A;  1KUK A;  3LJZ A;  1BKC E;  3P1V A;  3HYG A;  1GE6 A;  3OHO A;  4QKZ A;  1HOV A;  3DTE A;  3EWJ A;  2OVX A;  4XM6 A;  1QIC A;  1MMR A;  830C A;  1G9K A;  2JT5 A;  3RTS A;  1JJ9 A;  4DV8 A;  1KUG A;  2OXU A;  3N2V A;  1XFZ A;  3HY9 A;  5B5O A;  3O2X A;  3DSL A;  3KEK A;  3LGP A;  4J4M A; 
#chains in the Genus database with same CATH homology
 1SMP A;  1Z3J A;  1XFV A;  1BM6 A;  1YCM A;  1JK3 A;  4PKS A;  1XUD A;  2I47 A;  1PWU A;  1QIA A;  5D2B A;  4H3X A;  4DPE A;  1QIB A;  3VTG A;  1HFS A;  3HDA P;  2AIG P;  3CKI A;  2WO8 A;  5BOT A;  5L7F A;  3KWV C;  3AIG A;  4DD8 A;  1MNC A;  3L0V A;  3TT4 A;  3HDB A;  2WOA A;  1BKC A;  3LIR A;  4XM7 A;  1G05 A;  1IAB A;  1ND1 A;  3WV2 A;  4H2E A;  1DTH A;  1JKY A;  2X3A A;  1BIW A;  3I7I A;  2OW9 A;  4XM8 A;  1D8F A;  1HY7 A;  1RM8 A;  4ILW D;  1KAP P;  1K7G A;  1OS9 A;  4AIG A;  2MZH A;  3V96 B;  1SLM A;  966C A;  1OS2 A;  5I0L A;  2O3E A;  3DTK A;  1O0T A;  2J0T A;  3DWB A;  5B5P A;  2W12 A;  1MMP A;  1YP1 A;  4I03 A;  1R55 A;  4GR0 A;  3UVC A;  3HY7 A;  3E8R A;  3Q2H A;  4AXQ A;  3P24 A;  3EDI A;  3KEC A;  1XFX A;  1JAO A;  1OMJ A;  3EHY A;  2MLS A;  3AYU A;  3K7L A;  1PWQ A;  3HBV P;  2J83 A;  5CUH A;  3KEJ A;  3I7G A;  3EDH A;  3EDZ A;  2OW2 A;  1SRP A;  3LKA A;  1IAC A;  3DNG A;  1AST A;  1BUV M;  4ON1 A;  3LEA A;  5BPA A;  5L79 A;  2DDY A;  2MLR A;  2OXZ A;  4H30 A;  5D3C A;  3F18 A;  3LK8 A;  2ERO A;  1ZXV A;  4ZR5 A;  2A8H A;  2DW2 A;  4GR8 A;  1GE5 A;  5I4O A;  2FV9 A;  3OHL A;  1CAQ A;  2E3X A;  2POJ A;  3LIL A;  3Q2G A;  3G42 A;  4WKI A;  2W14 A;  1KUH A;  3F1A A;  1ZP5 A;  2JT6 A;  4WF6 A;  1S4B P;  3F19 A;  1PWP A;  3TS4 A;  1FLS A;  3TVC A;  1KUF A;  1R1J A;  1OM8 A;  3ZXH A;  1IAE A;  4GF1 A;  3TSK A;  1GO7 P;  2WO9 A;  1OO9 A;  1GKD A;  3B92 A;  4HMA A;  4FXY P;  2OW0 A;  4PKR A;  2W15 A;  2KRJ A;  1YOU A;  4JPA A;  4HX3 A;  2W0D A;  4JIJ A;  2OY2 A;  3KMC A;  2MZE A;  1ZVX A;  1XFW A;  3DL1 A;  1R54 A;  5CXA A;  1I1I P;  5BOY A;  3KME A;  1BUD A;  1CK7 A;  1CQR A;  2SRT A;  1B8Y A;  1I76 A;  4JP4 A;  2JNP A;  2L0R A;  1HFC A;  3G5C A;  3LUM A;  5I12 A;  3KHI A;  2RJP A;  3EHX A;  1G4K A;  4L63 A;  3DPE A;  2CLT A;  3LQ0 A;  4H84 A;  3DPF A;  5I2Z A;  3MA2 A;  2OI0 A;  3F15 A;  3U1R A;  2OZR A;  4PKT A;  1USN A;  3LIK A;  2OW1 A;  3LQB A;  3B8Z A;  3L0T A;  1O0Q A;  4JA1 A;  2O36 A;  4WZV A;  1JAP A;  456C A;  1IAA A;  2XS3 A;  2X3B A;  1C7K A;  2FV5 A;  1BKC I;  3ZVS A;  1BSW A;  1EAK A;  1PWV A;  4PKQ A;  4EFS A;  2Y6C A;  1HV5 A;  4JQG A;  3AYK A;  3EDG A;  3LE9 A;  2RJQ A;  4IJO A;  1I73 A;  5D1U A;  1L6J A;  1G12 A;  4XCT A;  3O64 A;  1JAN A;  2YIG A;  3NX7 A;  4A3W A;  5H8X A;  1MMQ A;  5D1S A;  4A7B A;  2QPJ A;  1GE7 A;  4WKE A;  1GO8 P;  1CGL A;  2AYK A;  1QJI A;  4AYK A;  1IAG A;  4H82 A;  4WK7 A;  1Y8J A;  2DDF A;  1Y93 A;  4FXQ A;  1CXV A;  4GWM A;  2JIH A;  3F16 A;  1UEA A;  1RMZ A;  2W13 A;  2Y6D A;  1C8T A;  5D1T A;  1HTD A;  1FBL A;  2D1N A;  1ZS0 A;  1XFU A;  1B3D A;  1DMT A;  2OXW A;  3GBO A;  3BA0 A;  3KRY A;  4L19 A;  2TCL A;  3USN A;  1KUI A;  1ZTQ A;  4IN9 A;  3ZUK A;  2USN A;  3HBU P;  2PJT A;  1SU3 A;  1PWW A;  3LJG A;  1CGF A;  4GR3 A;  3WV1 A;  3DTI A;  4L6T A;  1ROS A;  5I43 A;  4G9L A;  2JSD A;  1JIZ A;  4H1Q A;  1BQQ M;  4PKW A;  1WNI A;  1G49 A;  1SLN A;  1AKL A;  3HB2 P;  1YQY A;  4CTH A;  1A85 A;  5JMY A;  1XUR A;  1QJJ A;  1XUC A;  3LJT A;  2K2G A;  2YB9 A;  4FU4 A;  5I3M A;  3B2Z A;  4FVL A;  4PKV A;  1A86 A;  3LUN A;  3VI1 A;  1FM1 A;  3K7N A;  1R1I A;  1QUA A;  1CGE A;  1MMB A;  2X3C A;  4AUO A;  2K9C A;  2E2D A;  2HU6 A;  1K7I A;  2X7M A;  1KBC A;  1XFY A;  4GUY A;  5LAB A;  2DW0 A;  1UMS A;  1J7N A;  1ATL A;  1JH1 A;  2OY4 A;  2MZI A;  3F17 A;  1Q3A A;  1OM6 A;  1Y0V A;  2N8R A;  1AF0 A;  2Z2D A;  1BZS A;  1OM7 A;  1JIW P;  4IUW A;  4G0D A;  1UTT A;  4Q1L A;  3WV3 A;  1D7X A;  2ERP A;  2ERQ A;  1H71 P;  1EUB A;  3RTT A;  5CZM A;  1ZXC A;  3N2U A;  4XBH A;  4H76 A;  2CKI A;  4DF9 A;  1JAQ A;  1AYK A;  1R1H A;  3LMC A;  1UTZ A;  1SAT A;  1D5J A;  2YUF A;  4GQL A;  2OVZ A;  2D1O A;  1K7Q A;  1GKC A;  2DW1 A;  2V4B A;  1D8M A;  1UMT A;  4H49 A;  4PKU A;  2XS4 A;  4GWN A;  4R3V A;  1GXD A;  4L7A A;  1CIZ A;  3ELM A;  5D7W A;  1EB6 A;  1C3I A;  1IAD A;  1BQO A;  4I35 A;  3SHI A;  1KUK A;  3LJZ A;  1BKC E;  3P1V A;  3HYG A;  1GE6 A;  3OHO A;  4QKZ A;  1HOV A;  3DTE A;  3EWJ A;  2OVX A;  4XM6 A;  1QIC A;  1MMR A;  830C A;  1G9K A;  2JT5 A;  3RTS A;  1JJ9 A;  4DV8 A;  1KUG A;  2OXU A;  3N2V A;  1XFZ A;  3HY9 A;  5B5O A;  3O2X A;  3DSL A;  3KEK A;  3LGP A;  4J4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...