2W0DA

Does a fast nuclear magnetic resonance spectroscopy- and x-ray crystallography hybrid approach provide reliable structural information of ligand-protein complexes? a case study of metalloproteinases.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title Does a Fast Nuclear Magnetic Resonance Spectroscopy- and X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information of Ligand-Protein Complexes? a Case Study of Metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2w0dA00
4PKQA 1B3DA 1KUGA 1GE6A 3Q2GA 1KUIA 5I12A 1BQOA 4PKUA 1BSWA 830CA 1SLMA 4JP4A 2Y6DA 1ROSA 1YP1A 3F17A 3HY9A 3ZUKA 1G4KA 1R54A 1O0QA 1QUAA 1PWVA 1QJJA 4XM8A 4L63A 2OY4A 4H49A 3DNGA 1D5JA 2OVZA 4H2EA 4JA1A 4DF9A 2MLRA 3HBVP 3O64A 2OXZA 1IACA 1BUDA 1KBCA 3AYUA 3P1VA 1I1IP 1BQQM 2O3EA 1ZVXA 2X3BA 5B5PA 1GXDA 1XUDA 3VTGA 4HMAA 1D8MA 1KUKA 2USNA 2X3CA 2E2DA 5I4OA 3LIKA 3SHIA 3DWBA 3NX7A 1BM6A 4GUYA 1UMTA 3N2UA 1BKCE 5D7WA 3DSLA 3BA0A 2RJPA 1XFXA 3EHYA 1AYKA 2FV9A 1KAPP 1I76A 4XM7A 1BIWA 4G0DA 1CXVA 1PWUA 2PJTA 3LQ0A 3LEAA 1KUFA 2ERQA 1IAGA 4GR3A 3USNA 1GO7P 2JSDA 2V4BA 3F19A 1OMJA 1DTHA 2OW9A 4WKIA 3WV1A 2WO9A 1CGEA 2OW0A 2OI0A 4FVLA 3P24A 3K7NA 4WKEA 3U1RA 3OHLA 4H76A 2OXWA 4IUWA 4WF6A 2X3AA 5D3CA 5D1TA 1ASTA 2OY2A 1OS9A 4GWNA 5I3MA 1CAQA 1PWQA 1B8YA 3HB2P 3KWVC 1Q3AA 1H71P 1KUHA 2POJA 3KMCA 4XCTA 1Y8JA 5BOTA 2WOAA 1JJ9A 4JIJA 2JIHA 1C7KA 4GR0A 1S4BP 3GBOA 2KRJA 1UMSA 3MA2A 3O2XA 3LUNA 4XBHA 5L7FA 3F16A 2YB9A 2W13A 2JNPA 4H82A 4PKRA 3Q2HA 1FBLA 1PWPA 2ERPA 3VI1A 2HU6A 1K7QA 1MNCA 1CGFA 1G9KA 4ON1A 1RMZA 1SMPA 3EHXA 3N2VA 1CQRA 1MMRA 4GWMA 2OVXA 3AYKA 4A3WA 4PKSA 1GE5A 4PKTA 3EDZA 2JT5A 3G5CA 1Y0VA 4AYKA 1UEAA 4J4MA 4EFSA 2W0DA 5D1UA 2K9CA 1EUBA 1BKCI 3ZXHA 1IADA 2RJQA 4CTHA 3F15A 1XFZA 3KRYA 1D8FA 1XFYA 2WO8A 2DDFA 4HX3A 3LGPA 2DDYA 1ZP5A 1MMPA 3L0TA 4AXQA 1GO8P 2FV5A 1JAPA 1ZXCA 2D1NA 1R1JA 3KMEA 1HV5A 1QIAA 4XM6A 3HBUP 1CK7A 1K7IA 1SLNA 2MZIA 2XS3A 2L0RA 1JAOA 3G42A 4ZR5A 4I03A 3TSKA 1Z3JA 5CZMA 3CKIA 2OW1A 4H30A 2TCLA 4R3VA 3TVCA 4FU4A 3B92A 4I35A 2N8RA 2DW1A 1FLSA 4DV8A 3EDHA 1XURA 4L6TA 3ZVSA 2W15A 1AF0A 3WV2A 2DW0A 1RM8A 3LK8A 1FM1A 3L0VA 4GQLA 1YOUA 5D2BA 1JIWP 2MLSA 3EDIA 1XFVA 3EWJA 1C3IA 4L19A 3WV3A 1OM7A 4AUOA 5LABA 1QIBA 1HY7A 3HDBA 1OO9A 4DD8A 4DPEA 3LQBA 3K7LA 1GE7A 2Y6CA 5CUHA 1ND1A 2EROA 3F1AA 3TT4A 2OXUA 3KEJA 1OS2A 3DL1A 2E3XA 1CGLA 2I47A 3KECA 1IABA 1ZS0A 1WNIA 3I7GA 5I2ZA 3V96B 1SU3A 3EDGA 1ZTQA 2CKIA 456CA 3RTSA 1YCMA 4GF1A 4FXQA 4JPAA 1BZSA 3TS4A 3LMCA 1D7XA 5BPAA 4IN9A 1EAKA 2D1OA 5JMYA 1C8TA 5L79A 1PWWA 1JH1A 1GKCA 1JANA 1Y93A 2XS4A 4JQGA 1DMTA 1J7NA 2Z2DA 3LJGA 1A85A 1JK3A 3HY7A 3UVCA 1SRPA 1USNA 2QPJA 4AIGA 1ZXVA 4ILWD 3I7IA 5D1SA 1R55A 2W14A 3LE9A 1HFCA 3ELMA 3F18A 5BOYA 3B8ZA 2J0TA 966CA 3B2ZA 2X7MA 1G05A 1HFSA 4WK7A 1HOVA 1L6JA 3LKAA 1SATA 3LUMA 1R1IA 4IJOA 4H84A 2JT6A 1G12A 1BUVM 4QKZA 2AYKA 3E8RA 5I43A 1HTDA 4FXYP 1BKCA 3DPEA 2YIGA 2SRTA 1I73A 1XUCA 2W12A 1G49A 1QICA 1UTZA 1CIZA 1JIZA 1QJIA 4H3XA 1ATLA 2MZEA 2O36A 2OZRA 5CXAA 1GKDA 4G9LA 1JKYA 1AKLA 3LJZA 2J83A 2OW2A 1R1HA 2CLTA 2MZHA 1OM8A 3HYGA 3AIGA 4PKWA 5B5OA 1XFUA 3RTTA 3HDAP 1O0TA 1UTTA 3OHOA 1MMBA 1IAAA 1OM6A 2DW2A 5I0LA 1EB6A 3LIRA 1YQYA 2AIGP 3LILA 3LJTA 2K2GA 3KEKA 1K7GA 2A8HA 4GR8A 1XFWA 3KHIA 4Q1LA 1A86A 3DPFA 1JAQA 4WZVA 1MMQA 4H1QA 1IAEA 4PKVA 5H8XA 4A7BA
chains in the Genus database with same CATH superfamily
4PKQA 1B3DA 1KUGA 1GE6A 3Q2GA 1KUIA 5I12A 1BQOA 4PKUA 1BSWA 830CA 1TVIA 1SLMA 4JP4A 2Y6DA 1ROSA 1YP1A 3F17A 3HY9A 3ZUKA 1G4KA 1R54A 1O0QA 1QUAA 1PWVA 1QJJA 4XM8A 4L63A 2OY4A 4H49A 3DNGA 1D5JA 2OVZA 4H2EA 4JA1A 4DF9A 2MLRA 3HBVP 3O64A 2OXZA 1IACA 1BUDA 1KBCA 3AYUA 3P1VA 1I1IP 1BQQM 2O3EA 1ZVXA 2X3BA 5B5PA 1GXDA 1XUDA 3VTGA 4HMAA 1D8MA 1KUKA 2USNA 2X3CA 2E2DA 5I4OA 3LIKA 3SHIA 3DWBA 3NX7A 1BM6A 4GUYA 1UMTA 3N2UA 1BKCE 5D7WA 3DSLA 3DTIA 3BA0A 2RJPA 1XFXA 3EHYA 1AYKA 2FV9A 1KAPP 1I76A 4XM7A 1BIWA 4G0DA 1XAXA 1CXVA 1PWUA 2PJTA 3LQ0A 3LEAA 1KUFA 2ERQA 1IAGA 4GR3A 3USNA 1GO7P 3DTKA 2JSDA 2V4BA 3F19A 1OMJA 1DTHA 2OW9A 4WKIA 3WV1A 2WO9A 1CGEA 2OW0A 2OI0A 4FVLA 3P24A 3K7NA 4WKEA 3U1RA 3OHLA 4H76A 2OXWA 4IUWA 4WF6A 2X3AA 5D3CA 5D1TA 1ASTA 2OY2A 1OS9A 4GWNA 5I3MA 1CAQA 1PWQA 1B8YA 3HB2P 3KWVC 1Q3AA 1H71P 1KUHA 2POJA 3KMCA 4XCTA 1Y8JA 5BOTA 2WOAA 1JJ9A 4JIJA 2JIHA 1C7KA 4GR0A 1S4BP 3GBOA 2KRJA 1UMSA 3MA2A 3O2XA 3LUNA 4XBHA 5L7FA 3F16A 2YB9A 2W13A 2JNPA 4H82A 4PKRA 3Q2HA 1FBLA 1PWPA 2ERPA 3VI1A 2HU6A 1K7QA 1MNCA 1CGFA 1G9KA 4ON1A 1RMZA 1SMPA 3EHXA 3N2VA 1CQRA 1MMRA 4GWMA 2OVXA 3AYKA 4A3WA 4PKSA 1GE5A 4PKTA 3EDZA 2JT5A 3G5CA 1Y0VA 4AYKA 1UEAA 4J4MA 4EFSA 2W0DA 5D1UA 2K9CA 1EUBA 1BKCI 3ZXHA 1IADA 2RJQA 4CTHA 3F15A 1XFZA 3DTEA 3KRYA 1D8FA 1XFYA 2WO8A 2DDFA 4HX3A 4L7AA 3LGPA 2DDYA 1ZP5A 1MMPA 3L0TA 4AXQA 1GO8P 2FV5A 1JAPA 1ZXCA 2D1NA 1R1JA 3KMEA 1HV5A 1QIAA 4XM6A 3HBUP 1CK7A 1K7IA 1SLNA 2MZIA 2XS3A 2L0RA 1JAOA 3G42A 4ZR5A 4I03A 3TSKA 1Z3JA 5CZMA 3CKIA 2OW1A 4H30A 2TCLA 4R3VA 3TVCA 4FU4A 3B92A 4I35A 2YUFA 2N8RA 2DW1A 1FLSA 4DV8A 3EDHA 1XURA 4L6TA 3ZVSA 2W15A 1AF0A 3WV2A 2DW0A 1RM8A 3LK8A 1FM1A 3L0VA 4GQLA 1YOUA 5D2BA 1JIWP 2MLSA 3EDIA 1XFVA 3EWJA 1C3IA 4L19A 3WV3A 1OM7A 4AUOA 5LABA 1QIBA 1HY7A 3HDBA 1OO9A 4DD8A 4DPEA 3LQBA 3K7LA 1GE7A 2Y6CA 5CUHA 1ND1A 2EROA 3F1AA 3TT4A 2OXUA 3KEJA 1OZ9A 1OS2A 3DL1A 2E3XA 1CGLA 2I47A 3KECA 1IABA 1ZS0A 1WNIA 3I7GA 5I2ZA 3V96B 1SU3A 3EDGA 1ZTQA 2CKIA 456CA 3RTSA 1YCMA 4GF1A 4FXQA 4JPAA 1BZSA 3TS4A 3LMCA 1D7XA 5BPAA 4IN9A 1EAKA 2D1OA 5JMYA 1XM5A 1C8TA 5L79A 1PWWA 1JH1A 1GKCA 1JANA 1Y93A 2XS4A 4JQGA 1DMTA 1J7NA 2Z2DA 3LJGA 1A85A 1JK3A 3HY7A 3UVCA 1SRPA 1USNA 2QPJA 4AIGA 1ZXVA 4ILWD 3I7IA 5D1SA 1R55A 2W14A 3LE9A 1HFCA 3ELMA 3F18A 5BOYA 3B8ZA 2J0TA 966CA 3B2ZA 2X7MA 1G05A 1HFSA 4WK7A 1HOVA 1L6JA 3LKAA 1SATA 3LUMA 1R1IA 4IJOA 4H84A 2JT6A 1G12A 1BUVM 4QKZA 2AYKA 3E8RA 5I43A 1HTDA 4FXYP 1BKCA 3DPEA 2YIGA 2SRTA 1I73A 1XUCA 2W12A 1G49A 1QICA 1UTZA 1CIZA 1JIZA 1QJIA 4H3XA 1ATLA 2MZEA 2O36A 2OZRA 5CXAA 1GKDA 4G9LA 1JKYA 1AKLA 3LJZA 2J83A 2OW2A 1R1HA 2CLTA 2MZHA 1OM8A 3HYGA 3AIGA 4PKWA 5B5OA 1XFUA 3RTTA 3HDAP 1O0TA 1UTTA 3OHOA 1MMBA 1IAAA 1OM6A 2DW2A 5I0LA 1EB6A 3LIRA 1YQYA 2AIGP 3LILA 3LJTA 2K2GA 3KEKA 1K7GA 2A8HA 4GR8A 1XFWA 3KHIA 4Q1LA 1A86A 3DPFA 1JAQA 4WZVA 1MMQA 4H1QA 1IAEA 4PKVA 5H8XA 4A7BA
chains in the Genus database with same CATH topology
4PKQA 1B3DA 1KUGA 1GE6A 3Q2GA 1KUIA 5I12A 1BQOA 4PKUA 1BSWA 830CA 1SLMA 4JP4A 2Y6DA 1ROSA 1YP1A 3F17A 3HY9A 3ZUKA 1G4KA 1R54A 1O0QA 1QUAA 1PWVA 1QJJA 4XM8A 4L63A 2OY4A 4H49A 3DNGA 1D5JA 2OVZA 4H2EA 4JA1A 4DF9A 2MLRA 3HBVP 3O64A 2OXZA 1IACA 1BUDA 1KBCA 3AYUA 3P1VA 1I1IP 1BQQM 2O3EA 1ZVXA 2X3BA 5B5PA 1GXDA 1XUDA 3VTGA 4HMAA 1D8MA 1KUKA 2USNA 2X3CA 2E2DA 5I4OA 3LIKA 3SHIA 3DWBA 3NX7A 1BM6A 4GUYA 1UMTA 3N2UA 1BKCE 5D7WA 3DSLA 3DTIA 3BA0A 2RJPA 1XFXA 3EHYA 1AYKA 2FV9A 1KAPP 1I76A 4XM7A 1BIWA 4G0DA 1CXVA 1PWUA 2PJTA 3LQ0A 3LEAA 1KUFA 2ERQA 1IAGA 4GR3A 3USNA 1GO7P 3DTKA 2JSDA 2V4BA 3F19A 1OMJA 1DTHA 2OW9A 4WKIA 3WV1A 2WO9A 1CGEA 2OW0A 2OI0A 4FVLA 3P24A 3K7NA 4WKEA 3U1RA 3OHLA 4H76A 2OXWA 4IUWA 4WF6A 2X3AA 5D3CA 5D1TA 1ASTA 2OY2A 1OS9A 4GWNA 5I3MA 1CAQA 1PWQA 1B8YA 3HB2P 3KWVC 1Q3AA 1H71P 1KUHA 2POJA 3KMCA 4XCTA 1Y8JA 5BOTA 2WOAA 1JJ9A 4JIJA 2JIHA 1C7KA 4GR0A 1S4BP 3GBOA 2KRJA 1UMSA 3MA2A 3O2XA 3LUNA 4XBHA 5L7FA 3F16A 2YB9A 2W13A 2JNPA 4H82A 4PKRA 3Q2HA 1FBLA 1PWPA 2ERPA 3VI1A 2HU6A 1K7QA 1MNCA 1CGFA 1G9KA 4ON1A 1RMZA 1SMPA 3EHXA 3N2VA 1CQRA 1MMRA 4GWMA 2OVXA 3AYKA 4A3WA 4PKSA 1GE5A 4PKTA 3EDZA 2JT5A 3G5CA 1Y0VA 4AYKA 1UEAA 4J4MA 4EFSA 2W0DA 5D1UA 2K9CA 1EUBA 1BKCI 3ZXHA 1IADA 2RJQA 4CTHA 3F15A 1XFZA 3DTEA 3KRYA 1D8FA 1XFYA 2WO8A 2DDFA 4HX3A 4L7AA 3LGPA 2DDYA 1ZP5A 1MMPA 3L0TA 4AXQA 1GO8P 2FV5A 1JAPA 1ZXCA 2D1NA 1R1JA 3KMEA 1HV5A 1QIAA 4XM6A 3HBUP 1CK7A 1K7IA 1SLNA 2MZIA 2XS3A 2L0RA 1JAOA 3G42A 4ZR5A 4I03A 3TSKA 1Z3JA 5CZMA 3CKIA 2OW1A 4H30A 2TCLA 4R3VA 3TVCA 4FU4A 3B92A 4I35A 2YUFA 2N8RA 2DW1A 1FLSA 4DV8A 3EDHA 1XURA 4L6TA 3ZVSA 2W15A 1AF0A 3WV2A 2DW0A 1RM8A 3LK8A 1FM1A 3L0VA 4GQLA 1YOUA 5D2BA 1JIWP 2MLSA 3EDIA 1XFVA 3EWJA 1C3IA 4L19A 3WV3A 1OM7A 4AUOA 5LABA 1QIBA 1HY7A 3HDBA 1OO9A 4DD8A 4DPEA 3LQBA 3K7LA 1GE7A 2Y6CA 5CUHA 1ND1A 2EROA 3F1AA 3TT4A 2OXUA 3KEJA 1OS2A 3DL1A 2E3XA 1CGLA 2I47A 3KECA 1IABA 1ZS0A 1WNIA 3I7GA 5I2ZA 3V96B 1SU3A 3EDGA 1ZTQA 2CKIA 456CA 3RTSA 1YCMA 4GF1A 4FXQA 4JPAA 1BZSA 3TS4A 3LMCA 1D7XA 5BPAA 4IN9A 1EAKA 2D1OA 5JMYA 1C8TA 5L79A 1PWWA 1JH1A 1GKCA 1JANA 1Y93A 2XS4A 4JQGA 1DMTA 1J7NA 2Z2DA 3LJGA 1A85A 1JK3A 3HY7A 3UVCA 1SRPA 1USNA 2QPJA 4AIGA 1ZXVA 4ILWD 3I7IA 5D1SA 1R55A 2W14A 3LE9A 1HFCA 3ELMA 3F18A 5BOYA 3B8ZA 2J0TA 966CA 3B2ZA 2X7MA 1G05A 1HFSA 4WK7A 1HOVA 1L6JA 3LKAA 1SATA 3LUMA 1R1IA 4IJOA 4H84A 2JT6A 1G12A 1BUVM 4QKZA 2AYKA 3E8RA 5I43A 1HTDA 4FXYP 1BKCA 3DPEA 2YIGA 2SRTA 1I73A 1XUCA 2W12A 1G49A 1QICA 1UTZA 1CIZA 1JIZA 1QJIA 4H3XA 1ATLA 2MZEA 2O36A 2OZRA 5CXAA 1GKDA 4G9LA 1JKYA 1AKLA 3LJZA 2J83A 2OW2A 1R1HA 2CLTA 2MZHA 1OM8A 3HYGA 3AIGA 4PKWA 5B5OA 1XFUA 3RTTA 3HDAP 1O0TA 1UTTA 3OHOA 1MMBA 1IAAA 1OM6A 2DW2A 5I0LA 1EB6A 3LIRA 1YQYA 2AIGP 3LILA 3LJTA 2K2GA 3KEKA 1K7GA 2A8HA 4GR8A 1XFWA 3KHIA 4Q1LA 1A86A 3DPFA 1JAQA 4WZVA 1MMQA 4H1QA 1IAEA 4PKVA 5H8XA 4A7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKQ A;  1B3D A;  1KUG A;  1GE6 A;  3Q2G A;  1KUI A;  5I12 A;  1BQO A;  4PKU A;  1BSW A;  830C A;  1SLM A;  4JP4 A;  2Y6D A;  1ROS A;  1YP1 A;  3F17 A;  3HY9 A;  3ZUK A;  1G4K A;  1R54 A;  1O0Q A;  1QUA A;  1PWV A;  1QJJ A;  4XM8 A;  4L63 A;  2OY4 A;  4H49 A;  3DNG A;  1D5J A;  2OVZ A;  4H2E A;  4JA1 A;  4DF9 A;  2MLR A;  3HBV P;  3O64 A;  2OXZ A;  1IAC A;  1BUD A;  1KBC A;  3AYU A;  3P1V A;  1I1I P;  1BQQ M;  2O3E A;  1ZVX A;  2X3B A;  5B5P A;  1GXD A;  1XUD A;  3VTG A;  4HMA A;  1D8M A;  1KUK A;  2USN A;  2X3C A;  2E2D A;  5I4O A;  3LIK A;  3SHI A;  3DWB A;  3NX7 A;  1BM6 A;  4GUY A;  1UMT A;  3N2U A;  1BKC E;  5D7W A;  3DSL A;  3BA0 A;  2RJP A;  1XFX A;  3EHY A;  1AYK A;  2FV9 A;  1KAP P;  1I76 A;  4XM7 A;  1BIW A;  4G0D A;  1CXV A;  1PWU A;  2PJT A;  3LQ0 A;  3LEA A;  1KUF A;  2ERQ A;  1IAG A;  4GR3 A;  3USN A;  1GO7 P;  2JSD A;  2V4B A;  3F19 A;  1OMJ A;  1DTH A;  2OW9 A;  4WKI A;  3WV1 A;  2WO9 A;  1CGE A;  2OW0 A;  2OI0 A;  4FVL A;  3P24 A;  3K7N A;  4WKE A;  3U1R A;  3OHL A;  4H76 A;  2OXW A;  4IUW A;  4WF6 A;  2X3A A;  5D3C A;  5D1T A;  1AST A;  2OY2 A;  1OS9 A;  4GWN A;  5I3M A;  1CAQ A;  1PWQ A;  1B8Y A;  3HB2 P;  3KWV C;  1Q3A A;  1H71 P;  1KUH A;  2POJ A;  3KMC A;  4XCT A;  1Y8J A;  5BOT A;  2WOA A;  1JJ9 A;  4JIJ A;  2JIH A;  1C7K A;  4GR0 A;  1S4B P;  3GBO A;  2KRJ A;  1UMS A;  3MA2 A;  3O2X A;  3LUN A;  4XBH A;  5L7F A;  3F16 A;  2YB9 A;  2W13 A;  2JNP A;  4H82 A;  4PKR A;  3Q2H A;  1FBL A;  1PWP A;  2ERP A;  3VI1 A;  2HU6 A;  1K7Q A;  1MNC A;  1CGF A;  1G9K A;  4ON1 A;  1RMZ A;  1SMP A;  3EHX A;  3N2V A;  1CQR A;  1MMR A;  4GWM A;  2OVX A;  3AYK A;  4A3W A;  4PKS A;  1GE5 A;  4PKT A;  3EDZ A;  2JT5 A;  3G5C A;  1Y0V A;  4AYK A;  1UEA A;  4J4M A;  4EFS A;  2W0D A;  5D1U A;  2K9C A;  1EUB A;  1BKC I;  3ZXH A;  1IAD A;  2RJQ A;  4CTH A;  3F15 A;  1XFZ A;  3KRY A;  1D8F A;  1XFY A;  2WO8 A;  2DDF A;  4HX3 A;  3LGP A;  2DDY A;  1ZP5 A;  1MMP A;  3L0T A;  4AXQ A;  1GO8 P;  2FV5 A;  1JAP A;  1ZXC A;  2D1N A;  1R1J A;  3KME A;  1HV5 A;  1QIA A;  4XM6 A;  3HBU P;  1CK7 A;  1K7I A;  1SLN A;  2MZI A;  2XS3 A;  2L0R A;  1JAO A;  3G42 A;  4ZR5 A;  4I03 A;  3TSK A;  1Z3J A;  5CZM A;  3CKI A;  2OW1 A;  4H30 A;  2TCL A;  4R3V A;  3TVC A;  4FU4 A;  3B92 A;  4I35 A;  2N8R A;  2DW1 A;  1FLS A;  4DV8 A;  3EDH A;  1XUR A;  4L6T A;  3ZVS A;  2W15 A;  1AF0 A;  3WV2 A;  2DW0 A;  1RM8 A;  3LK8 A;  1FM1 A;  3L0V A;  4GQL A;  1YOU A;  5D2B A;  1JIW P;  2MLS A;  3EDI A;  1XFV A;  3EWJ A;  1C3I A;  4L19 A;  3WV3 A;  1OM7 A;  4AUO A;  5LAB A;  1QIB A;  1HY7 A;  3HDB A;  1OO9 A;  4DD8 A;  4DPE A;  3LQB A;  3K7L A;  1GE7 A;  2Y6C A;  5CUH A;  1ND1 A;  2ERO A;  3F1A A;  3TT4 A;  2OXU A;  3KEJ A;  1OS2 A;  3DL1 A;  2E3X A;  1CGL A;  2I47 A;  3KEC A;  1IAB A;  1ZS0 A;  1WNI A;  3I7G A;  5I2Z A;  3V96 B;  1SU3 A;  3EDG A;  1ZTQ A;  2CKI A;  456C A;  3RTS A;  1YCM A;  4GF1 A;  4FXQ A;  4JPA A;  1BZS A;  3TS4 A;  3LMC A;  1D7X A;  5BPA A;  4IN9 A;  1EAK A;  2D1O A;  5JMY A;  1C8T A;  5L79 A;  1PWW A;  1JH1 A;  1GKC A;  1JAN A;  1Y93 A;  2XS4 A;  4JQG A;  1DMT A;  1J7N A;  2Z2D A;  3LJG A;  1A85 A;  1JK3 A;  3HY7 A;  3UVC A;  1SRP A;  1USN A;  2QPJ A;  4AIG A;  1ZXV A;  4ILW D;  3I7I A;  5D1S A;  1R55 A;  2W14 A;  3LE9 A;  1HFC A;  3ELM A;  3F18 A;  5BOY A;  3B8Z A;  2J0T A;  966C A;  3B2Z A;  2X7M A;  1G05 A;  1HFS A;  4WK7 A;  1HOV A;  1L6J A;  3LKA A;  1SAT A;  3LUM A;  1R1I A;  4IJO A;  4H84 A;  2JT6 A;  1G12 A;  1BUV M;  4QKZ A;  2AYK A;  3E8R A;  5I43 A;  1HTD A;  4FXY P;  1BKC A;  3DPE A;  2YIG A;  2SRT A;  1I73 A;  1XUC A;  2W12 A;  1G49 A;  1QIC A;  1UTZ A;  1CIZ A;  1JIZ A;  1QJI A;  4H3X A;  1ATL A;  2MZE A;  2O36 A;  2OZR A;  5CXA A;  1GKD A;  4G9L A;  1JKY A;  1AKL A;  3LJZ A;  2J83 A;  2OW2 A;  1R1H A;  2CLT A;  2MZH A;  1OM8 A;  3HYG A;  3AIG A;  4PKW A;  5B5O A;  1XFU A;  3RTT A;  3HDA P;  1O0T A;  1UTT A;  3OHO A;  1MMB A;  1IAA A;  1OM6 A;  2DW2 A;  5I0L A;  1EB6 A;  3LIR A;  1YQY A;  2AIG P;  3LIL A;  3LJT A;  2K2G A;  3KEK A;  1K7G A;  2A8H A;  4GR8 A;  1XFW A;  3KHI A;  4Q1L A;  1A86 A;  3DPF A;  1JAQ A;  4WZV A;  1MMQ A;  4H1Q A;  1IAE A;  4PKV A;  5H8X A;  4A7B A; 
#chains in the Genus database with same CATH topology
 4PKQ A;  1B3D A;  1KUG A;  1GE6 A;  3Q2G A;  1KUI A;  5I12 A;  1BQO A;  4PKU A;  1BSW A;  830C A;  1TVI A;  1SLM A;  4JP4 A;  2Y6D A;  1ROS A;  1YP1 A;  3F17 A;  3HY9 A;  3ZUK A;  1G4K A;  1R54 A;  1O0Q A;  1QUA A;  1PWV A;  1QJJ A;  4XM8 A;  4L63 A;  2OY4 A;  4H49 A;  3DNG A;  1D5J A;  2OVZ A;  4H2E A;  4JA1 A;  4DF9 A;  2MLR A;  3HBV P;  3O64 A;  2OXZ A;  1IAC A;  1BUD A;  1KBC A;  3AYU A;  3P1V A;  1I1I P;  1BQQ M;  2O3E A;  1ZVX A;  2X3B A;  5B5P A;  1GXD A;  1XUD A;  3VTG A;  4HMA A;  1D8M A;  1KUK A;  2USN A;  2X3C A;  2E2D A;  5I4O A;  3LIK A;  3SHI A;  3DWB A;  3NX7 A;  1BM6 A;  4GUY A;  1UMT A;  3N2U A;  1BKC E;  5D7W A;  3DSL A;  3DTI A;  3BA0 A;  2RJP A;  1XFX A;  3EHY A;  1AYK A;  2FV9 A;  1KAP P;  1I76 A;  4XM7 A;  1BIW A;  4G0D A;  1XAX A;  1CXV A;  1PWU A;  2PJT A;  3LQ0 A;  3LEA A;  1KUF A;  2ERQ A;  1IAG A;  4GR3 A;  3USN A;  1GO7 P;  3DTK A;  2JSD A;  2V4B A;  3F19 A;  1OMJ A;  1DTH A;  2OW9 A;  4WKI A;  3WV1 A;  2WO9 A;  1CGE A;  2OW0 A;  2OI0 A;  4FVL A;  3P24 A;  3K7N A;  4WKE A;  3U1R A;  3OHL A;  4H76 A;  2OXW A;  4IUW A;  4WF6 A;  2X3A A;  5D3C A;  5D1T A;  1AST A;  2OY2 A;  1OS9 A;  4GWN A;  5I3M A;  1CAQ A;  1PWQ A;  1B8Y A;  3HB2 P;  3KWV C;  1Q3A A;  1H71 P;  1KUH A;  2POJ A;  3KMC A;  4XCT A;  1Y8J A;  5BOT A;  2WOA A;  1JJ9 A;  4JIJ A;  2JIH A;  1C7K A;  4GR0 A;  1S4B P;  3GBO A;  2KRJ A;  1UMS A;  3MA2 A;  3O2X A;  3LUN A;  4XBH A;  5L7F A;  3F16 A;  2YB9 A;  2W13 A;  2JNP A;  4H82 A;  4PKR A;  3Q2H A;  1FBL A;  1PWP A;  2ERP A;  3VI1 A;  2HU6 A;  1K7Q A;  1MNC A;  1CGF A;  1G9K A;  4ON1 A;  1RMZ A;  1SMP A;  3EHX A;  3N2V A;  1CQR A;  1MMR A;  4GWM A;  2OVX A;  3AYK A;  4A3W A;  4PKS A;  1GE5 A;  4PKT A;  3EDZ A;  2JT5 A;  3G5C A;  1Y0V A;  4AYK A;  1UEA A;  4J4M A;  4EFS A;  2W0D A;  5D1U A;  2K9C A;  1EUB A;  1BKC I;  3ZXH A;  1IAD A;  2RJQ A;  4CTH A;  3F15 A;  1XFZ A;  3DTE A;  3KRY A;  1D8F A;  1XFY A;  2WO8 A;  2DDF A;  4HX3 A;  4L7A A;  3LGP A;  2DDY A;  1ZP5 A;  1MMP A;  3L0T A;  4AXQ A;  1GO8 P;  2FV5 A;  1JAP A;  1ZXC A;  2D1N A;  1R1J A;  3KME A;  1HV5 A;  1QIA A;  4XM6 A;  3HBU P;  1CK7 A;  1K7I A;  1SLN A;  2MZI A;  2XS3 A;  2L0R A;  1JAO A;  3G42 A;  4ZR5 A;  4I03 A;  3TSK A;  1Z3J A;  5CZM A;  3CKI A;  2OW1 A;  4H30 A;  2TCL A;  4R3V A;  3TVC A;  4FU4 A;  3B92 A;  4I35 A;  2YUF A;  2N8R A;  2DW1 A;  1FLS A;  4DV8 A;  3EDH A;  1XUR A;  4L6T A;  3ZVS A;  2W15 A;  1AF0 A;  3WV2 A;  2DW0 A;  1RM8 A;  3LK8 A;  1FM1 A;  3L0V A;  4GQL A;  1YOU A;  5D2B A;  1JIW P;  2MLS A;  3EDI A;  1XFV A;  3EWJ A;  1C3I A;  4L19 A;  3WV3 A;  1OM7 A;  4AUO A;  5LAB A;  1QIB A;  1HY7 A;  3HDB A;  1OO9 A;  4DD8 A;  4DPE A;  3LQB A;  3K7L A;  1GE7 A;  2Y6C A;  5CUH A;  1ND1 A;  2ERO A;  3F1A A;  3TT4 A;  2OXU A;  3KEJ A;  1OZ9 A;  1OS2 A;  3DL1 A;  2E3X A;  1CGL A;  2I47 A;  3KEC A;  1IAB A;  1ZS0 A;  1WNI A;  3I7G A;  5I2Z A;  3V96 B;  1SU3 A;  3EDG A;  1ZTQ A;  2CKI A;  456C A;  3RTS A;  1YCM A;  4GF1 A;  4FXQ A;  4JPA A;  1BZS A;  3TS4 A;  3LMC A;  1D7X A;  5BPA A;  4IN9 A;  1EAK A;  2D1O A;  5JMY A;  1XM5 A;  1C8T A;  5L79 A;  1PWW A;  1JH1 A;  1GKC A;  1JAN A;  1Y93 A;  2XS4 A;  4JQG A;  1DMT A;  1J7N A;  2Z2D A;  3LJG A;  1A85 A;  1JK3 A;  3HY7 A;  3UVC A;  1SRP A;  1USN A;  2QPJ A;  4AIG A;  1ZXV A;  4ILW D;  3I7I A;  5D1S A;  1R55 A;  2W14 A;  3LE9 A;  1HFC A;  3ELM A;  3F18 A;  5BOY A;  3B8Z A;  2J0T A;  966C A;  3B2Z A;  2X7M A;  1G05 A;  1HFS A;  4WK7 A;  1HOV A;  1L6J A;  3LKA A;  1SAT A;  3LUM A;  1R1I A;  4IJO A;  4H84 A;  2JT6 A;  1G12 A;  1BUV M;  4QKZ A;  2AYK A;  3E8R A;  5I43 A;  1HTD A;  4FXY P;  1BKC A;  3DPE A;  2YIG A;  2SRT A;  1I73 A;  1XUC A;  2W12 A;  1G49 A;  1QIC A;  1UTZ A;  1CIZ A;  1JIZ A;  1QJI A;  4H3X A;  1ATL A;  2MZE A;  2O36 A;  2OZR A;  5CXA A;  1GKD A;  4G9L A;  1JKY A;  1AKL A;  3LJZ A;  2J83 A;  2OW2 A;  1R1H A;  2CLT A;  2MZH A;  1OM8 A;  3HYG A;  3AIG A;  4PKW A;  5B5O A;  1XFU A;  3RTT A;  3HDA P;  1O0T A;  1UTT A;  3OHO A;  1MMB A;  1IAA A;  1OM6 A;  2DW2 A;  5I0L A;  1EB6 A;  3LIR A;  1YQY A;  2AIG P;  3LIL A;  3LJT A;  2K2G A;  3KEK A;  1K7G A;  2A8H A;  4GR8 A;  1XFW A;  3KHI A;  4Q1L A;  1A86 A;  3DPF A;  1JAQ A;  4WZV A;  1MMQ A;  4H1Q A;  1IAE A;  4PKV A;  5H8X A;  4A7B A; 
#chains in the Genus database with same CATH homology
 4PKQ A;  1B3D A;  1KUG A;  1GE6 A;  3Q2G A;  1KUI A;  5I12 A;  1BQO A;  4PKU A;  1BSW A;  830C A;  1SLM A;  4JP4 A;  2Y6D A;  1ROS A;  1YP1 A;  3F17 A;  3HY9 A;  3ZUK A;  1G4K A;  1R54 A;  1O0Q A;  1QUA A;  1PWV A;  1QJJ A;  4XM8 A;  4L63 A;  2OY4 A;  4H49 A;  3DNG A;  1D5J A;  2OVZ A;  4H2E A;  4JA1 A;  4DF9 A;  2MLR A;  3HBV P;  3O64 A;  2OXZ A;  1IAC A;  1BUD A;  1KBC A;  3AYU A;  3P1V A;  1I1I P;  1BQQ M;  2O3E A;  1ZVX A;  2X3B A;  5B5P A;  1GXD A;  1XUD A;  3VTG A;  4HMA A;  1D8M A;  1KUK A;  2USN A;  2X3C A;  2E2D A;  5I4O A;  3LIK A;  3SHI A;  3DWB A;  3NX7 A;  1BM6 A;  4GUY A;  1UMT A;  3N2U A;  1BKC E;  5D7W A;  3DSL A;  3DTI A;  3BA0 A;  2RJP A;  1XFX A;  3EHY A;  1AYK A;  2FV9 A;  1KAP P;  1I76 A;  4XM7 A;  1BIW A;  4G0D A;  1CXV A;  1PWU A;  2PJT A;  3LQ0 A;  3LEA A;  1KUF A;  2ERQ A;  1IAG A;  4GR3 A;  3USN A;  1GO7 P;  3DTK A;  2JSD A;  2V4B A;  3F19 A;  1OMJ A;  1DTH A;  2OW9 A;  4WKI A;  3WV1 A;  2WO9 A;  1CGE A;  2OW0 A;  2OI0 A;  4FVL A;  3P24 A;  3K7N A;  4WKE A;  3U1R A;  3OHL A;  4H76 A;  2OXW A;  4IUW A;  4WF6 A;  2X3A A;  5D3C A;  5D1T A;  1AST A;  2OY2 A;  1OS9 A;  4GWN A;  5I3M A;  1CAQ A;  1PWQ A;  1B8Y A;  3HB2 P;  3KWV C;  1Q3A A;  1H71 P;  1KUH A;  2POJ A;  3KMC A;  4XCT A;  1Y8J A;  5BOT A;  2WOA A;  1JJ9 A;  4JIJ A;  2JIH A;  1C7K A;  4GR0 A;  1S4B P;  3GBO A;  2KRJ A;  1UMS A;  3MA2 A;  3O2X A;  3LUN A;  4XBH A;  5L7F A;  3F16 A;  2YB9 A;  2W13 A;  2JNP A;  4H82 A;  4PKR A;  3Q2H A;  1FBL A;  1PWP A;  2ERP A;  3VI1 A;  2HU6 A;  1K7Q A;  1MNC A;  1CGF A;  1G9K A;  4ON1 A;  1RMZ A;  1SMP A;  3EHX A;  3N2V A;  1CQR A;  1MMR A;  4GWM A;  2OVX A;  3AYK A;  4A3W A;  4PKS A;  1GE5 A;  4PKT A;  3EDZ A;  2JT5 A;  3G5C A;  1Y0V A;  4AYK A;  1UEA A;  4J4M A;  4EFS A;  2W0D A;  5D1U A;  2K9C A;  1EUB A;  1BKC I;  3ZXH A;  1IAD A;  2RJQ A;  4CTH A;  3F15 A;  1XFZ A;  3DTE A;  3KRY A;  1D8F A;  1XFY A;  2WO8 A;  2DDF A;  4HX3 A;  4L7A A;  3LGP A;  2DDY A;  1ZP5 A;  1MMP A;  3L0T A;  4AXQ A;  1GO8 P;  2FV5 A;  1JAP A;  1ZXC A;  2D1N A;  1R1J A;  3KME A;  1HV5 A;  1QIA A;  4XM6 A;  3HBU P;  1CK7 A;  1K7I A;  1SLN A;  2MZI A;  2XS3 A;  2L0R A;  1JAO A;  3G42 A;  4ZR5 A;  4I03 A;  3TSK A;  1Z3J A;  5CZM A;  3CKI A;  2OW1 A;  4H30 A;  2TCL A;  4R3V A;  3TVC A;  4FU4 A;  3B92 A;  4I35 A;  2YUF A;  2N8R A;  2DW1 A;  1FLS A;  4DV8 A;  3EDH A;  1XUR A;  4L6T A;  3ZVS A;  2W15 A;  1AF0 A;  3WV2 A;  2DW0 A;  1RM8 A;  3LK8 A;  1FM1 A;  3L0V A;  4GQL A;  1YOU A;  5D2B A;  1JIW P;  2MLS A;  3EDI A;  1XFV A;  3EWJ A;  1C3I A;  4L19 A;  3WV3 A;  1OM7 A;  4AUO A;  5LAB A;  1QIB A;  1HY7 A;  3HDB A;  1OO9 A;  4DD8 A;  4DPE A;  3LQB A;  3K7L A;  1GE7 A;  2Y6C A;  5CUH A;  1ND1 A;  2ERO A;  3F1A A;  3TT4 A;  2OXU A;  3KEJ A;  1OS2 A;  3DL1 A;  2E3X A;  1CGL A;  2I47 A;  3KEC A;  1IAB A;  1ZS0 A;  1WNI A;  3I7G A;  5I2Z A;  3V96 B;  1SU3 A;  3EDG A;  1ZTQ A;  2CKI A;  456C A;  3RTS A;  1YCM A;  4GF1 A;  4FXQ A;  4JPA A;  1BZS A;  3TS4 A;  3LMC A;  1D7X A;  5BPA A;  4IN9 A;  1EAK A;  2D1O A;  5JMY A;  1C8T A;  5L79 A;  1PWW A;  1JH1 A;  1GKC A;  1JAN A;  1Y93 A;  2XS4 A;  4JQG A;  1DMT A;  1J7N A;  2Z2D A;  3LJG A;  1A85 A;  1JK3 A;  3HY7 A;  3UVC A;  1SRP A;  1USN A;  2QPJ A;  4AIG A;  1ZXV A;  4ILW D;  3I7I A;  5D1S A;  1R55 A;  2W14 A;  3LE9 A;  1HFC A;  3ELM A;  3F18 A;  5BOY A;  3B8Z A;  2J0T A;  966C A;  3B2Z A;  2X7M A;  1G05 A;  1HFS A;  4WK7 A;  1HOV A;  1L6J A;  3LKA A;  1SAT A;  3LUM A;  1R1I A;  4IJO A;  4H84 A;  2JT6 A;  1G12 A;  1BUV M;  4QKZ A;  2AYK A;  3E8R A;  5I43 A;  1HTD A;  4FXY P;  1BKC A;  3DPE A;  2YIG A;  2SRT A;  1I73 A;  1XUC A;  2W12 A;  1G49 A;  1QIC A;  1UTZ A;  1CIZ A;  1JIZ A;  1QJI A;  4H3X A;  1ATL A;  2MZE A;  2O36 A;  2OZR A;  5CXA A;  1GKD A;  4G9L A;  1JKY A;  1AKL A;  3LJZ A;  2J83 A;  2OW2 A;  1R1H A;  2CLT A;  2MZH A;  1OM8 A;  3HYG A;  3AIG A;  4PKW A;  5B5O A;  1XFU A;  3RTT A;  3HDA P;  1O0T A;  1UTT A;  3OHO A;  1MMB A;  1IAA A;  1OM6 A;  2DW2 A;  5I0L A;  1EB6 A;  3LIR A;  1YQY A;  2AIG P;  3LIL A;  3LJT A;  2K2G A;  3KEK A;  1K7G A;  2A8H A;  4GR8 A;  1XFW A;  3KHI A;  4Q1L A;  1A86 A;  3DPF A;  1JAQ A;  4WZV A;  1MMQ A;  4H1Q A;  1IAE A;  4PKV A;  5H8X A;  4A7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...