2MZIA

Nmr solution structure of the pro form of human matrilysin (prommp-7) in complex with anionic membrane
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
248
structure length
248
Chain Sequence
LPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrilysin
publication title Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 248
sequence length 248
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2mziA00
2XS3A 3KECA 5I0LA 1XUDA 4L19A 2QPJA 1QJJA 4IN9A 1OM7A 1XFVA 1QICA 3LQBA 1JIZA 2OXUA 4JPAA 2SRTA 1FLSA 1CIZA 4Q1LA 2W12A 4GR0A 830CA 1B3DA 3KMEA 1YCMA 4XBHA 4A7BA 5D2BA 1AYKA 2DW2A 3I7GA 1PWWA 3EDGA 3HYGA 4PKWA 4JP4A 3LUMA 4L6TA 1D5JA 4WK7A 1KUHA 1CGFA 1EUBA 3V96B 1UMTA 4FVLA 4H84A 4HX3A 4A3WA 4GR8A 4H49A 1I76A 3N2UA 5BOTA 1BSWA 2DW1A 3KMCA 1EAKA 1XFUA 2MZEA 1GO8P 4HMAA 2DW0A 5D3CA 3EHXA 3ZUKA 3UVCA 2JIHA 5CXAA 3AYUA 4GQLA 1QJIA 1ASTA 1AF0A 1Y8JA 2X3CA 1CK7A 3BA0A 3EDHA 5BOYA 2WOAA 1GXDA 3RTSA 1K7IA 3HB2P 1SMPA 2OVXA 2A8HA 2OW1A 2MLRA 1BIWA 3MA2A 1Y0VA 2AIGP 1CXVA 3U1RA 1C7KA 1JIWP 3GBOA 4PKUA 1CAQA 1R54A 2OY4A 2N8RA 4ON1A 3HY7A 1OMJA 2WO8A 5L7FA 1XFXA 3ELMA 1BKCE 2K9CA 1JAOA 1DMTA 3LGPA 1GE6A 3F19A 1KUKA 1SLMA 3HDAP 1K7GA 1UTTA 3EHYA 3WV3A 3WV1A 1A85A 4G0DA 4GWNA 1WNIA 1QUAA 3LUNA 3P24A 4PKTA 5LABA 1Y93A 3E8RA 2FV5A 3HBVP 1JJ9A 1KAPP 2X3BA 5JMYA 5I43A 1HFCA 3DL1A 2E2DA 4AXQA 1ZTQA 1R1IA 1CGEA 4EFSA 4FXYP 1DTHA 1HOVA 5I3MA 1BKCI 1BQOA 1O0QA 2XS4A 2CLTA 1HY7A 1GE7A 1MMPA 1BKCA 3DSLA 4DV8A 1B8YA 3KEKA 1GKDA 1QIBA 2V4BA 1AKLA 4FU4A 2MLSA 3USNA 3NX7A 3L0TA 1HV5A 3VI1A 2RJPA 1H71P 2KRJA 3HBUP 3LIKA 2CKIA 3OHOA 3TSKA 3Q2GA 3ZVSA 1J7NA 3LILA 3L0VA 1IAGA 1ZVXA 4WKEA 2W0DA 1XURA 4QKZA 4IJOA 2K2GA 5I2ZA 1KUGA 1O0TA 2FV9A 3LKAA 4JQGA 3SHIA 1S4BP 3EDIA 3G5CA 1EB6A 5D1UA 1JKYA 4PKRA 1GE5A 1PWVA 4AIGA 5I12A 4DF9A 2EROA 3LE9A 3O2XA 1ZS0A 1JANA 1G05A 2Y6DA 4AYKA 4I35A 1XUCA 2JNPA 1PWPA 1L6JA 1CGLA 2X3AA 1G49A 1OS9A 1OS2A 2HU6A 1HTDA 1BQQM 3F15A 1SRPA 2JSDA 4WZVA 1XFZA 1UMSA 2X7MA 4AUOA 3CKIA 1OM6A 4IUWA 1BUVM 2TCLA 1MMQA 2WO9A 2W15A 4PKVA 4CTHA 4H76A 1MMRA 1SLNA 3EWJA 4XM7A 4GR3A 2OW9A 2OZRA 4H1QA 1KBCA 5L79A 4H3XA 1FM1A 5CZMA 5H8XA 4XCTA 2DDFA 3KWVC 1ROSA 2ERPA 2Y6CA 1ND1A 3KEJA 3B92A 5D1TA 4XM6A 4XM8A 3RTTA 1XFWA 3HY9A 4DPEA 1K7QA 3LMCA 2JT5A 4L63A 5B5OA 2J0TA 3ZXHA 3WV2A 1C8TA 1RMZA 2OW2A 3F1AA 5CUHA 3G42A 3DPEA 1G9KA 1FBLA 1G12A 3HDBA 1ZXVA 3Q2HA 1KUFA 1R55A 3DPFA 2E3XA 1GKCA 2OI0A 3VTGA 1BZSA 1Q3AA 3AYKA 4G9LA 3LJZA 966CA 3LJTA 2D1NA 1IADA 1PWUA 4I03A 3TS4A 1KUIA 3O64A 3F17A 2USNA 2ERQA 2W13A 3KRYA 4WF6A 1ATLA 1JH1A 4H82A 1IAEA 2MZIA 1JAQA 1OM8A 1BM6A 2O36A 1SATA 1G4KA 4WKIA 2AYKA 2PJTA 3K7NA 2JT6A 1YP1A 1ZP5A 5I4OA 3LIRA 4FXQA 4JA1A 3B8ZA 4ILWD 1PWQA 5D1SA 3TVCA 1BUDA 2YIGA 3K7LA 3B2ZA 3DWBA 4H30A 4R3VA 1R1JA 5BPAA 1MNCA 3KHIA 1QIAA 4H2EA 1IABA 2POJA 1Z3JA 2OXWA 2I47A 1OO9A 2L0RA 1IACA 1XFYA 1UTZA 2Z2DA 1D8MA 4J4MA 4PKSA 4DD8A 1USNA 1D8FA 1I1IP 2D1OA 1RM8A 2YB9A 456CA 1I73A 4JIJA 3P1VA 1JAPA 2J83A 1MMBA 3LEAA 4GF1A 3DNGA 4PKQA 3N2VA 1R1HA 2RJQA 2MZHA 1CQRA 1HFSA 2OVZA 1A86A 3TT4A 1D7XA 5D7WA 2O3EA 2OW0A 3EDZA 5B5PA 1IAAA 2DDYA 3LQ0A 1UEAA 2OXZA 3LK8A 4GUYA 3LJGA 4ZR5A 3F18A 4GWMA 3OHLA 3F16A 3AIGA 2W14A 1JK3A 3I7IA 1SU3A 2OY2A 1YOUA 1ZXCA 1C3IA 1GO7P 1YQYA
chains in the Genus database with same CATH superfamily
2XS3A 3KECA 5I0LA 1XUDA 4L19A 2QPJA 1QJJA 4IN9A 1OM7A 1XFVA 1QICA 3DTIA 3LQBA 1JIZA 4L7AA 2OXUA 4JPAA 2SRTA 1FLSA 1CIZA 4Q1LA 2W12A 4GR0A 830CA 1B3DA 3KMEA 1YCMA 4XBHA 4A7BA 5D2BA 1AYKA 2DW2A 3I7GA 1PWWA 3EDGA 3HYGA 4PKWA 4JP4A 3LUMA 4L6TA 1D5JA 4WK7A 1KUHA 1CGFA 1EUBA 3V96B 1UMTA 4FVLA 4H84A 4HX3A 4A3WA 4GR8A 4H49A 1I76A 3N2UA 5BOTA 1BSWA 2DW1A 3KMCA 1EAKA 1XFUA 2MZEA 1GO8P 4HMAA 2DW0A 5D3CA 3EHXA 3ZUKA 3UVCA 2JIHA 5CXAA 3AYUA 3DTKA 1QJIA 1ASTA 4GQLA 1AF0A 1Y8JA 2X3CA 3DTEA 1CK7A 2YUFA 3BA0A 3EDHA 5BOYA 2WOAA 1GXDA 3RTSA 1K7IA 3HB2P 1SMPA 2OVXA 2A8HA 2OW1A 2MLRA 1BIWA 3MA2A 1Y0VA 2AIGP 1CXVA 3U1RA 1C7KA 1JIWP 3GBOA 4PKUA 1CAQA 1R54A 2OY4A 2N8RA 4ON1A 3HY7A 1OMJA 2WO8A 5L7FA 1XFXA 3ELMA 1BKCE 2K9CA 1JAOA 1DMTA 3LGPA 1GE6A 3F19A 1KUKA 1SLMA 3HDAP 1XM5A 1K7GA 1UTTA 3EHYA 3WV3A 3WV1A 1A85A 4G0DA 4GWNA 1WNIA 1QUAA 3LUNA 3P24A 4PKTA 5LABA 1OZ9A 1Y93A 3E8RA 2FV5A 3HBVP 1JJ9A 1KAPP 2X3BA 5JMYA 5I43A 1HFCA 3DL1A 2E2DA 4AXQA 1ZTQA 1R1IA 1CGEA 4EFSA 4FXYP 1DTHA 1HOVA 5I3MA 1BKCI 1BQOA 1O0QA 2XS4A 2CLTA 1HY7A 1GE7A 1MMPA 1BKCA 3DSLA 4DV8A 1B8YA 3KEKA 1GKDA 1QIBA 2V4BA 1AKLA 4FU4A 2MLSA 3USNA 3NX7A 3L0TA 1HV5A 3VI1A 2RJPA 1H71P 2KRJA 3HBUP 3LIKA 2CKIA 3OHOA 3TSKA 3Q2GA 3ZVSA 1J7NA 3LILA 3L0VA 1IAGA 1ZVXA 4WKEA 2W0DA 1XURA 4QKZA 4IJOA 2K2GA 5I2ZA 1KUGA 1O0TA 2FV9A 3LKAA 4JQGA 3SHIA 1S4BP 3EDIA 3G5CA 1EB6A 5D1UA 1JKYA 4PKRA 1GE5A 1PWVA 4AIGA 5I12A 4DF9A 2EROA 3LE9A 3O2XA 1ZS0A 1JANA 1G05A 2Y6DA 4AYKA 4I35A 1XUCA 2JNPA 1PWPA 1L6JA 1CGLA 2X3AA 1G49A 1OS9A 1OS2A 2HU6A 1HTDA 1BQQM 3F15A 1SRPA 2JSDA 4WZVA 1XFZA 1UMSA 2X7MA 4AUOA 3CKIA 1OM6A 4IUWA 1BUVM 2TCLA 1MMQA 2WO9A 2W15A 4PKVA 4CTHA 4H76A 1MMRA 1SLNA 3EWJA 4XM7A 4GR3A 2OW9A 2OZRA 4H1QA 1KBCA 5L79A 4H3XA 1FM1A 5CZMA 5H8XA 4XCTA 2DDFA 3KWVC 1ROSA 2ERPA 2Y6CA 1ND1A 3KEJA 3B92A 5D1TA 4XM6A 4XM8A 1XAXA 3RTTA 1XFWA 3HY9A 4DPEA 1K7QA 3LMCA 2JT5A 4L63A 5B5OA 2J0TA 3ZXHA 3WV2A 1C8TA 1RMZA 2OW2A 3F1AA 5CUHA 3G42A 3DPEA 1G9KA 1FBLA 1G12A 3HDBA 1ZXVA 3Q2HA 1KUFA 1R55A 3DPFA 2E3XA 1GKCA 2OI0A 3VTGA 1BZSA 1Q3AA 3AYKA 4G9LA 3LJZA 966CA 3LJTA 2D1NA 1IADA 1PWUA 4I03A 3TS4A 1KUIA 3O64A 3F17A 2USNA 2ERQA 2W13A 3KRYA 4WF6A 1ATLA 1JH1A 4H82A 1IAEA 2MZIA 1JAQA 1OM8A 1BM6A 2O36A 1SATA 1G4KA 4WKIA 2AYKA 2PJTA 3K7NA 2JT6A 1YP1A 1ZP5A 5I4OA 3LIRA 4FXQA 4JA1A 3B8ZA 4ILWD 1PWQA 5D1SA 3TVCA 1BUDA 2YIGA 3K7LA 3B2ZA 3DWBA 4H30A 4R3VA 1R1JA 5BPAA 1MNCA 3KHIA 1QIAA 4H2EA 1IABA 2POJA 1Z3JA 2OXWA 2I47A 1OO9A 2L0RA 1IACA 1XFYA 1UTZA 2Z2DA 1D8MA 4J4MA 4PKSA 4DD8A 1USNA 1D8FA 1I1IP 2D1OA 1RM8A 2YB9A 456CA 1I73A 4JIJA 3P1VA 1JAPA 2J83A 1MMBA 3LEAA 4GF1A 3DNGA 4PKQA 3N2VA 1R1HA 2RJQA 2MZHA 1CQRA 1HFSA 2OVZA 1A86A 3TT4A 1D7XA 5D7WA 2O3EA 2OW0A 3EDZA 5B5PA 1TVIA 1IAAA 2DDYA 3LQ0A 1UEAA 2OXZA 3LK8A 4GUYA 3LJGA 4ZR5A 3F18A 4GWMA 3OHLA 3F16A 3AIGA 2W14A 1JK3A 3I7IA 1SU3A 2OY2A 1YOUA 1ZXCA 1C3IA 1GO7P 1YQYA
chains in the Genus database with same CATH topology
2XS3A 3KECA 5I0LA 1XUDA 4L19A 2QPJA 1QJJA 4IN9A 1OM7A 1XFVA 1QICA 3DTIA 3LQBA 1JIZA 4L7AA 2OXUA 4JPAA 2SRTA 1FLSA 1CIZA 4Q1LA 2W12A 4GR0A 830CA 1B3DA 3KMEA 1YCMA 4XBHA 4A7BA 5D2BA 1AYKA 2DW2A 3I7GA 1PWWA 3EDGA 3HYGA 4PKWA 4JP4A 3LUMA 4L6TA 1D5JA 4WK7A 1KUHA 1CGFA 1EUBA 3V96B 1UMTA 4FVLA 4H84A 4HX3A 4A3WA 4GR8A 4H49A 1I76A 3N2UA 5BOTA 1BSWA 2DW1A 3KMCA 1EAKA 1XFUA 2MZEA 1GO8P 4HMAA 2DW0A 5D3CA 3EHXA 3ZUKA 3UVCA 2JIHA 5CXAA 3AYUA 3DTKA 1QJIA 1ASTA 4GQLA 1AF0A 1Y8JA 2X3CA 3DTEA 1CK7A 2YUFA 3BA0A 3EDHA 5BOYA 2WOAA 1GXDA 3RTSA 1K7IA 3HB2P 1SMPA 2OVXA 2A8HA 2OW1A 2MLRA 1BIWA 3MA2A 1Y0VA 2AIGP 1CXVA 3U1RA 1C7KA 1JIWP 3GBOA 4PKUA 1CAQA 1R54A 2OY4A 2N8RA 4ON1A 3HY7A 1OMJA 2WO8A 5L7FA 1XFXA 3ELMA 1BKCE 2K9CA 1JAOA 1DMTA 3LGPA 1GE6A 3F19A 1KUKA 1SLMA 3HDAP 1K7GA 1UTTA 3EHYA 3WV3A 3WV1A 1A85A 4G0DA 4GWNA 1WNIA 1QUAA 3LUNA 3P24A 4PKTA 5LABA 1Y93A 3E8RA 2FV5A 3HBVP 1JJ9A 1KAPP 2X3BA 5JMYA 5I43A 1HFCA 3DL1A 2E2DA 4AXQA 1ZTQA 1R1IA 1CGEA 4EFSA 4FXYP 1DTHA 1HOVA 5I3MA 1BKCI 1BQOA 1O0QA 2XS4A 2CLTA 1HY7A 1GE7A 1MMPA 1BKCA 3DSLA 4DV8A 1B8YA 3KEKA 1GKDA 1QIBA 2V4BA 1AKLA 4FU4A 2MLSA 3USNA 3NX7A 3L0TA 1HV5A 3VI1A 2RJPA 1H71P 2KRJA 3HBUP 3LIKA 2CKIA 3OHOA 3TSKA 3Q2GA 3ZVSA 1J7NA 3LILA 3L0VA 1IAGA 1ZVXA 4WKEA 2W0DA 1XURA 4QKZA 4IJOA 2K2GA 5I2ZA 1KUGA 1O0TA 2FV9A 3LKAA 4JQGA 3SHIA 1S4BP 3EDIA 3G5CA 1EB6A 5D1UA 1JKYA 4PKRA 1GE5A 1PWVA 4AIGA 5I12A 4DF9A 2EROA 3LE9A 3O2XA 1ZS0A 1JANA 1G05A 2Y6DA 4AYKA 4I35A 1XUCA 2JNPA 1PWPA 1L6JA 1CGLA 2X3AA 1G49A 1OS9A 1OS2A 2HU6A 1HTDA 1BQQM 3F15A 1SRPA 2JSDA 4WZVA 1XFZA 1UMSA 2X7MA 4AUOA 3CKIA 1OM6A 4IUWA 1BUVM 2TCLA 1MMQA 2WO9A 2W15A 4PKVA 4CTHA 4H76A 1MMRA 1SLNA 3EWJA 4XM7A 4GR3A 2OW9A 2OZRA 4H1QA 1KBCA 5L79A 4H3XA 1FM1A 5CZMA 5H8XA 4XCTA 2DDFA 3KWVC 1ROSA 2ERPA 2Y6CA 1ND1A 3KEJA 3B92A 5D1TA 4XM6A 4XM8A 3RTTA 1XFWA 3HY9A 4DPEA 1K7QA 3LMCA 2JT5A 4L63A 5B5OA 2J0TA 3ZXHA 3WV2A 1C8TA 1RMZA 2OW2A 3F1AA 5CUHA 3G42A 3DPEA 1G9KA 1FBLA 1G12A 3HDBA 1ZXVA 3Q2HA 1KUFA 1R55A 3DPFA 2E3XA 1GKCA 2OI0A 3VTGA 1BZSA 1Q3AA 3AYKA 4G9LA 3LJZA 966CA 3LJTA 2D1NA 1IADA 1PWUA 4I03A 3TS4A 1KUIA 3O64A 3F17A 2USNA 2ERQA 2W13A 3KRYA 4WF6A 1ATLA 1JH1A 4H82A 1IAEA 2MZIA 1JAQA 1OM8A 1BM6A 2O36A 1SATA 1G4KA 4WKIA 2AYKA 2PJTA 3K7NA 2JT6A 1YP1A 1ZP5A 5I4OA 3LIRA 4FXQA 4JA1A 3B8ZA 4ILWD 1PWQA 5D1SA 3TVCA 1BUDA 2YIGA 3K7LA 3B2ZA 3DWBA 4H30A 4R3VA 1R1JA 5BPAA 1MNCA 3KHIA 1QIAA 4H2EA 1IABA 2POJA 1Z3JA 2OXWA 2I47A 1OO9A 2L0RA 1IACA 1XFYA 1UTZA 2Z2DA 1D8MA 4J4MA 4PKSA 4DD8A 1USNA 1D8FA 1I1IP 2D1OA 1RM8A 2YB9A 456CA 1I73A 4JIJA 3P1VA 1JAPA 2J83A 1MMBA 3LEAA 4GF1A 3DNGA 4PKQA 3N2VA 1R1HA 2RJQA 2MZHA 1CQRA 1HFSA 2OVZA 1A86A 3TT4A 1D7XA 5D7WA 2O3EA 2OW0A 3EDZA 5B5PA 1IAAA 2DDYA 3LQ0A 1UEAA 2OXZA 3LK8A 4GUYA 3LJGA 4ZR5A 3F18A 4GWMA 3OHLA 3F16A 3AIGA 2W14A 1JK3A 3I7IA 1SU3A 2OY2A 1YOUA 1ZXCA 1C3IA 1GO7P 1YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XS3 A;  3KEC A;  5I0L A;  1XUD A;  4L19 A;  2QPJ A;  1QJJ A;  4IN9 A;  1OM7 A;  1XFV A;  1QIC A;  3LQB A;  1JIZ A;  2OXU A;  4JPA A;  2SRT A;  1FLS A;  1CIZ A;  4Q1L A;  2W12 A;  4GR0 A;  830C A;  1B3D A;  3KME A;  1YCM A;  4XBH A;  4A7B A;  5D2B A;  1AYK A;  2DW2 A;  3I7G A;  1PWW A;  3EDG A;  3HYG A;  4PKW A;  4JP4 A;  3LUM A;  4L6T A;  1D5J A;  4WK7 A;  1KUH A;  1CGF A;  1EUB A;  3V96 B;  1UMT A;  4FVL A;  4H84 A;  4HX3 A;  4A3W A;  4GR8 A;  4H49 A;  1I76 A;  3N2U A;  5BOT A;  1BSW A;  2DW1 A;  3KMC A;  1EAK A;  1XFU A;  2MZE A;  1GO8 P;  4HMA A;  2DW0 A;  5D3C A;  3EHX A;  3ZUK A;  3UVC A;  2JIH A;  5CXA A;  3AYU A;  4GQL A;  1QJI A;  1AST A;  1AF0 A;  1Y8J A;  2X3C A;  1CK7 A;  3BA0 A;  3EDH A;  5BOY A;  2WOA A;  1GXD A;  3RTS A;  1K7I A;  3HB2 P;  1SMP A;  2OVX A;  2A8H A;  2OW1 A;  2MLR A;  1BIW A;  3MA2 A;  1Y0V A;  2AIG P;  1CXV A;  3U1R A;  1C7K A;  1JIW P;  3GBO A;  4PKU A;  1CAQ A;  1R54 A;  2OY4 A;  2N8R A;  4ON1 A;  3HY7 A;  1OMJ A;  2WO8 A;  5L7F A;  1XFX A;  3ELM A;  1BKC E;  2K9C A;  1JAO A;  1DMT A;  3LGP A;  1GE6 A;  3F19 A;  1KUK A;  1SLM A;  3HDA P;  1K7G A;  1UTT A;  3EHY A;  3WV3 A;  3WV1 A;  1A85 A;  4G0D A;  4GWN A;  1WNI A;  1QUA A;  3LUN A;  3P24 A;  4PKT A;  5LAB A;  1Y93 A;  3E8R A;  2FV5 A;  3HBV P;  1JJ9 A;  1KAP P;  2X3B A;  5JMY A;  5I43 A;  1HFC A;  3DL1 A;  2E2D A;  4AXQ A;  1ZTQ A;  1R1I A;  1CGE A;  4EFS A;  4FXY P;  1DTH A;  1HOV A;  5I3M A;  1BKC I;  1BQO A;  1O0Q A;  2XS4 A;  2CLT A;  1HY7 A;  1GE7 A;  1MMP A;  1BKC A;  3DSL A;  4DV8 A;  1B8Y A;  3KEK A;  1GKD A;  1QIB A;  2V4B A;  1AKL A;  4FU4 A;  2MLS A;  3USN A;  3NX7 A;  3L0T A;  1HV5 A;  3VI1 A;  2RJP A;  1H71 P;  2KRJ A;  3HBU P;  3LIK A;  2CKI A;  3OHO A;  3TSK A;  3Q2G A;  3ZVS A;  1J7N A;  3LIL A;  3L0V A;  1IAG A;  1ZVX A;  4WKE A;  2W0D A;  1XUR A;  4QKZ A;  4IJO A;  2K2G A;  5I2Z A;  1KUG A;  1O0T A;  2FV9 A;  3LKA A;  4JQG A;  3SHI A;  1S4B P;  3EDI A;  3G5C A;  1EB6 A;  5D1U A;  1JKY A;  4PKR A;  1GE5 A;  1PWV A;  4AIG A;  5I12 A;  4DF9 A;  2ERO A;  3LE9 A;  3O2X A;  1ZS0 A;  1JAN A;  1G05 A;  2Y6D A;  4AYK A;  4I35 A;  1XUC A;  2JNP A;  1PWP A;  1L6J A;  1CGL A;  2X3A A;  1G49 A;  1OS9 A;  1OS2 A;  2HU6 A;  1HTD A;  1BQQ M;  3F15 A;  1SRP A;  2JSD A;  4WZV A;  1XFZ A;  1UMS A;  2X7M A;  4AUO A;  3CKI A;  1OM6 A;  4IUW A;  1BUV M;  2TCL A;  1MMQ A;  2WO9 A;  2W15 A;  4PKV A;  4CTH A;  4H76 A;  1MMR A;  1SLN A;  3EWJ A;  4XM7 A;  4GR3 A;  2OW9 A;  2OZR A;  4H1Q A;  1KBC A;  5L79 A;  4H3X A;  1FM1 A;  5CZM A;  5H8X A;  4XCT A;  2DDF A;  3KWV C;  1ROS A;  2ERP A;  2Y6C A;  1ND1 A;  3KEJ A;  3B92 A;  5D1T A;  4XM6 A;  4XM8 A;  3RTT A;  1XFW A;  3HY9 A;  4DPE A;  1K7Q A;  3LMC A;  2JT5 A;  4L63 A;  5B5O A;  2J0T A;  3ZXH A;  3WV2 A;  1C8T A;  1RMZ A;  2OW2 A;  3F1A A;  5CUH A;  3G42 A;  3DPE A;  1G9K A;  1FBL A;  1G12 A;  3HDB A;  1ZXV A;  3Q2H A;  1KUF A;  1R55 A;  3DPF A;  2E3X A;  1GKC A;  2OI0 A;  3VTG A;  1BZS A;  1Q3A A;  3AYK A;  4G9L A;  3LJZ A;  966C A;  3LJT A;  2D1N A;  1IAD A;  1PWU A;  4I03 A;  3TS4 A;  1KUI A;  3O64 A;  3F17 A;  2USN A;  2ERQ A;  2W13 A;  3KRY A;  4WF6 A;  1ATL A;  1JH1 A;  4H82 A;  1IAE A;  2MZI A;  1JAQ A;  1OM8 A;  1BM6 A;  2O36 A;  1SAT A;  1G4K A;  4WKI A;  2AYK A;  2PJT A;  3K7N A;  2JT6 A;  1YP1 A;  1ZP5 A;  5I4O A;  3LIR A;  4FXQ A;  4JA1 A;  3B8Z A;  4ILW D;  1PWQ A;  5D1S A;  3TVC A;  1BUD A;  2YIG A;  3K7L A;  3B2Z A;  3DWB A;  4H30 A;  4R3V A;  1R1J A;  5BPA A;  1MNC A;  3KHI A;  1QIA A;  4H2E A;  1IAB A;  2POJ A;  1Z3J A;  2OXW A;  2I47 A;  1OO9 A;  2L0R A;  1IAC A;  1XFY A;  1UTZ A;  2Z2D A;  1D8M A;  4J4M A;  4PKS A;  4DD8 A;  1USN A;  1D8F A;  1I1I P;  2D1O A;  1RM8 A;  2YB9 A;  456C A;  1I73 A;  4JIJ A;  3P1V A;  1JAP A;  2J83 A;  1MMB A;  3LEA A;  4GF1 A;  3DNG A;  4PKQ A;  3N2V A;  1R1H A;  2RJQ A;  2MZH A;  1CQR A;  1HFS A;  2OVZ A;  1A86 A;  3TT4 A;  1D7X A;  5D7W A;  2O3E A;  2OW0 A;  3EDZ A;  5B5P A;  1IAA A;  2DDY A;  3LQ0 A;  1UEA A;  2OXZ A;  3LK8 A;  4GUY A;  3LJG A;  4ZR5 A;  3F18 A;  4GWM A;  3OHL A;  3F16 A;  3AIG A;  2W14 A;  1JK3 A;  3I7I A;  1SU3 A;  2OY2 A;  1YOU A;  1ZXC A;  1C3I A;  1GO7 P;  1YQY A; 
#chains in the Genus database with same CATH topology
 2XS3 A;  3KEC A;  5I0L A;  1XUD A;  4L19 A;  2QPJ A;  1QJJ A;  4IN9 A;  1OM7 A;  1XFV A;  1QIC A;  3DTI A;  3LQB A;  1JIZ A;  4L7A A;  2OXU A;  4JPA A;  2SRT A;  1FLS A;  1CIZ A;  4Q1L A;  2W12 A;  4GR0 A;  830C A;  1B3D A;  3KME A;  1YCM A;  4XBH A;  4A7B A;  5D2B A;  1AYK A;  2DW2 A;  3I7G A;  1PWW A;  3EDG A;  3HYG A;  4PKW A;  4JP4 A;  3LUM A;  4L6T A;  1D5J A;  4WK7 A;  1KUH A;  1CGF A;  1EUB A;  3V96 B;  1UMT A;  4FVL A;  4H84 A;  4HX3 A;  4A3W A;  4GR8 A;  4H49 A;  1I76 A;  3N2U A;  5BOT A;  1BSW A;  2DW1 A;  3KMC A;  1EAK A;  1XFU A;  2MZE A;  1GO8 P;  4HMA A;  2DW0 A;  5D3C A;  3EHX A;  3ZUK A;  3UVC A;  2JIH A;  5CXA A;  3AYU A;  3DTK A;  1QJI A;  1AST A;  4GQL A;  1AF0 A;  1Y8J A;  2X3C A;  3DTE A;  1CK7 A;  2YUF A;  3BA0 A;  3EDH A;  5BOY A;  2WOA A;  1GXD A;  3RTS A;  1K7I A;  3HB2 P;  1SMP A;  2OVX A;  2A8H A;  2OW1 A;  2MLR A;  1BIW A;  3MA2 A;  1Y0V A;  2AIG P;  1CXV A;  3U1R A;  1C7K A;  1JIW P;  3GBO A;  4PKU A;  1CAQ A;  1R54 A;  2OY4 A;  2N8R A;  4ON1 A;  3HY7 A;  1OMJ A;  2WO8 A;  5L7F A;  1XFX A;  3ELM A;  1BKC E;  2K9C A;  1JAO A;  1DMT A;  3LGP A;  1GE6 A;  3F19 A;  1KUK A;  1SLM A;  3HDA P;  1XM5 A;  1K7G A;  1UTT A;  3EHY A;  3WV3 A;  3WV1 A;  1A85 A;  4G0D A;  4GWN A;  1WNI A;  1QUA A;  3LUN A;  3P24 A;  4PKT A;  5LAB A;  1OZ9 A;  1Y93 A;  3E8R A;  2FV5 A;  3HBV P;  1JJ9 A;  1KAP P;  2X3B A;  5JMY A;  5I43 A;  1HFC A;  3DL1 A;  2E2D A;  4AXQ A;  1ZTQ A;  1R1I A;  1CGE A;  4EFS A;  4FXY P;  1DTH A;  1HOV A;  5I3M A;  1BKC I;  1BQO A;  1O0Q A;  2XS4 A;  2CLT A;  1HY7 A;  1GE7 A;  1MMP A;  1BKC A;  3DSL A;  4DV8 A;  1B8Y A;  3KEK A;  1GKD A;  1QIB A;  2V4B A;  1AKL A;  4FU4 A;  2MLS A;  3USN A;  3NX7 A;  3L0T A;  1HV5 A;  3VI1 A;  2RJP A;  1H71 P;  2KRJ A;  3HBU P;  3LIK A;  2CKI A;  3OHO A;  3TSK A;  3Q2G A;  3ZVS A;  1J7N A;  3LIL A;  3L0V A;  1IAG A;  1ZVX A;  4WKE A;  2W0D A;  1XUR A;  4QKZ A;  4IJO A;  2K2G A;  5I2Z A;  1KUG A;  1O0T A;  2FV9 A;  3LKA A;  4JQG A;  3SHI A;  1S4B P;  3EDI A;  3G5C A;  1EB6 A;  5D1U A;  1JKY A;  4PKR A;  1GE5 A;  1PWV A;  4AIG A;  5I12 A;  4DF9 A;  2ERO A;  3LE9 A;  3O2X A;  1ZS0 A;  1JAN A;  1G05 A;  2Y6D A;  4AYK A;  4I35 A;  1XUC A;  2JNP A;  1PWP A;  1L6J A;  1CGL A;  2X3A A;  1G49 A;  1OS9 A;  1OS2 A;  2HU6 A;  1HTD A;  1BQQ M;  3F15 A;  1SRP A;  2JSD A;  4WZV A;  1XFZ A;  1UMS A;  2X7M A;  4AUO A;  3CKI A;  1OM6 A;  4IUW A;  1BUV M;  2TCL A;  1MMQ A;  2WO9 A;  2W15 A;  4PKV A;  4CTH A;  4H76 A;  1MMR A;  1SLN A;  3EWJ A;  4XM7 A;  4GR3 A;  2OW9 A;  2OZR A;  4H1Q A;  1KBC A;  5L79 A;  4H3X A;  1FM1 A;  5CZM A;  5H8X A;  4XCT A;  2DDF A;  3KWV C;  1ROS A;  2ERP A;  2Y6C A;  1ND1 A;  3KEJ A;  3B92 A;  5D1T A;  4XM6 A;  4XM8 A;  1XAX A;  3RTT A;  1XFW A;  3HY9 A;  4DPE A;  1K7Q A;  3LMC A;  2JT5 A;  4L63 A;  5B5O A;  2J0T A;  3ZXH A;  3WV2 A;  1C8T A;  1RMZ A;  2OW2 A;  3F1A A;  5CUH A;  3G42 A;  3DPE A;  1G9K A;  1FBL A;  1G12 A;  3HDB A;  1ZXV A;  3Q2H A;  1KUF A;  1R55 A;  3DPF A;  2E3X A;  1GKC A;  2OI0 A;  3VTG A;  1BZS A;  1Q3A A;  3AYK A;  4G9L A;  3LJZ A;  966C A;  3LJT A;  2D1N A;  1IAD A;  1PWU A;  4I03 A;  3TS4 A;  1KUI A;  3O64 A;  3F17 A;  2USN A;  2ERQ A;  2W13 A;  3KRY A;  4WF6 A;  1ATL A;  1JH1 A;  4H82 A;  1IAE A;  2MZI A;  1JAQ A;  1OM8 A;  1BM6 A;  2O36 A;  1SAT A;  1G4K A;  4WKI A;  2AYK A;  2PJT A;  3K7N A;  2JT6 A;  1YP1 A;  1ZP5 A;  5I4O A;  3LIR A;  4FXQ A;  4JA1 A;  3B8Z A;  4ILW D;  1PWQ A;  5D1S A;  3TVC A;  1BUD A;  2YIG A;  3K7L A;  3B2Z A;  3DWB A;  4H30 A;  4R3V A;  1R1J A;  5BPA A;  1MNC A;  3KHI A;  1QIA A;  4H2E A;  1IAB A;  2POJ A;  1Z3J A;  2OXW A;  2I47 A;  1OO9 A;  2L0R A;  1IAC A;  1XFY A;  1UTZ A;  2Z2D A;  1D8M A;  4J4M A;  4PKS A;  4DD8 A;  1USN A;  1D8F A;  1I1I P;  2D1O A;  1RM8 A;  2YB9 A;  456C A;  1I73 A;  4JIJ A;  3P1V A;  1JAP A;  2J83 A;  1MMB A;  3LEA A;  4GF1 A;  3DNG A;  4PKQ A;  3N2V A;  1R1H A;  2RJQ A;  2MZH A;  1CQR A;  1HFS A;  2OVZ A;  1A86 A;  3TT4 A;  1D7X A;  5D7W A;  2O3E A;  2OW0 A;  3EDZ A;  5B5P A;  1TVI A;  1IAA A;  2DDY A;  3LQ0 A;  1UEA A;  2OXZ A;  3LK8 A;  4GUY A;  3LJG A;  4ZR5 A;  3F18 A;  4GWM A;  3OHL A;  3F16 A;  3AIG A;  2W14 A;  1JK3 A;  3I7I A;  1SU3 A;  2OY2 A;  1YOU A;  1ZXC A;  1C3I A;  1GO7 P;  1YQY A; 
#chains in the Genus database with same CATH homology
 2XS3 A;  3KEC A;  5I0L A;  1XUD A;  4L19 A;  2QPJ A;  1QJJ A;  4IN9 A;  1OM7 A;  1XFV A;  1QIC A;  3DTI A;  3LQB A;  1JIZ A;  4L7A A;  2OXU A;  4JPA A;  2SRT A;  1FLS A;  1CIZ A;  4Q1L A;  2W12 A;  4GR0 A;  830C A;  1B3D A;  3KME A;  1YCM A;  4XBH A;  4A7B A;  5D2B A;  1AYK A;  2DW2 A;  3I7G A;  1PWW A;  3EDG A;  3HYG A;  4PKW A;  4JP4 A;  3LUM A;  4L6T A;  1D5J A;  4WK7 A;  1KUH A;  1CGF A;  1EUB A;  3V96 B;  1UMT A;  4FVL A;  4H84 A;  4HX3 A;  4A3W A;  4GR8 A;  4H49 A;  1I76 A;  3N2U A;  5BOT A;  1BSW A;  2DW1 A;  3KMC A;  1EAK A;  1XFU A;  2MZE A;  1GO8 P;  4HMA A;  2DW0 A;  5D3C A;  3EHX A;  3ZUK A;  3UVC A;  2JIH A;  5CXA A;  3AYU A;  3DTK A;  1QJI A;  1AST A;  4GQL A;  1AF0 A;  1Y8J A;  2X3C A;  3DTE A;  1CK7 A;  2YUF A;  3BA0 A;  3EDH A;  5BOY A;  2WOA A;  1GXD A;  3RTS A;  1K7I A;  3HB2 P;  1SMP A;  2OVX A;  2A8H A;  2OW1 A;  2MLR A;  1BIW A;  3MA2 A;  1Y0V A;  2AIG P;  1CXV A;  3U1R A;  1C7K A;  1JIW P;  3GBO A;  4PKU A;  1CAQ A;  1R54 A;  2OY4 A;  2N8R A;  4ON1 A;  3HY7 A;  1OMJ A;  2WO8 A;  5L7F A;  1XFX A;  3ELM A;  1BKC E;  2K9C A;  1JAO A;  1DMT A;  3LGP A;  1GE6 A;  3F19 A;  1KUK A;  1SLM A;  3HDA P;  1K7G A;  1UTT A;  3EHY A;  3WV3 A;  3WV1 A;  1A85 A;  4G0D A;  4GWN A;  1WNI A;  1QUA A;  3LUN A;  3P24 A;  4PKT A;  5LAB A;  1Y93 A;  3E8R A;  2FV5 A;  3HBV P;  1JJ9 A;  1KAP P;  2X3B A;  5JMY A;  5I43 A;  1HFC A;  3DL1 A;  2E2D A;  4AXQ A;  1ZTQ A;  1R1I A;  1CGE A;  4EFS A;  4FXY P;  1DTH A;  1HOV A;  5I3M A;  1BKC I;  1BQO A;  1O0Q A;  2XS4 A;  2CLT A;  1HY7 A;  1GE7 A;  1MMP A;  1BKC A;  3DSL A;  4DV8 A;  1B8Y A;  3KEK A;  1GKD A;  1QIB A;  2V4B A;  1AKL A;  4FU4 A;  2MLS A;  3USN A;  3NX7 A;  3L0T A;  1HV5 A;  3VI1 A;  2RJP A;  1H71 P;  2KRJ A;  3HBU P;  3LIK A;  2CKI A;  3OHO A;  3TSK A;  3Q2G A;  3ZVS A;  1J7N A;  3LIL A;  3L0V A;  1IAG A;  1ZVX A;  4WKE A;  2W0D A;  1XUR A;  4QKZ A;  4IJO A;  2K2G A;  5I2Z A;  1KUG A;  1O0T A;  2FV9 A;  3LKA A;  4JQG A;  3SHI A;  1S4B P;  3EDI A;  3G5C A;  1EB6 A;  5D1U A;  1JKY A;  4PKR A;  1GE5 A;  1PWV A;  4AIG A;  5I12 A;  4DF9 A;  2ERO A;  3LE9 A;  3O2X A;  1ZS0 A;  1JAN A;  1G05 A;  2Y6D A;  4AYK A;  4I35 A;  1XUC A;  2JNP A;  1PWP A;  1L6J A;  1CGL A;  2X3A A;  1G49 A;  1OS9 A;  1OS2 A;  2HU6 A;  1HTD A;  1BQQ M;  3F15 A;  1SRP A;  2JSD A;  4WZV A;  1XFZ A;  1UMS A;  2X7M A;  4AUO A;  3CKI A;  1OM6 A;  4IUW A;  1BUV M;  2TCL A;  1MMQ A;  2WO9 A;  2W15 A;  4PKV A;  4CTH A;  4H76 A;  1MMR A;  1SLN A;  3EWJ A;  4XM7 A;  4GR3 A;  2OW9 A;  2OZR A;  4H1Q A;  1KBC A;  5L79 A;  4H3X A;  1FM1 A;  5CZM A;  5H8X A;  4XCT A;  2DDF A;  3KWV C;  1ROS A;  2ERP A;  2Y6C A;  1ND1 A;  3KEJ A;  3B92 A;  5D1T A;  4XM6 A;  4XM8 A;  3RTT A;  1XFW A;  3HY9 A;  4DPE A;  1K7Q A;  3LMC A;  2JT5 A;  4L63 A;  5B5O A;  2J0T A;  3ZXH A;  3WV2 A;  1C8T A;  1RMZ A;  2OW2 A;  3F1A A;  5CUH A;  3G42 A;  3DPE A;  1G9K A;  1FBL A;  1G12 A;  3HDB A;  1ZXV A;  3Q2H A;  1KUF A;  1R55 A;  3DPF A;  2E3X A;  1GKC A;  2OI0 A;  3VTG A;  1BZS A;  1Q3A A;  3AYK A;  4G9L A;  3LJZ A;  966C A;  3LJT A;  2D1N A;  1IAD A;  1PWU A;  4I03 A;  3TS4 A;  1KUI A;  3O64 A;  3F17 A;  2USN A;  2ERQ A;  2W13 A;  3KRY A;  4WF6 A;  1ATL A;  1JH1 A;  4H82 A;  1IAE A;  2MZI A;  1JAQ A;  1OM8 A;  1BM6 A;  2O36 A;  1SAT A;  1G4K A;  4WKI A;  2AYK A;  2PJT A;  3K7N A;  2JT6 A;  1YP1 A;  1ZP5 A;  5I4O A;  3LIR A;  4FXQ A;  4JA1 A;  3B8Z A;  4ILW D;  1PWQ A;  5D1S A;  3TVC A;  1BUD A;  2YIG A;  3K7L A;  3B2Z A;  3DWB A;  4H30 A;  4R3V A;  1R1J A;  5BPA A;  1MNC A;  3KHI A;  1QIA A;  4H2E A;  1IAB A;  2POJ A;  1Z3J A;  2OXW A;  2I47 A;  1OO9 A;  2L0R A;  1IAC A;  1XFY A;  1UTZ A;  2Z2D A;  1D8M A;  4J4M A;  4PKS A;  4DD8 A;  1USN A;  1D8F A;  1I1I P;  2D1O A;  1RM8 A;  2YB9 A;  456C A;  1I73 A;  4JIJ A;  3P1V A;  1JAP A;  2J83 A;  1MMB A;  3LEA A;  4GF1 A;  3DNG A;  4PKQ A;  3N2V A;  1R1H A;  2RJQ A;  2MZH A;  1CQR A;  1HFS A;  2OVZ A;  1A86 A;  3TT4 A;  1D7X A;  5D7W A;  2O3E A;  2OW0 A;  3EDZ A;  5B5P A;  1IAA A;  2DDY A;  3LQ0 A;  1UEA A;  2OXZ A;  3LK8 A;  4GUY A;  3LJG A;  4ZR5 A;  3F18 A;  4GWM A;  3OHL A;  3F16 A;  3AIG A;  2W14 A;  1JK3 A;  3I7I A;  1SU3 A;  2OY2 A;  1YOU A;  1ZXC A;  1C3I A;  1GO7 P;  1YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...