2OXUA

Uninhibited form of human mmp-12
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oxuA00
3SHIA 4PKUA 1AYKA 2X3BA 2DDFA 2X3CA 1JKYA 2OW0A 2D1OA 3DPFA 1BKCE 5B5OA 3RTSA 1CGLA 1JJ9A 4FXQA 3LQBA 1A86A 4AXQA 3CKIA 2WOAA 2PJTA 1XFVA 3KRYA 1KBCA 456CA 2J83A 966CA 4EFSA 2WO8A 1K7QA 4PKVA 1ZP5A 1CIZA 1KUIA 2W0DA 3HDBA 2W15A 1QJIA 3TS4A 3V96B 2V4BA 1S4BP 1AF0A 3I7GA 2OZRA 3EDGA 1Y93A 2E3XA 3ZXHA 2W13A 1PWUA 5JMYA 1BM6A 5I12A 3KEKA 2KRJA 1UTZA 3HDAP 1HOVA 1JIWP 1BZSA 1XFUA 3EWJA 4PKWA 5CUHA 2A8HA 2RJQA 1MMPA 1CK7A 2N8RA 1GE6A 2OW9A 3TVCA 3ELMA 1IAEA 4HX3A 1DMTA 1GO8P 3EDZA 4GQLA 1PWPA 1G12A 1YQYA 5I4OA 4H76A 3EHYA 1G4KA 1XFXA 3LUNA 2JIHA 2ERQA 1KUHA 3OHOA 5D7WA 1OMJA 3TT4A 2CKIA 2HU6A 3GBOA 1R55A 3F17A 830CA 4ZR5A 2X7MA 1CAQA 1KUFA 3KEJA 4DV8A 4H82A 2OI0A 2AIGP 5D3CA 3G5CA 1JAPA 2JNPA 1QUAA 3U1RA 4L19A 2FV9A 1AKLA 4FVLA 3VTGA 1Y8JA 1R1IA 2FV5A 4H84A 1XURA 2O36A 2YIGA 3DSLA 1XUCA 4JP4A 1SLNA 1WNIA 1G49A 1D7XA 4AYKA 1ZS0A 2USNA 5D2BA 1USNA 2DDYA 2JT6A 4DPEA 4JPAA 5D1TA 1BKCI 1K7IA 1UTTA 2XS3A 3F18A 3OHLA 2YB9A 3HBVP 1SMPA 4PKQA 4WZVA 3F19A 5BOTA 3HBUP 2W14A 5CZMA 2MZHA 1EAKA 2OVXA 3MA2A 3KMEA 4DF9A 3EHXA 2K2GA 1O0TA 1ZTQA 3KMCA 4GWMA 1SLMA 3LJTA 1CGFA 1I76A 1MNCA 3N2UA 1MMBA 3I7IA 3UVCA 1K7GA 1UMSA 3P24A 3NX7A 1C7KA 1GKDA 2DW0A 4XCTA 4L6TA 2E2DA 1OM7A 2QPJA 1CXVA 4IN9A 1JAQA 3B92A 1G05A 1XFYA 1IAGA 3LK8A 3KECA 4FXYP 3KWVC 4H30A 4GR3A 2OVZA 1QJJA 5I0LA 1YP1A 4I35A 1FBLA 1ZXVA 1C3IA 4H49A 1IACA 1JANA 1OS2A 3LIRA 4HMAA 2OXZA 2TCLA 2OXUA 1EUBA 2EROA 3K7LA 5D1SA 2I47A 2Y6CA 3K7NA 3F16A 1IABA 1RM8A 3DWBA 2SRTA 3LJZA 4AUOA 1PWVA 4WKIA 2MLSA 3L0VA 5B5PA 4A7BA 2X3AA 2DW1A 4GR0A 1DTHA 1PWWA 4GUYA 3EDIA 4GWNA 1L6JA 3ZVSA 1CGEA 1GE7A 3E8RA 1CQRA 2CLTA 3F1AA 4L63A 1R54A 4WF6A 2OY2A 1OM8A 4JA1A 5L79A 1GE5A 3B8ZA 1MMRA 3LQ0A 1GKCA 3O64A 2MZEA 3B2ZA 1ZVXA 2OW2A 1H71P 1D8MA 5I2ZA 3KHIA 1D5JA 5H8XA 4JQGA 5BOYA 3L0TA 1A85A 3DNGA 4XM6A 4GF1A 3TSKA 4Q1LA 1Q3AA 3ZUKA 1O0QA 3DPEA 2Z2DA 3VI1A 5D1UA 1YCMA 1JIZA 1C8TA 3EDHA 1JAOA 2K9CA 4PKTA 4WK7A 2POJA 1I1IP 3Q2GA 2JT5A 4QKZA 1R1HA 2Y6DA 2MLRA 1HFSA 1GO7P 4PKRA 2O3EA 1BQOA 4PKSA 1B3DA 1XFWA 4XBHA 1SRPA 4GR8A 4ILWD 3LILA 4G0DA 2L0RA 4JIJA 1ROSA 1XUDA 1GXDA 1J7NA 3G42A 3HY9A 4CTHA 5LABA 1BIWA 3N2VA 3LMCA 1HFCA 1FLSA 2D1NA 3DL1A 2DW2A 1BUDA 3LGPA 3LKAA 1ND1A 2MZIA 2RJPA 2W12A 5L7FA 3P1VA 4H2EA 4IJOA 4J4MA 4IUWA 5BPAA 4XM7A 3WV2A 3AYUA 1B8YA 3WV3A 2OW1A 1Z3JA 2JSDA 1OM6A 1BQQM 1QIBA 3AIGA 3BA0A 1HTDA 1SATA 3LUMA 2WO9A 1G9KA 1BUVM 1MMQA 3USNA 2XS4A 1PWQA 3LEAA 1HY7A 3F15A 4XM8A 3LJGA 2ERPA 1IADA 1JK3A 1FM1A 3RTTA 3HYGA 4WKEA 1XFZA 4H3XA 3LIKA 3WV1A 3AYKA 1BSWA 4G9LA 1OO9A 3Q2HA 1KUKA 4DD8A 4A3WA 4AIGA 1I73A 1UMTA 5I3MA 1UEAA 1Y0VA 3O2XA 1D8FA 3HB2P 4I03A 4R3VA 1ZXCA 1EB6A 1OS9A 1ASTA 5CXAA 1HV5A 1BKCA 1YOUA 3HY7A 2OXWA 3LE9A 1RMZA 2AYKA 1JH1A 4FU4A 1KAPP 1QICA 4ON1A 2J0TA 2OY4A 1SU3A 1ATLA 5I43A 1R1JA 1IAAA 4H1QA 1QIAA 1KUGA
chains in the Genus database with same CATH superfamily
3SHIA 4PKUA 1AYKA 2X3BA 2DDFA 2X3CA 1JKYA 2OW0A 2D1OA 3DPFA 1BKCE 5B5OA 3RTSA 1CGLA 1JJ9A 4FXQA 3LQBA 1A86A 4AXQA 3CKIA 2WOAA 2PJTA 1XFVA 3KRYA 1KBCA 456CA 2J83A 966CA 4EFSA 2WO8A 1K7QA 4PKVA 1ZP5A 1CIZA 1KUIA 2W0DA 3HDBA 2W15A 1QJIA 3TS4A 3V96B 2V4BA 1S4BP 1AF0A 3I7GA 2OZRA 3EDGA 1Y93A 2E3XA 3ZXHA 2W13A 1PWUA 1XAXA 5JMYA 1BM6A 5I12A 3KEKA 2KRJA 1UTZA 3HDAP 1HOVA 1JIWP 1BZSA 1XFUA 3EWJA 4PKWA 5CUHA 2A8HA 2RJQA 1MMPA 1CK7A 2N8RA 1GE6A 2OW9A 3TVCA 3ELMA 1IAEA 4HX3A 1DMTA 1GO8P 3EDZA 4GQLA 1PWPA 1G12A 1YQYA 5I4OA 4H76A 3EHYA 1G4KA 1XFXA 3LUNA 2JIHA 2ERQA 1KUHA 3OHOA 5D7WA 1OMJA 3TT4A 2CKIA 2HU6A 3GBOA 1R55A 3F17A 830CA 4ZR5A 1XM5A 1CAQA 2X7MA 1TVIA 1KUFA 3KEJA 4DV8A 4H82A 2OI0A 2AIGP 5D3CA 3DTKA 3G5CA 1JAPA 2JNPA 1QUAA 3U1RA 4L19A 2FV9A 1AKLA 4FVLA 3VTGA 1Y8JA 1R1IA 2FV5A 4H84A 1XURA 2O36A 2YIGA 3DSLA 1XUCA 4JP4A 1SLNA 1WNIA 1G49A 1D7XA 4AYKA 1ZS0A 2USNA 5D2BA 1USNA 2DDYA 2JT6A 4DPEA 4JPAA 5D1TA 1BKCI 1K7IA 1UTTA 2XS3A 3F18A 3OHLA 2YB9A 3HBVP 1SMPA 4PKQA 4WZVA 3F19A 5BOTA 3HBUP 2W14A 5CZMA 2MZHA 1EAKA 2OVXA 3MA2A 3KMEA 4DF9A 3EHXA 2K2GA 1O0TA 1ZTQA 3KMCA 4GWMA 1SLMA 3LJTA 1CGFA 1I76A 1MNCA 3N2UA 1MMBA 3I7IA 3UVCA 1K7GA 1UMSA 3P24A 3NX7A 1C7KA 1GKDA 2DW0A 4XCTA 4L6TA 2E2DA 1OM7A 2QPJA 1CXVA 4IN9A 1JAQA 3B92A 1G05A 1XFYA 1IAGA 1OZ9A 3LK8A 3KECA 4FXYP 3KWVC 4H30A 4GR3A 2OVZA 1QJJA 5I0LA 1YP1A 4I35A 1FBLA 1ZXVA 1C3IA 4H49A 1IACA 1JANA 1OS2A 3LIRA 4HMAA 2OXZA 2TCLA 2OXUA 1EUBA 2EROA 3K7LA 5D1SA 2I47A 2Y6CA 3K7NA 3F16A 1IABA 1RM8A 3DWBA 2SRTA 3LJZA 4AUOA 1PWVA 4WKIA 2MLSA 3L0VA 5B5PA 4A7BA 2X3AA 2DW1A 4GR0A 1DTHA 1PWWA 4GUYA 3EDIA 4GWNA 1L6JA 3ZVSA 1CGEA 1GE7A 3E8RA 1CQRA 2CLTA 3F1AA 4L63A 1R54A 4WF6A 2OY2A 1OM8A 4JA1A 5L79A 1GE5A 3B8ZA 1MMRA 3LQ0A 1GKCA 3O64A 2MZEA 3B2ZA 1ZVXA 2OW2A 1H71P 1D8MA 5I2ZA 3KHIA 1D5JA 5H8XA 4JQGA 5BOYA 3L0TA 1A85A 3DNGA 4XM6A 4GF1A 3TSKA 4Q1LA 1Q3AA 3ZUKA 1O0QA 3DPEA 2Z2DA 3VI1A 2YUFA 5D1UA 1YCMA 1JIZA 1C8TA 3EDHA 1JAOA 2K9CA 3DTIA 4PKTA 4WK7A 2POJA 1I1IP 3Q2GA 2JT5A 4QKZA 1R1HA 2Y6DA 2MLRA 1HFSA 1GO7P 4PKRA 2O3EA 1BQOA 4PKSA 4L7AA 1B3DA 1XFWA 4XBHA 1SRPA 4GR8A 4ILWD 3LILA 4G0DA 2L0RA 4JIJA 1ROSA 1XUDA 1GXDA 1J7NA 3G42A 3HY9A 4CTHA 5LABA 1BIWA 3N2VA 3LMCA 1HFCA 1FLSA 2D1NA 3DL1A 2DW2A 1BUDA 3LGPA 3LKAA 1ND1A 2MZIA 2RJPA 2W12A 5L7FA 3P1VA 4H2EA 4IJOA 4J4MA 4IUWA 5BPAA 4XM7A 3WV2A 3AYUA 1B8YA 3WV3A 2OW1A 1Z3JA 2JSDA 1OM6A 1BQQM 1QIBA 3AIGA 3BA0A 1HTDA 1SATA 3LUMA 2WO9A 1G9KA 3DTEA 1BUVM 1MMQA 3USNA 2XS4A 1PWQA 3LEAA 1HY7A 3F15A 4XM8A 3LJGA 2ERPA 1IADA 1JK3A 1FM1A 3RTTA 3HYGA 4WKEA 1XFZA 4H3XA 3LIKA 3WV1A 3AYKA 1BSWA 4G9LA 1OO9A 3Q2HA 1KUKA 4DD8A 4A3WA 4AIGA 1I73A 1UMTA 5I3MA 1UEAA 1Y0VA 3O2XA 1D8FA 3HB2P 4I03A 4R3VA 1ZXCA 1EB6A 1OS9A 1ASTA 5CXAA 1HV5A 1BKCA 1YOUA 3HY7A 2OXWA 3LE9A 1RMZA 2AYKA 1JH1A 4FU4A 1KAPP 1QICA 4ON1A 2J0TA 2OY4A 1SU3A 1ATLA 5I43A 1R1JA 1IAAA 4H1QA 1QIAA 1KUGA
chains in the Genus database with same CATH topology
3SHIA 4PKUA 1AYKA 2X3BA 2DDFA 2X3CA 1JKYA 2OW0A 2D1OA 3DPFA 1BKCE 5B5OA 3RTSA 1CGLA 1JJ9A 4FXQA 3LQBA 1A86A 4AXQA 3CKIA 2WOAA 2PJTA 1XFVA 3KRYA 1KBCA 456CA 2J83A 966CA 4EFSA 2WO8A 1K7QA 4PKVA 1ZP5A 1CIZA 1KUIA 2W0DA 3HDBA 2W15A 1QJIA 3TS4A 3V96B 2V4BA 1S4BP 1AF0A 3I7GA 2OZRA 3EDGA 1Y93A 2E3XA 3ZXHA 2W13A 1PWUA 5JMYA 1BM6A 5I12A 3KEKA 2KRJA 1UTZA 3HDAP 1HOVA 1JIWP 1BZSA 1XFUA 3EWJA 4PKWA 5CUHA 2A8HA 2RJQA 1MMPA 1CK7A 2N8RA 1GE6A 2OW9A 3TVCA 3ELMA 1IAEA 4HX3A 1DMTA 1GO8P 3EDZA 4GQLA 1PWPA 1G12A 1YQYA 5I4OA 4H76A 3EHYA 1G4KA 1XFXA 3LUNA 2JIHA 2ERQA 1KUHA 3OHOA 5D7WA 1OMJA 3TT4A 2CKIA 2HU6A 3GBOA 1R55A 3F17A 830CA 4ZR5A 2X7MA 1CAQA 1KUFA 3KEJA 4DV8A 4H82A 2OI0A 2AIGP 5D3CA 3DTKA 3G5CA 1JAPA 2JNPA 1QUAA 3U1RA 4L19A 2FV9A 1AKLA 4FVLA 3VTGA 1Y8JA 1R1IA 2FV5A 4H84A 1XURA 2O36A 2YIGA 3DSLA 1XUCA 4JP4A 1SLNA 1WNIA 1G49A 1D7XA 4AYKA 1ZS0A 2USNA 5D2BA 1USNA 2DDYA 2JT6A 4DPEA 4JPAA 5D1TA 1BKCI 1K7IA 1UTTA 2XS3A 3F18A 3OHLA 2YB9A 3HBVP 1SMPA 4PKQA 4WZVA 3F19A 5BOTA 3HBUP 2W14A 5CZMA 2MZHA 1EAKA 2OVXA 3MA2A 3KMEA 4DF9A 3EHXA 2K2GA 1O0TA 1ZTQA 3KMCA 4GWMA 1SLMA 3LJTA 1CGFA 1I76A 1MNCA 3N2UA 1MMBA 3I7IA 3UVCA 1K7GA 1UMSA 3P24A 3NX7A 1C7KA 1GKDA 2DW0A 4XCTA 4L6TA 2E2DA 1OM7A 2QPJA 1CXVA 4IN9A 1JAQA 3B92A 1G05A 1XFYA 1IAGA 3LK8A 3KECA 4FXYP 3KWVC 4H30A 4GR3A 2OVZA 1QJJA 5I0LA 1YP1A 4I35A 1FBLA 1ZXVA 1C3IA 4H49A 1IACA 1JANA 1OS2A 3LIRA 4HMAA 2OXZA 2TCLA 2OXUA 1EUBA 2EROA 3K7LA 5D1SA 2I47A 2Y6CA 3K7NA 3F16A 1IABA 1RM8A 3DWBA 2SRTA 3LJZA 4AUOA 1PWVA 4WKIA 2MLSA 3L0VA 5B5PA 4A7BA 2X3AA 2DW1A 4GR0A 1DTHA 1PWWA 4GUYA 3EDIA 4GWNA 1L6JA 3ZVSA 1CGEA 1GE7A 3E8RA 1CQRA 2CLTA 3F1AA 4L63A 1R54A 4WF6A 2OY2A 1OM8A 4JA1A 5L79A 1GE5A 3B8ZA 1MMRA 3LQ0A 1GKCA 3O64A 2MZEA 3B2ZA 1ZVXA 2OW2A 1H71P 1D8MA 5I2ZA 3KHIA 1D5JA 5H8XA 4JQGA 5BOYA 3L0TA 1A85A 3DNGA 4XM6A 4GF1A 3TSKA 4Q1LA 1Q3AA 3ZUKA 1O0QA 3DPEA 2Z2DA 3VI1A 2YUFA 5D1UA 1YCMA 1JIZA 1C8TA 3EDHA 1JAOA 2K9CA 3DTIA 4PKTA 4WK7A 2POJA 1I1IP 3Q2GA 2JT5A 4QKZA 1R1HA 2Y6DA 2MLRA 1HFSA 1GO7P 4PKRA 2O3EA 1BQOA 4PKSA 4L7AA 1B3DA 1XFWA 4XBHA 1SRPA 4GR8A 4ILWD 3LILA 4G0DA 2L0RA 4JIJA 1ROSA 1XUDA 1GXDA 1J7NA 3G42A 3HY9A 4CTHA 5LABA 1BIWA 3N2VA 3LMCA 1HFCA 1FLSA 2D1NA 3DL1A 2DW2A 1BUDA 3LGPA 3LKAA 1ND1A 2MZIA 2RJPA 2W12A 5L7FA 3P1VA 4H2EA 4IJOA 4J4MA 4IUWA 5BPAA 4XM7A 3WV2A 3AYUA 1B8YA 3WV3A 2OW1A 1Z3JA 2JSDA 1OM6A 1BQQM 1QIBA 3AIGA 3BA0A 1HTDA 1SATA 3LUMA 2WO9A 1G9KA 3DTEA 1BUVM 1MMQA 3USNA 2XS4A 1PWQA 3LEAA 1HY7A 3F15A 4XM8A 3LJGA 2ERPA 1IADA 1JK3A 1FM1A 3RTTA 3HYGA 4WKEA 1XFZA 4H3XA 3LIKA 3WV1A 3AYKA 1BSWA 4G9LA 1OO9A 3Q2HA 1KUKA 4DD8A 4A3WA 4AIGA 1I73A 1UMTA 5I3MA 1UEAA 1Y0VA 3O2XA 1D8FA 3HB2P 4I03A 4R3VA 1ZXCA 1EB6A 1OS9A 1ASTA 5CXAA 1HV5A 1BKCA 1YOUA 3HY7A 2OXWA 3LE9A 1RMZA 2AYKA 1JH1A 4FU4A 1KAPP 1QICA 4ON1A 2J0TA 2OY4A 1SU3A 1ATLA 5I43A 1R1JA 1IAAA 4H1QA 1QIAA 1KUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHI A;  4PKU A;  1AYK A;  2X3B A;  2DDF A;  2X3C A;  1JKY A;  2OW0 A;  2D1O A;  3DPF A;  1BKC E;  5B5O A;  3RTS A;  1CGL A;  1JJ9 A;  4FXQ A;  3LQB A;  1A86 A;  4AXQ A;  3CKI A;  2WOA A;  2PJT A;  1XFV A;  3KRY A;  1KBC A;  456C A;  2J83 A;  966C A;  4EFS A;  2WO8 A;  1K7Q A;  4PKV A;  1ZP5 A;  1CIZ A;  1KUI A;  2W0D A;  3HDB A;  2W15 A;  1QJI A;  3TS4 A;  3V96 B;  2V4B A;  1S4B P;  1AF0 A;  3I7G A;  2OZR A;  3EDG A;  1Y93 A;  2E3X A;  3ZXH A;  2W13 A;  1PWU A;  5JMY A;  1BM6 A;  5I12 A;  3KEK A;  2KRJ A;  1UTZ A;  3HDA P;  1HOV A;  1JIW P;  1BZS A;  1XFU A;  3EWJ A;  4PKW A;  5CUH A;  2A8H A;  2RJQ A;  1MMP A;  1CK7 A;  2N8R A;  1GE6 A;  2OW9 A;  3TVC A;  3ELM A;  1IAE A;  4HX3 A;  1DMT A;  1GO8 P;  3EDZ A;  4GQL A;  1PWP A;  1G12 A;  1YQY A;  5I4O A;  4H76 A;  3EHY A;  1G4K A;  1XFX A;  3LUN A;  2JIH A;  2ERQ A;  1KUH A;  3OHO A;  5D7W A;  1OMJ A;  3TT4 A;  2CKI A;  2HU6 A;  3GBO A;  1R55 A;  3F17 A;  830C A;  4ZR5 A;  2X7M A;  1CAQ A;  1KUF A;  3KEJ A;  4DV8 A;  4H82 A;  2OI0 A;  2AIG P;  5D3C A;  3G5C A;  1JAP A;  2JNP A;  1QUA A;  3U1R A;  4L19 A;  2FV9 A;  1AKL A;  4FVL A;  3VTG A;  1Y8J A;  1R1I A;  2FV5 A;  4H84 A;  1XUR A;  2O36 A;  2YIG A;  3DSL A;  1XUC A;  4JP4 A;  1SLN A;  1WNI A;  1G49 A;  1D7X A;  4AYK A;  1ZS0 A;  2USN A;  5D2B A;  1USN A;  2DDY A;  2JT6 A;  4DPE A;  4JPA A;  5D1T A;  1BKC I;  1K7I A;  1UTT A;  2XS3 A;  3F18 A;  3OHL A;  2YB9 A;  3HBV P;  1SMP A;  4PKQ A;  4WZV A;  3F19 A;  5BOT A;  3HBU P;  2W14 A;  5CZM A;  2MZH A;  1EAK A;  2OVX A;  3MA2 A;  3KME A;  4DF9 A;  3EHX A;  2K2G A;  1O0T A;  1ZTQ A;  3KMC A;  4GWM A;  1SLM A;  3LJT A;  1CGF A;  1I76 A;  1MNC A;  3N2U A;  1MMB A;  3I7I A;  3UVC A;  1K7G A;  1UMS A;  3P24 A;  3NX7 A;  1C7K A;  1GKD A;  2DW0 A;  4XCT A;  4L6T A;  2E2D A;  1OM7 A;  2QPJ A;  1CXV A;  4IN9 A;  1JAQ A;  3B92 A;  1G05 A;  1XFY A;  1IAG A;  3LK8 A;  3KEC A;  4FXY P;  3KWV C;  4H30 A;  4GR3 A;  2OVZ A;  1QJJ A;  5I0L A;  1YP1 A;  4I35 A;  1FBL A;  1ZXV A;  1C3I A;  4H49 A;  1IAC A;  1JAN A;  1OS2 A;  3LIR A;  4HMA A;  2OXZ A;  2TCL A;  2OXU A;  1EUB A;  2ERO A;  3K7L A;  5D1S A;  2I47 A;  2Y6C A;  3K7N A;  3F16 A;  1IAB A;  1RM8 A;  3DWB A;  2SRT A;  3LJZ A;  4AUO A;  1PWV A;  4WKI A;  2MLS A;  3L0V A;  5B5P A;  4A7B A;  2X3A A;  2DW1 A;  4GR0 A;  1DTH A;  1PWW A;  4GUY A;  3EDI A;  4GWN A;  1L6J A;  3ZVS A;  1CGE A;  1GE7 A;  3E8R A;  1CQR A;  2CLT A;  3F1A A;  4L63 A;  1R54 A;  4WF6 A;  2OY2 A;  1OM8 A;  4JA1 A;  5L79 A;  1GE5 A;  3B8Z A;  1MMR A;  3LQ0 A;  1GKC A;  3O64 A;  2MZE A;  3B2Z A;  1ZVX A;  2OW2 A;  1H71 P;  1D8M A;  5I2Z A;  3KHI A;  1D5J A;  5H8X A;  4JQG A;  5BOY A;  3L0T A;  1A85 A;  3DNG A;  4XM6 A;  4GF1 A;  3TSK A;  4Q1L A;  1Q3A A;  3ZUK A;  1O0Q A;  3DPE A;  2Z2D A;  3VI1 A;  5D1U A;  1YCM A;  1JIZ A;  1C8T A;  3EDH A;  1JAO A;  2K9C A;  4PKT A;  4WK7 A;  2POJ A;  1I1I P;  3Q2G A;  2JT5 A;  4QKZ A;  1R1H A;  2Y6D A;  2MLR A;  1HFS A;  1GO7 P;  4PKR A;  2O3E A;  1BQO A;  4PKS A;  1B3D A;  1XFW A;  4XBH A;  1SRP A;  4GR8 A;  4ILW D;  3LIL A;  4G0D A;  2L0R A;  4JIJ A;  1ROS A;  1XUD A;  1GXD A;  1J7N A;  3G42 A;  3HY9 A;  4CTH A;  5LAB A;  1BIW A;  3N2V A;  3LMC A;  1HFC A;  1FLS A;  2D1N A;  3DL1 A;  2DW2 A;  1BUD A;  3LGP A;  3LKA A;  1ND1 A;  2MZI A;  2RJP A;  2W12 A;  5L7F A;  3P1V A;  4H2E A;  4IJO A;  4J4M A;  4IUW A;  5BPA A;  4XM7 A;  3WV2 A;  3AYU A;  1B8Y A;  3WV3 A;  2OW1 A;  1Z3J A;  2JSD A;  1OM6 A;  1BQQ M;  1QIB A;  3AIG A;  3BA0 A;  1HTD A;  1SAT A;  3LUM A;  2WO9 A;  1G9K A;  1BUV M;  1MMQ A;  3USN A;  2XS4 A;  1PWQ A;  3LEA A;  1HY7 A;  3F15 A;  4XM8 A;  3LJG A;  2ERP A;  1IAD A;  1JK3 A;  1FM1 A;  3RTT A;  3HYG A;  4WKE A;  1XFZ A;  4H3X A;  3LIK A;  3WV1 A;  3AYK A;  1BSW A;  4G9L A;  1OO9 A;  3Q2H A;  1KUK A;  4DD8 A;  4A3W A;  4AIG A;  1I73 A;  1UMT A;  5I3M A;  1UEA A;  1Y0V A;  3O2X A;  1D8F A;  3HB2 P;  4I03 A;  4R3V A;  1ZXC A;  1EB6 A;  1OS9 A;  1AST A;  5CXA A;  1HV5 A;  1BKC A;  1YOU A;  3HY7 A;  2OXW A;  3LE9 A;  1RMZ A;  2AYK A;  1JH1 A;  4FU4 A;  1KAP P;  1QIC A;  4ON1 A;  2J0T A;  2OY4 A;  1SU3 A;  1ATL A;  5I43 A;  1R1J A;  1IAA A;  4H1Q A;  1QIA A;  1KUG A; 
#chains in the Genus database with same CATH topology
 3SHI A;  4PKU A;  1AYK A;  2X3B A;  2DDF A;  2X3C A;  1JKY A;  2OW0 A;  2D1O A;  3DPF A;  1BKC E;  5B5O A;  3RTS A;  1CGL A;  1JJ9 A;  4FXQ A;  3LQB A;  1A86 A;  4AXQ A;  3CKI A;  2WOA A;  2PJT A;  1XFV A;  3KRY A;  1KBC A;  456C A;  2J83 A;  966C A;  4EFS A;  2WO8 A;  1K7Q A;  4PKV A;  1ZP5 A;  1CIZ A;  1KUI A;  2W0D A;  3HDB A;  2W15 A;  1QJI A;  3TS4 A;  3V96 B;  2V4B A;  1S4B P;  1AF0 A;  3I7G A;  2OZR A;  3EDG A;  1Y93 A;  2E3X A;  3ZXH A;  2W13 A;  1PWU A;  1XAX A;  5JMY A;  1BM6 A;  5I12 A;  3KEK A;  2KRJ A;  1UTZ A;  3HDA P;  1HOV A;  1JIW P;  1BZS A;  1XFU A;  3EWJ A;  4PKW A;  5CUH A;  2A8H A;  2RJQ A;  1MMP A;  1CK7 A;  2N8R A;  1GE6 A;  2OW9 A;  3TVC A;  3ELM A;  1IAE A;  4HX3 A;  1DMT A;  1GO8 P;  3EDZ A;  4GQL A;  1PWP A;  1G12 A;  1YQY A;  5I4O A;  4H76 A;  3EHY A;  1G4K A;  1XFX A;  3LUN A;  2JIH A;  2ERQ A;  1KUH A;  3OHO A;  5D7W A;  1OMJ A;  3TT4 A;  2CKI A;  2HU6 A;  3GBO A;  1R55 A;  3F17 A;  830C A;  4ZR5 A;  1XM5 A;  1CAQ A;  2X7M A;  1TVI A;  1KUF A;  3KEJ A;  4DV8 A;  4H82 A;  2OI0 A;  2AIG P;  5D3C A;  3DTK A;  3G5C A;  1JAP A;  2JNP A;  1QUA A;  3U1R A;  4L19 A;  2FV9 A;  1AKL A;  4FVL A;  3VTG A;  1Y8J A;  1R1I A;  2FV5 A;  4H84 A;  1XUR A;  2O36 A;  2YIG A;  3DSL A;  1XUC A;  4JP4 A;  1SLN A;  1WNI A;  1G49 A;  1D7X A;  4AYK A;  1ZS0 A;  2USN A;  5D2B A;  1USN A;  2DDY A;  2JT6 A;  4DPE A;  4JPA A;  5D1T A;  1BKC I;  1K7I A;  1UTT A;  2XS3 A;  3F18 A;  3OHL A;  2YB9 A;  3HBV P;  1SMP A;  4PKQ A;  4WZV A;  3F19 A;  5BOT A;  3HBU P;  2W14 A;  5CZM A;  2MZH A;  1EAK A;  2OVX A;  3MA2 A;  3KME A;  4DF9 A;  3EHX A;  2K2G A;  1O0T A;  1ZTQ A;  3KMC A;  4GWM A;  1SLM A;  3LJT A;  1CGF A;  1I76 A;  1MNC A;  3N2U A;  1MMB A;  3I7I A;  3UVC A;  1K7G A;  1UMS A;  3P24 A;  3NX7 A;  1C7K A;  1GKD A;  2DW0 A;  4XCT A;  4L6T A;  2E2D A;  1OM7 A;  2QPJ A;  1CXV A;  4IN9 A;  1JAQ A;  3B92 A;  1G05 A;  1XFY A;  1IAG A;  1OZ9 A;  3LK8 A;  3KEC A;  4FXY P;  3KWV C;  4H30 A;  4GR3 A;  2OVZ A;  1QJJ A;  5I0L A;  1YP1 A;  4I35 A;  1FBL A;  1ZXV A;  1C3I A;  4H49 A;  1IAC A;  1JAN A;  1OS2 A;  3LIR A;  4HMA A;  2OXZ A;  2TCL A;  2OXU A;  1EUB A;  2ERO A;  3K7L A;  5D1S A;  2I47 A;  2Y6C A;  3K7N A;  3F16 A;  1IAB A;  1RM8 A;  3DWB A;  2SRT A;  3LJZ A;  4AUO A;  1PWV A;  4WKI A;  2MLS A;  3L0V A;  5B5P A;  4A7B A;  2X3A A;  2DW1 A;  4GR0 A;  1DTH A;  1PWW A;  4GUY A;  3EDI A;  4GWN A;  1L6J A;  3ZVS A;  1CGE A;  1GE7 A;  3E8R A;  1CQR A;  2CLT A;  3F1A A;  4L63 A;  1R54 A;  4WF6 A;  2OY2 A;  1OM8 A;  4JA1 A;  5L79 A;  1GE5 A;  3B8Z A;  1MMR A;  3LQ0 A;  1GKC A;  3O64 A;  2MZE A;  3B2Z A;  1ZVX A;  2OW2 A;  1H71 P;  1D8M A;  5I2Z A;  3KHI A;  1D5J A;  5H8X A;  4JQG A;  5BOY A;  3L0T A;  1A85 A;  3DNG A;  4XM6 A;  4GF1 A;  3TSK A;  4Q1L A;  1Q3A A;  3ZUK A;  1O0Q A;  3DPE A;  2Z2D A;  3VI1 A;  2YUF A;  5D1U A;  1YCM A;  1JIZ A;  1C8T A;  3EDH A;  1JAO A;  2K9C A;  3DTI A;  4PKT A;  4WK7 A;  2POJ A;  1I1I P;  3Q2G A;  2JT5 A;  4QKZ A;  1R1H A;  2Y6D A;  2MLR A;  1HFS A;  1GO7 P;  4PKR A;  2O3E A;  1BQO A;  4PKS A;  4L7A A;  1B3D A;  1XFW A;  4XBH A;  1SRP A;  4GR8 A;  4ILW D;  3LIL A;  4G0D A;  2L0R A;  4JIJ A;  1ROS A;  1XUD A;  1GXD A;  1J7N A;  3G42 A;  3HY9 A;  4CTH A;  5LAB A;  1BIW A;  3N2V A;  3LMC A;  1HFC A;  1FLS A;  2D1N A;  3DL1 A;  2DW2 A;  1BUD A;  3LGP A;  3LKA A;  1ND1 A;  2MZI A;  2RJP A;  2W12 A;  5L7F A;  3P1V A;  4H2E A;  4IJO A;  4J4M A;  4IUW A;  5BPA A;  4XM7 A;  3WV2 A;  3AYU A;  1B8Y A;  3WV3 A;  2OW1 A;  1Z3J A;  2JSD A;  1OM6 A;  1BQQ M;  1QIB A;  3AIG A;  3BA0 A;  1HTD A;  1SAT A;  3LUM A;  2WO9 A;  1G9K A;  3DTE A;  1BUV M;  1MMQ A;  3USN A;  2XS4 A;  1PWQ A;  3LEA A;  1HY7 A;  3F15 A;  4XM8 A;  3LJG A;  2ERP A;  1IAD A;  1JK3 A;  1FM1 A;  3RTT A;  3HYG A;  4WKE A;  1XFZ A;  4H3X A;  3LIK A;  3WV1 A;  3AYK A;  1BSW A;  4G9L A;  1OO9 A;  3Q2H A;  1KUK A;  4DD8 A;  4A3W A;  4AIG A;  1I73 A;  1UMT A;  5I3M A;  1UEA A;  1Y0V A;  3O2X A;  1D8F A;  3HB2 P;  4I03 A;  4R3V A;  1ZXC A;  1EB6 A;  1OS9 A;  1AST A;  5CXA A;  1HV5 A;  1BKC A;  1YOU A;  3HY7 A;  2OXW A;  3LE9 A;  1RMZ A;  2AYK A;  1JH1 A;  4FU4 A;  1KAP P;  1QIC A;  4ON1 A;  2J0T A;  2OY4 A;  1SU3 A;  1ATL A;  5I43 A;  1R1J A;  1IAA A;  4H1Q A;  1QIA A;  1KUG A; 
#chains in the Genus database with same CATH homology
 3SHI A;  4PKU A;  1AYK A;  2X3B A;  2DDF A;  2X3C A;  1JKY A;  2OW0 A;  2D1O A;  3DPF A;  1BKC E;  5B5O A;  3RTS A;  1CGL A;  1JJ9 A;  4FXQ A;  3LQB A;  1A86 A;  4AXQ A;  3CKI A;  2WOA A;  2PJT A;  1XFV A;  3KRY A;  1KBC A;  456C A;  2J83 A;  966C A;  4EFS A;  2WO8 A;  1K7Q A;  4PKV A;  1ZP5 A;  1CIZ A;  1KUI A;  2W0D A;  3HDB A;  2W15 A;  1QJI A;  3TS4 A;  3V96 B;  2V4B A;  1S4B P;  1AF0 A;  3I7G A;  2OZR A;  3EDG A;  1Y93 A;  2E3X A;  3ZXH A;  2W13 A;  1PWU A;  5JMY A;  1BM6 A;  5I12 A;  3KEK A;  2KRJ A;  1UTZ A;  3HDA P;  1HOV A;  1JIW P;  1BZS A;  1XFU A;  3EWJ A;  4PKW A;  5CUH A;  2A8H A;  2RJQ A;  1MMP A;  1CK7 A;  2N8R A;  1GE6 A;  2OW9 A;  3TVC A;  3ELM A;  1IAE A;  4HX3 A;  1DMT A;  1GO8 P;  3EDZ A;  4GQL A;  1PWP A;  1G12 A;  1YQY A;  5I4O A;  4H76 A;  3EHY A;  1G4K A;  1XFX A;  3LUN A;  2JIH A;  2ERQ A;  1KUH A;  3OHO A;  5D7W A;  1OMJ A;  3TT4 A;  2CKI A;  2HU6 A;  3GBO A;  1R55 A;  3F17 A;  830C A;  4ZR5 A;  2X7M A;  1CAQ A;  1KUF A;  3KEJ A;  4DV8 A;  4H82 A;  2OI0 A;  2AIG P;  5D3C A;  3DTK A;  3G5C A;  1JAP A;  2JNP A;  1QUA A;  3U1R A;  4L19 A;  2FV9 A;  1AKL A;  4FVL A;  3VTG A;  1Y8J A;  1R1I A;  2FV5 A;  4H84 A;  1XUR A;  2O36 A;  2YIG A;  3DSL A;  1XUC A;  4JP4 A;  1SLN A;  1WNI A;  1G49 A;  1D7X A;  4AYK A;  1ZS0 A;  2USN A;  5D2B A;  1USN A;  2DDY A;  2JT6 A;  4DPE A;  4JPA A;  5D1T A;  1BKC I;  1K7I A;  1UTT A;  2XS3 A;  3F18 A;  3OHL A;  2YB9 A;  3HBV P;  1SMP A;  4PKQ A;  4WZV A;  3F19 A;  5BOT A;  3HBU P;  2W14 A;  5CZM A;  2MZH A;  1EAK A;  2OVX A;  3MA2 A;  3KME A;  4DF9 A;  3EHX A;  2K2G A;  1O0T A;  1ZTQ A;  3KMC A;  4GWM A;  1SLM A;  3LJT A;  1CGF A;  1I76 A;  1MNC A;  3N2U A;  1MMB A;  3I7I A;  3UVC A;  1K7G A;  1UMS A;  3P24 A;  3NX7 A;  1C7K A;  1GKD A;  2DW0 A;  4XCT A;  4L6T A;  2E2D A;  1OM7 A;  2QPJ A;  1CXV A;  4IN9 A;  1JAQ A;  3B92 A;  1G05 A;  1XFY A;  1IAG A;  3LK8 A;  3KEC A;  4FXY P;  3KWV C;  4H30 A;  4GR3 A;  2OVZ A;  1QJJ A;  5I0L A;  1YP1 A;  4I35 A;  1FBL A;  1ZXV A;  1C3I A;  4H49 A;  1IAC A;  1JAN A;  1OS2 A;  3LIR A;  4HMA A;  2OXZ A;  2TCL A;  2OXU A;  1EUB A;  2ERO A;  3K7L A;  5D1S A;  2I47 A;  2Y6C A;  3K7N A;  3F16 A;  1IAB A;  1RM8 A;  3DWB A;  2SRT A;  3LJZ A;  4AUO A;  1PWV A;  4WKI A;  2MLS A;  3L0V A;  5B5P A;  4A7B A;  2X3A A;  2DW1 A;  4GR0 A;  1DTH A;  1PWW A;  4GUY A;  3EDI A;  4GWN A;  1L6J A;  3ZVS A;  1CGE A;  1GE7 A;  3E8R A;  1CQR A;  2CLT A;  3F1A A;  4L63 A;  1R54 A;  4WF6 A;  2OY2 A;  1OM8 A;  4JA1 A;  5L79 A;  1GE5 A;  3B8Z A;  1MMR A;  3LQ0 A;  1GKC A;  3O64 A;  2MZE A;  3B2Z A;  1ZVX A;  2OW2 A;  1H71 P;  1D8M A;  5I2Z A;  3KHI A;  1D5J A;  5H8X A;  4JQG A;  5BOY A;  3L0T A;  1A85 A;  3DNG A;  4XM6 A;  4GF1 A;  3TSK A;  4Q1L A;  1Q3A A;  3ZUK A;  1O0Q A;  3DPE A;  2Z2D A;  3VI1 A;  2YUF A;  5D1U A;  1YCM A;  1JIZ A;  1C8T A;  3EDH A;  1JAO A;  2K9C A;  3DTI A;  4PKT A;  4WK7 A;  2POJ A;  1I1I P;  3Q2G A;  2JT5 A;  4QKZ A;  1R1H A;  2Y6D A;  2MLR A;  1HFS A;  1GO7 P;  4PKR A;  2O3E A;  1BQO A;  4PKS A;  4L7A A;  1B3D A;  1XFW A;  4XBH A;  1SRP A;  4GR8 A;  4ILW D;  3LIL A;  4G0D A;  2L0R A;  4JIJ A;  1ROS A;  1XUD A;  1GXD A;  1J7N A;  3G42 A;  3HY9 A;  4CTH A;  5LAB A;  1BIW A;  3N2V A;  3LMC A;  1HFC A;  1FLS A;  2D1N A;  3DL1 A;  2DW2 A;  1BUD A;  3LGP A;  3LKA A;  1ND1 A;  2MZI A;  2RJP A;  2W12 A;  5L7F A;  3P1V A;  4H2E A;  4IJO A;  4J4M A;  4IUW A;  5BPA A;  4XM7 A;  3WV2 A;  3AYU A;  1B8Y A;  3WV3 A;  2OW1 A;  1Z3J A;  2JSD A;  1OM6 A;  1BQQ M;  1QIB A;  3AIG A;  3BA0 A;  1HTD A;  1SAT A;  3LUM A;  2WO9 A;  1G9K A;  3DTE A;  1BUV M;  1MMQ A;  3USN A;  2XS4 A;  1PWQ A;  3LEA A;  1HY7 A;  3F15 A;  4XM8 A;  3LJG A;  2ERP A;  1IAD A;  1JK3 A;  1FM1 A;  3RTT A;  3HYG A;  4WKE A;  1XFZ A;  4H3X A;  3LIK A;  3WV1 A;  3AYK A;  1BSW A;  4G9L A;  1OO9 A;  3Q2H A;  1KUK A;  4DD8 A;  4A3W A;  4AIG A;  1I73 A;  1UMT A;  5I3M A;  1UEA A;  1Y0V A;  3O2X A;  1D8F A;  3HB2 P;  4I03 A;  4R3V A;  1ZXC A;  1EB6 A;  1OS9 A;  1AST A;  5CXA A;  1HV5 A;  1BKC A;  1YOU A;  3HY7 A;  2OXW A;  3LE9 A;  1RMZ A;  2AYK A;  1JH1 A;  4FU4 A;  1KAP P;  1QIC A;  4ON1 A;  2J0T A;  2OY4 A;  1SU3 A;  1ATL A;  5I43 A;  1R1J A;  1IAA A;  4H1Q A;  1QIA A;  1KUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...