2OXUA

Uninhibited form of human mmp-12
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oxuA00
1IABA 1QUAA 1GE5A 3KHIA 3LMCA 3KMEA 1AKLA 3WV1A 2OXUA 1JIWP 3TSKA 3DPEA 1BKCA 1QJJA 3F1AA 4GWMA 3LUNA 1SLNA 1MMRA 1J7NA 2DDFA 1YQYA 2E3XA 1CQRA 1SATA 1QIAA 1BQQM 3F15A 1XFYA 5D1UA 3ZUKA 1QJIA 1XFVA 3LGPA 1IAGA 3TVCA 5LABA 5I12A 3HY9A 5BOTA 4AIGA 3LIRA 1HTDA 3LILA 4IN9A 3N2VA 1BZSA 1GKCA 3HY7A 3F17A 3EDZA 3OHOA 2QPJA 1IADA 2WO9A 4H2EA 2USNA 1O0QA 2W13A 3AIGA 5D2BA 1UMTA 4XM6A 2XS3A 2A8HA 1CGFA 2DDYA 3KRYA 1K7IA 1SU3A 3F16A 1FM1A 1A86A 1R1JA 1SLMA 2OW2A 4H1QA 3E8RA 1UTZA 3HDBA 4PKUA 3LK8A 2YB9A 2J83A 2CLTA 4EFSA 1ZVXA 1H71P 4H82A 1R1IA 1L6JA 3B92A 4Q1LA 4H3XA 5D7WA 3G42A 1GKDA 2MZHA 830CA 2AYKA 3AYUA 3B8ZA 2FV9A 2WOAA 3TT4A 1D8MA 3EHXA 2SRTA 1PWPA 2JIHA 2I47A 3DWBA 1B8YA 3HBUP 1G12A 1G4KA 3LUMA 1K7QA 1ZTQA 2WO8A 2OVXA 4FXQA 1BIWA 3DPFA 5I0LA 2RJPA 5B5OA 4WF6A 1EAKA 3WV2A 3EWJA 2OY4A 1JAOA 2W0DA 1HFSA 4WKEA 1XFWA 2W12A 1IAAA 5CZMA 1FLSA 1PWVA 3RTSA 1B3DA 4G0DA 4L19A 1ATLA 3ELMA 1C3IA 5B5PA 1G9KA 5D3CA 3WV3A 1HFCA 1MMBA 1USNA 1ROSA 2X7MA 3N2UA 2V4BA 1YOUA 1IAEA 4HMAA 1AYKA 1HOVA 2K9CA 1OMJA 1Y0VA 3NX7A 4H84A 4J4MA 2Z2DA 1QIBA 3VI1A 1BQOA 4A7BA 3F18A 4ON1A 4DV8A 2O36A 3CKIA 1KUKA 1Y93A 1HY7A 4XM8A 4GQLA 3DSLA 4GF1A 1KUIA 4GUYA 3LEAA 1JANA 3LIKA 3LJGA 5D1SA 2D1OA 4IJOA 4GWNA 4HX3A 2OXZA 3I7IA 1JH1A 1XUDA 3HYGA 1JAQA 1OO9A 2CKIA 1CK7A 966CA 2MLSA 3LKAA 1WNIA 1ZP5A 3ZVSA 4PKVA 1AF0A 5BOYA 4XBHA 4FU4A 2X3AA 3LQBA 4L63A 5D1TA 4WK7A 1C8TA 1QICA 1KBCA 1GO7P 3L0VA 5CUHA 2AIGP 2MZIA 4AXQA 4PKQA 4ZR5A 1I1IP 1YP1A 4QKZA 1JKYA 4JP4A 1UTTA 1Q3AA 2OXWA 1CAQA 3EDHA 4H76A 3K7LA 2Y6DA 3GBOA 2OZRA 1Y8JA 5H8XA 2Y6CA 1GXDA 3LE9A 1XURA 2OY2A 1HV5A 1BUDA 2W15A 2DW0A 3VTGA 1ZS0A 1KUGA 3O64A 2POJA 4XM7A 1K7GA 1MNCA 1R1HA 4H30A 1UEAA 1OM6A 4L6TA 1R55A 2X3CA 3LQ0A 1ZXCA 3P1VA 4PKSA 1OS2A 2JNPA 1Z3JA 4JA1A 2OI0A 3HBVP 4IUWA 3TS4A 2JT5A 2OW1A 3DNGA 1XFXA 1CXVA 1PWQA 1GO8P 4R3VA 1R54A 5CXAA 5I43A 1JJ9A 1CGEA 1OM8A 1JK3A 3AYKA 2JT6A 4I03A 1XFUA 1ND1A 1BSWA 5I4OA 5JMYA 4G9LA 3O2XA 1XFZA 1C7KA 4GR8A 3Q2GA 5L79A 2L0RA 1MMQA 4I35A 2J0TA 3LJTA 1YCMA 3Q2HA 1BUVM 1BKCE 3KWVC 4WKIA 3I7GA 1GE6A 3L0TA 1KUFA 4JQGA 1IACA 2PJTA 1S4BP 4AUOA 1RMZA 2MZEA 2RJQA 1OM7A 3KMCA 1G05A 4CTHA 4DF9A 5BPAA 3F19A 1KAPP 1FBLA 3BA0A 1SRPA 3V96B 3G5CA 1BKCI 3HB2P 3EDGA 4DPEA 1PWWA 1O0TA 2KRJA 2JSDA 1PWUA 4PKTA 1D5JA 1OS9A 1ASTA 1JAPA 4GR3A 1D7XA 1KUHA 1ZXVA 3KEKA 4FXYP 4XCTA 2HU6A 3OHLA 4PKRA 3HDAP 1JIZA 2OW9A 2O3EA 2TCLA 1CIZA 3EDIA 4GR0A 1A85A 1MMPA 1XUCA 1GE7A 1I73A 4AYKA 2DW1A 5L7FA 5I2ZA 3ZXHA 2OW0A 1UMSA 3EHYA 3RTTA 3U1RA 3K7NA 1I76A 4JPAA 1BM6A 3USNA 3MA2A 2YIGA 3KEJA 2D1NA 2E2DA 2OVZA 1D8FA 3B2ZA 4ILWD 4WZVA 1RM8A 1G49A 2X3BA 2ERPA 4H49A 1CGLA 2W14A 4PKWA 2N8RA 1DMTA 2XS4A 1SMPA 2MLRA 2EROA 1EB6A 2ERQA 3UVCA 2FV5A 1DTHA 3LJZA 1EUBA 4FVLA 3SHIA 4JIJA 3P24A 2DW2A 5I3MA 2K2GA 3DL1A 456CA 4DD8A 3KECA 4A3WA
chains in the Genus database with same CATH superfamily
1IABA 1QUAA 1GE5A 3KHIA 3KMEA 3LMCA 1AKLA 3WV1A 2OXUA 1JIWP 3TSKA 3DPEA 1BKCA 1QJJA 3F1AA 4GWMA 3LUNA 1SLNA 1MMRA 3DTIA 1J7NA 2DDFA 1YQYA 2E3XA 1CQRA 1SATA 1QIAA 1BQQM 3F15A 1XFYA 5D1UA 3ZUKA 1QJIA 1XFVA 3LGPA 1IAGA 3TVCA 5LABA 5I12A 3HY9A 5BOTA 4AIGA 3LIRA 1HTDA 3LILA 4IN9A 3N2VA 1BZSA 1GKCA 3HY7A 3F17A 3EDZA 3OHOA 2QPJA 1IADA 2WO9A 4H2EA 2USNA 1O0QA 2W13A 3AIGA 5D2BA 1UMTA 4XM6A 2XS3A 2A8HA 1CGFA 2DDYA 3KRYA 1K7IA 1SU3A 3F16A 1FM1A 1A86A 1R1JA 1SLMA 2OW2A 4H1QA 3E8RA 1UTZA 3HDBA 4PKUA 3LK8A 2YB9A 2J83A 2CLTA 4EFSA 1ZVXA 1H71P 4H82A 1R1IA 1L6JA 3B92A 4Q1LA 4H3XA 5D7WA 3G42A 1GKDA 2MZHA 830CA 2AYKA 1XM5A 3AYUA 3B8ZA 2FV9A 2WOAA 3TT4A 1D8MA 3EHXA 2SRTA 1PWPA 2JIHA 2I47A 3DWBA 1B8YA 3HBUP 1G12A 1G4KA 3LUMA 1K7QA 1ZTQA 2WO8A 2OVXA 4FXQA 1BIWA 3DPFA 5I0LA 2RJPA 5B5OA 4WF6A 1EAKA 3WV2A 3EWJA 2OY4A 1JAOA 2W0DA 1HFSA 4WKEA 1XFWA 2W12A 1IAAA 5CZMA 1FLSA 1PWVA 3RTSA 1B3DA 4G0DA 4L19A 1ATLA 3ELMA 1C3IA 5B5PA 1G9KA 5D3CA 3WV3A 1HFCA 1MMBA 1USNA 1ROSA 2X7MA 3N2UA 2V4BA 1YOUA 1IAEA 4HMAA 1AYKA 1HOVA 1TVIA 2K9CA 1OMJA 1Y0VA 3NX7A 4H84A 4J4MA 2Z2DA 1QIBA 3VI1A 1BQOA 4A7BA 3F18A 4ON1A 4DV8A 2O36A 3CKIA 1KUKA 1Y93A 1HY7A 4XM8A 4GQLA 3DSLA 4GF1A 1KUIA 4GUYA 3LEAA 1JANA 3LIKA 3LJGA 5D1SA 2D1OA 4IJOA 4GWNA 4HX3A 2OXZA 3I7IA 1JH1A 1XUDA 3HYGA 1JAQA 1OO9A 2CKIA 1CK7A 966CA 2MLSA 3LKAA 1WNIA 1ZP5A 3ZVSA 4PKVA 1AF0A 5BOYA 4XBHA 4FU4A 2X3AA 3LQBA 4L63A 5D1TA 4WK7A 1C8TA 1QICA 1KBCA 1GO7P 3L0VA 5CUHA 2AIGP 2MZIA 4AXQA 4PKQA 4ZR5A 1I1IP 1YP1A 4QKZA 1JKYA 4JP4A 1UTTA 1Q3AA 2OXWA 1CAQA 3EDHA 4H76A 3K7LA 2Y6DA 3GBOA 2OZRA 1Y8JA 1XAXA 5H8XA 2Y6CA 1GXDA 3DTKA 3LE9A 1XURA 2OY2A 1HV5A 1BUDA 2W15A 2DW0A 3VTGA 1ZS0A 1KUGA 3O64A 2POJA 4XM7A 1K7GA 1MNCA 1R1HA 4H30A 1UEAA 1OM6A 4L6TA 1R55A 2X3CA 3LQ0A 1ZXCA 3P1VA 4PKSA 1OS2A 2JNPA 1Z3JA 4JA1A 2OI0A 3HBVP 4IUWA 3TS4A 2JT5A 2OW1A 3DNGA 1XFXA 1CXVA 1PWQA 1GO8P 4R3VA 1R54A 5CXAA 5I43A 1JJ9A 1CGEA 3DTEA 1OM8A 1JK3A 3AYKA 2JT6A 4I03A 1XFUA 1ND1A 1BSWA 5I4OA 5JMYA 4G9LA 1OZ9A 3O2XA 1XFZA 1C7KA 4GR8A 3Q2GA 5L79A 2L0RA 1MMQA 4I35A 2J0TA 3LJTA 1YCMA 3Q2HA 1BUVM 1BKCE 3KWVC 4WKIA 3I7GA 1GE6A 3L0TA 1KUFA 4JQGA 1IACA 2PJTA 1S4BP 4AUOA 1RMZA 2MZEA 2RJQA 1OM7A 3KMCA 1G05A 4CTHA 4DF9A 5BPAA 3F19A 1KAPP 1FBLA 3BA0A 1SRPA 3V96B 3G5CA 2YUFA 1BKCI 3HB2P 3EDGA 4DPEA 1PWWA 1O0TA 2KRJA 2JSDA 1PWUA 4PKTA 1D5JA 1OS9A 1ASTA 1JAPA 4GR3A 1D7XA 1KUHA 1ZXVA 3KEKA 4FXYP 4XCTA 2HU6A 3OHLA 4PKRA 3HDAP 1JIZA 2OW9A 2O3EA 2TCLA 1CIZA 3EDIA 4GR0A 1A85A 1MMPA 1XUCA 1GE7A 1I73A 4AYKA 2DW1A 5L7FA 5I2ZA 3ZXHA 2OW0A 1UMSA 3EHYA 3RTTA 3U1RA 3K7NA 1I76A 4JPAA 1BM6A 3USNA 3MA2A 2YIGA 3KEJA 2D1NA 2E2DA 2OVZA 1D8FA 3B2ZA 4ILWD 4WZVA 1RM8A 1G49A 2X3BA 2ERPA 4H49A 1CGLA 2W14A 4PKWA 2N8RA 1DMTA 2XS4A 1SMPA 2MLRA 2EROA 1EB6A 2ERQA 3UVCA 2FV5A 1DTHA 3LJZA 1EUBA 4FVLA 3SHIA 4JIJA 3P24A 2DW2A 5I3MA 2K2GA 3DL1A 456CA 4DD8A 3KECA 4L7AA 4A3WA
chains in the Genus database with same CATH topology
1IABA 1QUAA 1GE5A 3KHIA 3KMEA 3LMCA 1AKLA 3WV1A 2OXUA 1JIWP 3TSKA 3DPEA 1BKCA 1QJJA 3F1AA 4GWMA 3LUNA 1SLNA 1MMRA 3DTIA 1J7NA 2DDFA 1YQYA 2E3XA 1CQRA 1SATA 1QIAA 1BQQM 3F15A 1XFYA 5D1UA 3ZUKA 1QJIA 1XFVA 3LGPA 1IAGA 3TVCA 5LABA 5I12A 3HY9A 5BOTA 4AIGA 3LIRA 1HTDA 3LILA 4IN9A 3N2VA 1BZSA 1GKCA 3HY7A 3F17A 3EDZA 3OHOA 2QPJA 1IADA 2WO9A 4H2EA 2USNA 1O0QA 2W13A 3AIGA 5D2BA 1UMTA 4XM6A 2XS3A 2A8HA 1CGFA 2DDYA 3KRYA 1K7IA 1SU3A 3F16A 1FM1A 1A86A 1R1JA 1SLMA 2OW2A 4H1QA 3E8RA 1UTZA 3HDBA 4PKUA 3LK8A 2YB9A 2J83A 2CLTA 4EFSA 1ZVXA 1H71P 4H82A 1R1IA 1L6JA 3B92A 4Q1LA 4H3XA 5D7WA 3G42A 1GKDA 2MZHA 830CA 2AYKA 3AYUA 3B8ZA 2FV9A 2WOAA 3TT4A 1D8MA 3EHXA 2SRTA 1PWPA 2JIHA 2I47A 3DWBA 1B8YA 3HBUP 1G12A 1G4KA 3LUMA 1K7QA 1ZTQA 2WO8A 2OVXA 4FXQA 1BIWA 3DPFA 5I0LA 2RJPA 5B5OA 4WF6A 1EAKA 3WV2A 3EWJA 2OY4A 1JAOA 2W0DA 1HFSA 4WKEA 1XFWA 2W12A 1IAAA 5CZMA 1FLSA 1PWVA 3RTSA 1B3DA 4G0DA 4L19A 1ATLA 3ELMA 1C3IA 5B5PA 1G9KA 5D3CA 3WV3A 1HFCA 1MMBA 1USNA 1ROSA 2X7MA 3N2UA 2V4BA 1YOUA 1IAEA 4HMAA 1AYKA 1HOVA 2K9CA 1OMJA 1Y0VA 3NX7A 4H84A 4J4MA 2Z2DA 1QIBA 3VI1A 1BQOA 4A7BA 3F18A 4ON1A 4DV8A 2O36A 3CKIA 1KUKA 1Y93A 1HY7A 4XM8A 4GQLA 3DSLA 4GF1A 1KUIA 4GUYA 3LEAA 1JANA 3LIKA 3LJGA 5D1SA 2D1OA 4IJOA 4GWNA 4HX3A 2OXZA 3I7IA 1JH1A 1XUDA 3HYGA 1JAQA 1OO9A 2CKIA 1CK7A 966CA 2MLSA 3LKAA 1WNIA 1ZP5A 3ZVSA 4PKVA 1AF0A 5BOYA 4XBHA 4FU4A 2X3AA 3LQBA 4L63A 5D1TA 4WK7A 1C8TA 1QICA 1KBCA 1GO7P 3L0VA 5CUHA 2AIGP 2MZIA 4AXQA 4PKQA 4ZR5A 1I1IP 1YP1A 4QKZA 1JKYA 4JP4A 1UTTA 1Q3AA 2OXWA 1CAQA 3EDHA 4H76A 3K7LA 2Y6DA 3GBOA 2OZRA 1Y8JA 5H8XA 2Y6CA 1GXDA 3DTKA 3LE9A 1XURA 2OY2A 1HV5A 1BUDA 2W15A 2DW0A 3VTGA 1ZS0A 1KUGA 3O64A 2POJA 4XM7A 1K7GA 1MNCA 1R1HA 4H30A 1UEAA 1OM6A 4L6TA 1R55A 2X3CA 3LQ0A 1ZXCA 3P1VA 4PKSA 1OS2A 2JNPA 1Z3JA 4JA1A 2OI0A 3HBVP 4IUWA 3TS4A 2JT5A 2OW1A 3DNGA 1XFXA 1CXVA 1PWQA 1GO8P 4R3VA 1R54A 5CXAA 5I43A 1JJ9A 1CGEA 3DTEA 1OM8A 1JK3A 3AYKA 2JT6A 4I03A 1XFUA 1ND1A 1BSWA 5I4OA 5JMYA 4G9LA 3O2XA 1XFZA 1C7KA 4GR8A 3Q2GA 5L79A 2L0RA 1MMQA 4I35A 2J0TA 3LJTA 1YCMA 3Q2HA 1BUVM 1BKCE 3KWVC 4WKIA 3I7GA 1GE6A 3L0TA 1KUFA 4JQGA 1IACA 2PJTA 1S4BP 4AUOA 1RMZA 2MZEA 2RJQA 1OM7A 3KMCA 1G05A 4CTHA 4DF9A 5BPAA 3F19A 1KAPP 1FBLA 3BA0A 1SRPA 3V96B 3G5CA 2YUFA 1BKCI 3HB2P 3EDGA 4DPEA 1PWWA 1O0TA 2KRJA 2JSDA 1PWUA 4PKTA 1D5JA 1OS9A 1ASTA 1JAPA 4GR3A 1D7XA 1KUHA 1ZXVA 3KEKA 4FXYP 4XCTA 2HU6A 3OHLA 4PKRA 3HDAP 1JIZA 2OW9A 2O3EA 2TCLA 1CIZA 3EDIA 4GR0A 1A85A 1MMPA 1XUCA 1GE7A 1I73A 4AYKA 2DW1A 5L7FA 5I2ZA 3ZXHA 2OW0A 1UMSA 3EHYA 3RTTA 3U1RA 3K7NA 1I76A 4JPAA 1BM6A 3USNA 3MA2A 2YIGA 3KEJA 2D1NA 2E2DA 2OVZA 1D8FA 3B2ZA 4ILWD 4WZVA 1RM8A 1G49A 2X3BA 2ERPA 4H49A 1CGLA 2W14A 4PKWA 2N8RA 1DMTA 2XS4A 1SMPA 2MLRA 2EROA 1EB6A 2ERQA 3UVCA 2FV5A 1DTHA 3LJZA 1EUBA 4FVLA 3SHIA 4JIJA 3P24A 2DW2A 5I3MA 2K2GA 3DL1A 456CA 4DD8A 3KECA 4L7AA 4A3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAB A;  1QUA A;  1GE5 A;  3KHI A;  3LMC A;  3KME A;  1AKL A;  3WV1 A;  2OXU A;  1JIW P;  3TSK A;  3DPE A;  1BKC A;  1QJJ A;  3F1A A;  4GWM A;  3LUN A;  1SLN A;  1MMR A;  1J7N A;  2DDF A;  1YQY A;  2E3X A;  1CQR A;  1SAT A;  1QIA A;  1BQQ M;  3F15 A;  1XFY A;  5D1U A;  3ZUK A;  1QJI A;  1XFV A;  3LGP A;  1IAG A;  3TVC A;  5LAB A;  5I12 A;  3HY9 A;  5BOT A;  4AIG A;  3LIR A;  1HTD A;  3LIL A;  4IN9 A;  3N2V A;  1BZS A;  1GKC A;  3HY7 A;  3F17 A;  3EDZ A;  3OHO A;  2QPJ A;  1IAD A;  2WO9 A;  4H2E A;  2USN A;  1O0Q A;  2W13 A;  3AIG A;  5D2B A;  1UMT A;  4XM6 A;  2XS3 A;  2A8H A;  1CGF A;  2DDY A;  3KRY A;  1K7I A;  1SU3 A;  3F16 A;  1FM1 A;  1A86 A;  1R1J A;  1SLM A;  2OW2 A;  4H1Q A;  3E8R A;  1UTZ A;  3HDB A;  4PKU A;  3LK8 A;  2YB9 A;  2J83 A;  2CLT A;  4EFS A;  1ZVX A;  1H71 P;  4H82 A;  1R1I A;  1L6J A;  3B92 A;  4Q1L A;  4H3X A;  5D7W A;  3G42 A;  1GKD A;  2MZH A;  830C A;  2AYK A;  3AYU A;  3B8Z A;  2FV9 A;  2WOA A;  3TT4 A;  1D8M A;  3EHX A;  2SRT A;  1PWP A;  2JIH A;  2I47 A;  3DWB A;  1B8Y A;  3HBU P;  1G12 A;  1G4K A;  3LUM A;  1K7Q A;  1ZTQ A;  2WO8 A;  2OVX A;  4FXQ A;  1BIW A;  3DPF A;  5I0L A;  2RJP A;  5B5O A;  4WF6 A;  1EAK A;  3WV2 A;  3EWJ A;  2OY4 A;  1JAO A;  2W0D A;  1HFS A;  4WKE A;  1XFW A;  2W12 A;  1IAA A;  5CZM A;  1FLS A;  1PWV A;  3RTS A;  1B3D A;  4G0D A;  4L19 A;  1ATL A;  3ELM A;  1C3I A;  5B5P A;  1G9K A;  5D3C A;  3WV3 A;  1HFC A;  1MMB A;  1USN A;  1ROS A;  2X7M A;  3N2U A;  2V4B A;  1YOU A;  1IAE A;  4HMA A;  1AYK A;  1HOV A;  2K9C A;  1OMJ A;  1Y0V A;  3NX7 A;  4H84 A;  4J4M A;  2Z2D A;  1QIB A;  3VI1 A;  1BQO A;  4A7B A;  3F18 A;  4ON1 A;  4DV8 A;  2O36 A;  3CKI A;  1KUK A;  1Y93 A;  1HY7 A;  4XM8 A;  4GQL A;  3DSL A;  4GF1 A;  1KUI A;  4GUY A;  3LEA A;  1JAN A;  3LIK A;  3LJG A;  5D1S A;  2D1O A;  4IJO A;  4GWN A;  4HX3 A;  2OXZ A;  3I7I A;  1JH1 A;  1XUD A;  3HYG A;  1JAQ A;  1OO9 A;  2CKI A;  1CK7 A;  966C A;  2MLS A;  3LKA A;  1WNI A;  1ZP5 A;  3ZVS A;  4PKV A;  1AF0 A;  5BOY A;  4XBH A;  4FU4 A;  2X3A A;  3LQB A;  4L63 A;  5D1T A;  4WK7 A;  1C8T A;  1QIC A;  1KBC A;  1GO7 P;  3L0V A;  5CUH A;  2AIG P;  2MZI A;  4AXQ A;  4PKQ A;  4ZR5 A;  1I1I P;  1YP1 A;  4QKZ A;  1JKY A;  4JP4 A;  1UTT A;  1Q3A A;  2OXW A;  1CAQ A;  3EDH A;  4H76 A;  3K7L A;  2Y6D A;  3GBO A;  2OZR A;  1Y8J A;  5H8X A;  2Y6C A;  1GXD A;  3LE9 A;  1XUR A;  2OY2 A;  1HV5 A;  1BUD A;  2W15 A;  2DW0 A;  3VTG A;  1ZS0 A;  1KUG A;  3O64 A;  2POJ A;  4XM7 A;  1K7G A;  1MNC A;  1R1H A;  4H30 A;  1UEA A;  1OM6 A;  4L6T A;  1R55 A;  2X3C A;  3LQ0 A;  1ZXC A;  3P1V A;  4PKS A;  1OS2 A;  2JNP A;  1Z3J A;  4JA1 A;  2OI0 A;  3HBV P;  4IUW A;  3TS4 A;  2JT5 A;  2OW1 A;  3DNG A;  1XFX A;  1CXV A;  1PWQ A;  1GO8 P;  4R3V A;  1R54 A;  5CXA A;  5I43 A;  1JJ9 A;  1CGE A;  1OM8 A;  1JK3 A;  3AYK A;  2JT6 A;  4I03 A;  1XFU A;  1ND1 A;  1BSW A;  5I4O A;  5JMY A;  4G9L A;  3O2X A;  1XFZ A;  1C7K A;  4GR8 A;  3Q2G A;  5L79 A;  2L0R A;  1MMQ A;  4I35 A;  2J0T A;  3LJT A;  1YCM A;  3Q2H A;  1BUV M;  1BKC E;  3KWV C;  4WKI A;  3I7G A;  1GE6 A;  3L0T A;  1KUF A;  4JQG A;  1IAC A;  2PJT A;  1S4B P;  4AUO A;  1RMZ A;  2MZE A;  2RJQ A;  1OM7 A;  3KMC A;  1G05 A;  4CTH A;  4DF9 A;  5BPA A;  3F19 A;  1KAP P;  1FBL A;  3BA0 A;  1SRP A;  3V96 B;  3G5C A;  1BKC I;  3HB2 P;  3EDG A;  4DPE A;  1PWW A;  1O0T A;  2KRJ A;  2JSD A;  1PWU A;  4PKT A;  1D5J A;  1OS9 A;  1AST A;  1JAP A;  4GR3 A;  1D7X A;  1KUH A;  1ZXV A;  3KEK A;  4FXY P;  4XCT A;  2HU6 A;  3OHL A;  4PKR A;  3HDA P;  1JIZ A;  2OW9 A;  2O3E A;  2TCL A;  1CIZ A;  3EDI A;  4GR0 A;  1A85 A;  1MMP A;  1XUC A;  1GE7 A;  1I73 A;  4AYK A;  2DW1 A;  5L7F A;  5I2Z A;  3ZXH A;  2OW0 A;  1UMS A;  3EHY A;  3RTT A;  3U1R A;  3K7N A;  1I76 A;  4JPA A;  1BM6 A;  3USN A;  3MA2 A;  2YIG A;  3KEJ A;  2D1N A;  2E2D A;  2OVZ A;  1D8F A;  3B2Z A;  4ILW D;  4WZV A;  1RM8 A;  1G49 A;  2X3B A;  2ERP A;  4H49 A;  1CGL A;  2W14 A;  4PKW A;  2N8R A;  1DMT A;  2XS4 A;  1SMP A;  2MLR A;  2ERO A;  1EB6 A;  2ERQ A;  3UVC A;  2FV5 A;  1DTH A;  3LJZ A;  1EUB A;  4FVL A;  3SHI A;  4JIJ A;  3P24 A;  2DW2 A;  5I3M A;  2K2G A;  3DL1 A;  456C A;  4DD8 A;  3KEC A;  4A3W A; 
#chains in the Genus database with same CATH topology
 1IAB A;  1QUA A;  1GE5 A;  3KHI A;  3KME A;  3LMC A;  1AKL A;  3WV1 A;  2OXU A;  1JIW P;  3TSK A;  3DPE A;  1BKC A;  1QJJ A;  3F1A A;  4GWM A;  3LUN A;  1SLN A;  1MMR A;  3DTI A;  1J7N A;  2DDF A;  1YQY A;  2E3X A;  1CQR A;  1SAT A;  1QIA A;  1BQQ M;  3F15 A;  1XFY A;  5D1U A;  3ZUK A;  1QJI A;  1XFV A;  3LGP A;  1IAG A;  3TVC A;  5LAB A;  5I12 A;  3HY9 A;  5BOT A;  4AIG A;  3LIR A;  1HTD A;  3LIL A;  4IN9 A;  3N2V A;  1BZS A;  1GKC A;  3HY7 A;  3F17 A;  3EDZ A;  3OHO A;  2QPJ A;  1IAD A;  2WO9 A;  4H2E A;  2USN A;  1O0Q A;  2W13 A;  3AIG A;  5D2B A;  1UMT A;  4XM6 A;  2XS3 A;  2A8H A;  1CGF A;  2DDY A;  3KRY A;  1K7I A;  1SU3 A;  3F16 A;  1FM1 A;  1A86 A;  1R1J A;  1SLM A;  2OW2 A;  4H1Q A;  3E8R A;  1UTZ A;  3HDB A;  4PKU A;  3LK8 A;  2YB9 A;  2J83 A;  2CLT A;  4EFS A;  1ZVX A;  1H71 P;  4H82 A;  1R1I A;  1L6J A;  3B92 A;  4Q1L A;  4H3X A;  5D7W A;  3G42 A;  1GKD A;  2MZH A;  830C A;  2AYK A;  1XM5 A;  3AYU A;  3B8Z A;  2FV9 A;  2WOA A;  3TT4 A;  1D8M A;  3EHX A;  2SRT A;  1PWP A;  2JIH A;  2I47 A;  3DWB A;  1B8Y A;  3HBU P;  1G12 A;  1G4K A;  3LUM A;  1K7Q A;  1ZTQ A;  2WO8 A;  2OVX A;  4FXQ A;  1BIW A;  3DPF A;  5I0L A;  2RJP A;  5B5O A;  4WF6 A;  1EAK A;  3WV2 A;  3EWJ A;  2OY4 A;  1JAO A;  2W0D A;  1HFS A;  4WKE A;  1XFW A;  2W12 A;  1IAA A;  5CZM A;  1FLS A;  1PWV A;  3RTS A;  1B3D A;  4G0D A;  4L19 A;  1ATL A;  3ELM A;  1C3I A;  5B5P A;  1G9K A;  5D3C A;  3WV3 A;  1HFC A;  1MMB A;  1USN A;  1ROS A;  2X7M A;  3N2U A;  2V4B A;  1YOU A;  1IAE A;  4HMA A;  1AYK A;  1HOV A;  1TVI A;  2K9C A;  1OMJ A;  1Y0V A;  3NX7 A;  4H84 A;  4J4M A;  2Z2D A;  1QIB A;  3VI1 A;  1BQO A;  4A7B A;  3F18 A;  4ON1 A;  4DV8 A;  2O36 A;  3CKI A;  1KUK A;  1Y93 A;  1HY7 A;  4XM8 A;  4GQL A;  3DSL A;  4GF1 A;  1KUI A;  4GUY A;  3LEA A;  1JAN A;  3LIK A;  3LJG A;  5D1S A;  2D1O A;  4IJO A;  4GWN A;  4HX3 A;  2OXZ A;  3I7I A;  1JH1 A;  1XUD A;  3HYG A;  1JAQ A;  1OO9 A;  2CKI A;  1CK7 A;  966C A;  2MLS A;  3LKA A;  1WNI A;  1ZP5 A;  3ZVS A;  4PKV A;  1AF0 A;  5BOY A;  4XBH A;  4FU4 A;  2X3A A;  3LQB A;  4L63 A;  5D1T A;  4WK7 A;  1C8T A;  1QIC A;  1KBC A;  1GO7 P;  3L0V A;  5CUH A;  2AIG P;  2MZI A;  4AXQ A;  4PKQ A;  4ZR5 A;  1I1I P;  1YP1 A;  4QKZ A;  1JKY A;  4JP4 A;  1UTT A;  1Q3A A;  2OXW A;  1CAQ A;  3EDH A;  4H76 A;  3K7L A;  2Y6D A;  3GBO A;  2OZR A;  1Y8J A;  1XAX A;  5H8X A;  2Y6C A;  1GXD A;  3DTK A;  3LE9 A;  1XUR A;  2OY2 A;  1HV5 A;  1BUD A;  2W15 A;  2DW0 A;  3VTG A;  1ZS0 A;  1KUG A;  3O64 A;  2POJ A;  4XM7 A;  1K7G A;  1MNC A;  1R1H A;  4H30 A;  1UEA A;  1OM6 A;  4L6T A;  1R55 A;  2X3C A;  3LQ0 A;  1ZXC A;  3P1V A;  4PKS A;  1OS2 A;  2JNP A;  1Z3J A;  4JA1 A;  2OI0 A;  3HBV P;  4IUW A;  3TS4 A;  2JT5 A;  2OW1 A;  3DNG A;  1XFX A;  1CXV A;  1PWQ A;  1GO8 P;  4R3V A;  1R54 A;  5CXA A;  5I43 A;  1JJ9 A;  1CGE A;  3DTE A;  1OM8 A;  1JK3 A;  3AYK A;  2JT6 A;  4I03 A;  1XFU A;  1ND1 A;  1BSW A;  5I4O A;  5JMY A;  4G9L A;  1OZ9 A;  3O2X A;  1XFZ A;  1C7K A;  4GR8 A;  3Q2G A;  5L79 A;  2L0R A;  1MMQ A;  4I35 A;  2J0T A;  3LJT A;  1YCM A;  3Q2H A;  1BUV M;  1BKC E;  3KWV C;  4WKI A;  3I7G A;  1GE6 A;  3L0T A;  1KUF A;  4JQG A;  1IAC A;  2PJT A;  1S4B P;  4AUO A;  1RMZ A;  2MZE A;  2RJQ A;  1OM7 A;  3KMC A;  1G05 A;  4CTH A;  4DF9 A;  5BPA A;  3F19 A;  1KAP P;  1FBL A;  3BA0 A;  1SRP A;  3V96 B;  3G5C A;  2YUF A;  1BKC I;  3HB2 P;  3EDG A;  4DPE A;  1PWW A;  1O0T A;  2KRJ A;  2JSD A;  1PWU A;  4PKT A;  1D5J A;  1OS9 A;  1AST A;  1JAP A;  4GR3 A;  1D7X A;  1KUH A;  1ZXV A;  3KEK A;  4FXY P;  4XCT A;  2HU6 A;  3OHL A;  4PKR A;  3HDA P;  1JIZ A;  2OW9 A;  2O3E A;  2TCL A;  1CIZ A;  3EDI A;  4GR0 A;  1A85 A;  1MMP A;  1XUC A;  1GE7 A;  1I73 A;  4AYK A;  2DW1 A;  5L7F A;  5I2Z A;  3ZXH A;  2OW0 A;  1UMS A;  3EHY A;  3RTT A;  3U1R A;  3K7N A;  1I76 A;  4JPA A;  1BM6 A;  3USN A;  3MA2 A;  2YIG A;  3KEJ A;  2D1N A;  2E2D A;  2OVZ A;  1D8F A;  3B2Z A;  4ILW D;  4WZV A;  1RM8 A;  1G49 A;  2X3B A;  2ERP A;  4H49 A;  1CGL A;  2W14 A;  4PKW A;  2N8R A;  1DMT A;  2XS4 A;  1SMP A;  2MLR A;  2ERO A;  1EB6 A;  2ERQ A;  3UVC A;  2FV5 A;  1DTH A;  3LJZ A;  1EUB A;  4FVL A;  3SHI A;  4JIJ A;  3P24 A;  2DW2 A;  5I3M A;  2K2G A;  3DL1 A;  456C A;  4DD8 A;  3KEC A;  4L7A A;  4A3W A; 
#chains in the Genus database with same CATH homology
 1IAB A;  1QUA A;  1GE5 A;  3KHI A;  3KME A;  3LMC A;  1AKL A;  3WV1 A;  2OXU A;  1JIW P;  3TSK A;  3DPE A;  1BKC A;  1QJJ A;  3F1A A;  4GWM A;  3LUN A;  1SLN A;  1MMR A;  3DTI A;  1J7N A;  2DDF A;  1YQY A;  2E3X A;  1CQR A;  1SAT A;  1QIA A;  1BQQ M;  3F15 A;  1XFY A;  5D1U A;  3ZUK A;  1QJI A;  1XFV A;  3LGP A;  1IAG A;  3TVC A;  5LAB A;  5I12 A;  3HY9 A;  5BOT A;  4AIG A;  3LIR A;  1HTD A;  3LIL A;  4IN9 A;  3N2V A;  1BZS A;  1GKC A;  3HY7 A;  3F17 A;  3EDZ A;  3OHO A;  2QPJ A;  1IAD A;  2WO9 A;  4H2E A;  2USN A;  1O0Q A;  2W13 A;  3AIG A;  5D2B A;  1UMT A;  4XM6 A;  2XS3 A;  2A8H A;  1CGF A;  2DDY A;  3KRY A;  1K7I A;  1SU3 A;  3F16 A;  1FM1 A;  1A86 A;  1R1J A;  1SLM A;  2OW2 A;  4H1Q A;  3E8R A;  1UTZ A;  3HDB A;  4PKU A;  3LK8 A;  2YB9 A;  2J83 A;  2CLT A;  4EFS A;  1ZVX A;  1H71 P;  4H82 A;  1R1I A;  1L6J A;  3B92 A;  4Q1L A;  4H3X A;  5D7W A;  3G42 A;  1GKD A;  2MZH A;  830C A;  2AYK A;  3AYU A;  3B8Z A;  2FV9 A;  2WOA A;  3TT4 A;  1D8M A;  3EHX A;  2SRT A;  1PWP A;  2JIH A;  2I47 A;  3DWB A;  1B8Y A;  3HBU P;  1G12 A;  1G4K A;  3LUM A;  1K7Q A;  1ZTQ A;  2WO8 A;  2OVX A;  4FXQ A;  1BIW A;  3DPF A;  5I0L A;  2RJP A;  5B5O A;  4WF6 A;  1EAK A;  3WV2 A;  3EWJ A;  2OY4 A;  1JAO A;  2W0D A;  1HFS A;  4WKE A;  1XFW A;  2W12 A;  1IAA A;  5CZM A;  1FLS A;  1PWV A;  3RTS A;  1B3D A;  4G0D A;  4L19 A;  1ATL A;  3ELM A;  1C3I A;  5B5P A;  1G9K A;  5D3C A;  3WV3 A;  1HFC A;  1MMB A;  1USN A;  1ROS A;  2X7M A;  3N2U A;  2V4B A;  1YOU A;  1IAE A;  4HMA A;  1AYK A;  1HOV A;  2K9C A;  1OMJ A;  1Y0V A;  3NX7 A;  4H84 A;  4J4M A;  2Z2D A;  1QIB A;  3VI1 A;  1BQO A;  4A7B A;  3F18 A;  4ON1 A;  4DV8 A;  2O36 A;  3CKI A;  1KUK A;  1Y93 A;  1HY7 A;  4XM8 A;  4GQL A;  3DSL A;  4GF1 A;  1KUI A;  4GUY A;  3LEA A;  1JAN A;  3LIK A;  3LJG A;  5D1S A;  2D1O A;  4IJO A;  4GWN A;  4HX3 A;  2OXZ A;  3I7I A;  1JH1 A;  1XUD A;  3HYG A;  1JAQ A;  1OO9 A;  2CKI A;  1CK7 A;  966C A;  2MLS A;  3LKA A;  1WNI A;  1ZP5 A;  3ZVS A;  4PKV A;  1AF0 A;  5BOY A;  4XBH A;  4FU4 A;  2X3A A;  3LQB A;  4L63 A;  5D1T A;  4WK7 A;  1C8T A;  1QIC A;  1KBC A;  1GO7 P;  3L0V A;  5CUH A;  2AIG P;  2MZI A;  4AXQ A;  4PKQ A;  4ZR5 A;  1I1I P;  1YP1 A;  4QKZ A;  1JKY A;  4JP4 A;  1UTT A;  1Q3A A;  2OXW A;  1CAQ A;  3EDH A;  4H76 A;  3K7L A;  2Y6D A;  3GBO A;  2OZR A;  1Y8J A;  5H8X A;  2Y6C A;  1GXD A;  3DTK A;  3LE9 A;  1XUR A;  2OY2 A;  1HV5 A;  1BUD A;  2W15 A;  2DW0 A;  3VTG A;  1ZS0 A;  1KUG A;  3O64 A;  2POJ A;  4XM7 A;  1K7G A;  1MNC A;  1R1H A;  4H30 A;  1UEA A;  1OM6 A;  4L6T A;  1R55 A;  2X3C A;  3LQ0 A;  1ZXC A;  3P1V A;  4PKS A;  1OS2 A;  2JNP A;  1Z3J A;  4JA1 A;  2OI0 A;  3HBV P;  4IUW A;  3TS4 A;  2JT5 A;  2OW1 A;  3DNG A;  1XFX A;  1CXV A;  1PWQ A;  1GO8 P;  4R3V A;  1R54 A;  5CXA A;  5I43 A;  1JJ9 A;  1CGE A;  3DTE A;  1OM8 A;  1JK3 A;  3AYK A;  2JT6 A;  4I03 A;  1XFU A;  1ND1 A;  1BSW A;  5I4O A;  5JMY A;  4G9L A;  3O2X A;  1XFZ A;  1C7K A;  4GR8 A;  3Q2G A;  5L79 A;  2L0R A;  1MMQ A;  4I35 A;  2J0T A;  3LJT A;  1YCM A;  3Q2H A;  1BUV M;  1BKC E;  3KWV C;  4WKI A;  3I7G A;  1GE6 A;  3L0T A;  1KUF A;  4JQG A;  1IAC A;  2PJT A;  1S4B P;  4AUO A;  1RMZ A;  2MZE A;  2RJQ A;  1OM7 A;  3KMC A;  1G05 A;  4CTH A;  4DF9 A;  5BPA A;  3F19 A;  1KAP P;  1FBL A;  3BA0 A;  1SRP A;  3V96 B;  3G5C A;  2YUF A;  1BKC I;  3HB2 P;  3EDG A;  4DPE A;  1PWW A;  1O0T A;  2KRJ A;  2JSD A;  1PWU A;  4PKT A;  1D5J A;  1OS9 A;  1AST A;  1JAP A;  4GR3 A;  1D7X A;  1KUH A;  1ZXV A;  3KEK A;  4FXY P;  4XCT A;  2HU6 A;  3OHL A;  4PKR A;  3HDA P;  1JIZ A;  2OW9 A;  2O3E A;  2TCL A;  1CIZ A;  3EDI A;  4GR0 A;  1A85 A;  1MMP A;  1XUC A;  1GE7 A;  1I73 A;  4AYK A;  2DW1 A;  5L7F A;  5I2Z A;  3ZXH A;  2OW0 A;  1UMS A;  3EHY A;  3RTT A;  3U1R A;  3K7N A;  1I76 A;  4JPA A;  1BM6 A;  3USN A;  3MA2 A;  2YIG A;  3KEJ A;  2D1N A;  2E2D A;  2OVZ A;  1D8F A;  3B2Z A;  4ILW D;  4WZV A;  1RM8 A;  1G49 A;  2X3B A;  2ERP A;  4H49 A;  1CGL A;  2W14 A;  4PKW A;  2N8R A;  1DMT A;  2XS4 A;  1SMP A;  2MLR A;  2ERO A;  1EB6 A;  2ERQ A;  3UVC A;  2FV5 A;  1DTH A;  3LJZ A;  1EUB A;  4FVL A;  3SHI A;  4JIJ A;  3P24 A;  2DW2 A;  5I3M A;  2K2G A;  3DL1 A;  456C A;  4DD8 A;  3KEC A;  4L7A A;  4A3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...