3DTIA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
243
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSLTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
molecule keywords IRRE protein
total genus 73
structure length 243
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtiA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtiA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtiA01
3DTKA 3DTIA 3DTEA
chains in the Genus database with same CATH superfamily
3MEXA 5ILUA 2R5YB 1ESUA 2X71A 4UNOA 2EFUA 4NXEA 2OD5A 2RNGA 5FRMA 1JKRC 1WZ2A 3GTLJ 1PI5A 1D7XA 1OYYA 5LABA 1V9YA 1D06A 3HOTA 1OS9A 1XSDA 4KIBA 1YOVB 1N78A 2K3FA 2E35A 1I76A 4HV6A 1D5JA 4II3A 3OR2C 2Y55A 1IDYA 3EGXC 1DJBA 1S66L 1PYVA 5HODA 2WZZA 4HA8A 3CCJI 2G9WA 1G5UA 3HJKA 5LBRA 4QJGA 2L4MA 5A90A 4XLNF 1SD6A 1R36A 1M6KA 3AL0C 4WF0A 2W0DA 4EM0B 4M3BA 1P9RA 2BBYA 2E1MB 3VSLA 2IAIA 3QP6A 1DY6A 2V8FA 3D72A 2ZNYA 2OCEA 3LR0A 3EYYA 3CQZJ 4I03A 2OXUA 5D5WB 4FSFA 4MEZA 2E7XA 4LK1F 1D0XA 1EKEA 3RKWA 2ZMFA 5DTSA 2IGKA 1SFEA 2KISA 4GW9A 1TBXA 1EV7A 5JVTA 5JYOA 5GAHJ 1F5MA 2B02A 3JRAA 1XXMA 2M30A 5L3BA 3BG6A 4MBFA 4BL3A 2MGQA 5AONA 4MBHA 3Q7ZA 2Q9NA 1ETWA 1QMFA 3IBJA 4G3WA 3HBUP 2X48A 3KFWX 3DTMA 3LA2A 2CQNA 2FU4A 1K6RA 1K55C 1NK2P 2L54A 2KDOA 4U3TA 1R5GA 3B02A 2PR5A 4B43A 2PT7A 1ZAOA 2JA2A 3SHFA 4AVPA 1SKOA 2CJJA 2DFHA 3OCNA 1WJ5A 2D5VA 1X4PA 4CLCD 1POGA 2QM3A 1K55A 3E5UA 3ITAA 4BE2A 2DA6A 4IXAA 1XFUA 4XRSG 1U5TA 5CECA 1L0DA 4KMUX 3LGOA 4QPQA 4E7JA 4JX6A 4LRXC 1YP1A 1DGWY 1JTYA 3K1PA 1TWCJ 4I6ZA 2W27A 4RGSA 3OIOA 2A6TA 2XRLA 5K5QA 5BPIA 4A7BA 4D2OA 4D5CA 4MTDA 2Z2LB 4JGRA 3AGDA 5KSHA 1KA8A 1DGRM 1LL5A 3MCZA 2KJCA 1IUYA 1AKHB 4A0XA 2CYYA 5DTTA 2EZIA 3A3IA 4PFPA 3CUQC 3K4BA 3KO6A 4A12A 5CGWA 2AXTC 3BTCA 2VV6A 3BFGA 4CTHA 4FXQA 4WK7A 2EPFA 3CTAA 3BP8A 3TQNA 4BYYA 3CJNA 5F1GA 2F4MB 2EINH 1H71P 4E3JA 1XB4A 3E6DA 1WYCA 1B8YA 3HB2P 4IHYA 2WAQA 4L0YB 1YT4A 3VP1A 3RJPA 1SRPA 2Y0SN 3HOXJ 1OQYA 4KNYA 3Q7VB 2H10A 3QOEA 5LBQA 1IN4A 2GQQA 2WV1A 3L00A 2OV7A 3HYGA 2CFOA 1A04A 3H92A 4LPZA 4WM9A 1LB2A 3ZCZA 3K2ZA 4D60A 5D7WA 3G1OA 2NVUB 1XFQA 2PRFA 2HZ5A 1WJAA 3K10A 1WA9A 5ICCA 2ZM0A 3BC8A 3AG3H 4U0XA 4O0PA 3V42A 4OOIA 2WGWB 3RKQA 3J81K 3IS2A 1YJWI 1W0UA 4UUSA 3JRGA 2A3UA 1ASTA 4NEED 3IQAA 2EQRA 4MEYF 1GLNA 2OY2A 1CGEA 4PJJA 1W79A 4LIUA 4UVBA 4B9OA 4WF6A 3LEZA 4S2NC 3SS3A 2KFDA 2VT2A 2EA2A 3UKGA 4PKRA 2V1UA 1R5ID 1SAUA 2HU9A 2XGEA 4IJGA 1GA0A 2VGKA 5GHZA 1GVDA 5I12A 5CRFA 2CQ7A 2HQ5A 4XICA 3BY8A 1V54H 4ZYGA 2PYPA 2DTZA 4WEKA 2HZDA 2M7BA 3UN7A 1GO7P 3KP7A 1Y8RB 4I0AA 1LPQA 4KZ7A 1KDWA 1ZH5A 2CH0A 1VQ5I 3P09A 2DBBA 3ZQ7A 1R4NB 3RDIA 2X1CA 1Z05A 3CCRI 2QPNA 3BZCA 2E60A 2USNA 4RLQA 2HQRA 3BOQA 4I02A 1G6AA 2L0WA 1TNTA 1Z7UA 2GAUA 5L7FA 2XS3A 2NVQJ 2A6EF 2L4RA 3HLWA 5GLDA 3DL1A 3LK8A 4K08A 5FGMA 2W3FA 3T4TA 3ZFZA 3V96B 2DU9A 4RS8A 3QNBA 2PBDP 1LFUP 3M8FA 3AGFA 3JRDA 3SXYA 2P8TA 5DV5A 3RPUA 3CC4I 1G6OA 4IHVA 3ABKH 2HP6A 1BOBA 1IOUA 3CCUI 5CXWA 1U3EM 3IH4A 4II7A 5EVID 3V8LA 3IH8A 1S7AA 1SDEA 3HUNA 2M0CA 5E3OA 3HPGA 3PNYA 1IEMA 4OQHA 3VTGA 2VOPA 1SFXA 1V55H 1BUVM 5D1SA 1K7GA 2ZB9A 1PUEE 2DPUA 3R60A 2VC0A 1U8RA 1LUJB 2VBYA 2HJEA 4A3WA 1X3ZB 3SFIA 4X6AJ 3ELMA 4Q0JA 3E4PA 4NQWB 4M9SA 3VP4A 5K7ZA 4N1XA 3HLDA 3TS4A 2WB1A 5H20A 4S2PA 4E4HA 4KUOA 1B9NA 3GQZA 3MMYB 4F52A 1U9OA 2OAQ1 2C6YA 1FPQA 3ZG7B 3ZGKA 3IWFA 5CHUA 1K4SA 1WI9A 4Y7NJ 2E1CA 4M6VA 3A03A 3L2WA 5FAPA 1JKQC 3OPLA 4QHCA 3ZQHA 2AYKA 2J83A 1A31A 2DFFA 3UPPA 1RKTA 2OZRA 3K2AA 5A2QZ 5E3NA 3U1DA 1GDTA 4UV8A 1APLC 3S7NA 1SKOB 3SEQA 3MZHA 4DV8A 1HA8A 2XAHA 1FQGA 2PX9A 3GX4X 2QF7A 1ODDA 1J59A 4WZ5A 3WRZA 1MMQA 1I5QA 4XN3A 3ROUA 4K0XA 5HARA 3TMOA 3ZUKA 1XPBA 5HZHA 1JGGA 1I5ZA 1BC7C 1ES4A 3EEHA 1MBEA 1R00A 1Z6FA 2BY3A 4WXHA 2QZ6A 1U60A 2CS3A 2K9QA 5IOZA 4H82A 3F3XA 1K56D 1S4BP 1KUFA 3C2GA 1XS9A 1JTGA 3BYDA 2L0KA 1IACA 5FB2A 2KRFA 2MC4A 3TDUC 5FROA 3G6EI 4PGGA 1IFQA 2Z6CA 2X7MA 1W8YA 1D1JA 2CMNA 5FO5A 4WBGA 2CFXA 4K91A 4F91B 3A3EA 4IL6C 5KNLA 4IHQA 3BROA 3R4KA 2RQQA 2QSFX 1QZZA 3BQAA 3VP3A 3VYSB 1BQOA 1KQ8A 3ABUA 4O3MA 4BD0A 2V4JC 4I01A 2BE5F 3UO9A 3Q9SA 3CZDA 2DK8A 1YLTA 2XGNA 5E2GA 4HOBA 2G7HA 1ZGAA 2MD5A 3ZMZA 1QICA 3LSMA 3PJRA 4A3BJ 5FAQA 2PYRA 4ENNA 2ID3A 5EZHA 3A01B 5FDSA 3RXWA 4HHDA 4CHUA 4IHSA 5E8GA 4D1QA 4H84A 3IRQA 2IXSA 3EWKA 4YRVA 1I6HJ 1IRGA 3OYAA 2ZQ9A 3DBAA 3IT9A 3TSGA 2IW5A 2W82A 2LFBA 3F6OA 3HRSA 2WWYA 4BEHA 4I38A 4A3GJ 4CH7A 2OW1A 3G3ZA 1SFKA 4P1WA 4R1HA 4BHBA 3WTUC 1ERDA 4HEA2 4LK0F 4FX4A 1IELA 2ZBBA 3H9WA 3VE4A 4E3KA 4RGXA 5E1XA 1LQ1A 3W6JB 5LRRA 1J9MA 1NJ4A 3KSGA 2YS9A 2FV9A 3KEJA 4EJWA 2BXYA 4G94A 1GXPA 3JYIA 4GCZA 1X0OA 5DKLA 3JW4A 3LSRA 1D5YA 1IN5A 2DT5A 3RSNA 2DPDA 3S15J 2EA4A 4JF6A 2Z16A 4BD1A 4YFMA 3HDAP 2QYBA 4Y13A 2MC3A 2E36A 1OYIA 2DOAA 2WAFA 2ZNZA 5HWVA 1IAAA 3WTXC 1TQMA 5HNFA 3ULQB 3RI4A 2EX8A 1X1CA 2OJED 2V2FF 3WTVC 1HLUP 4OONA 2BXZA 5M5YJ 2LRDA 1OYWA 4BJTA 5EG0B 1FTZA 4ZJ3A 3QP5A 2QJ7A 3F1OA 4CLCC 2TRTA 3E2KA 4HP4A 2MH9A 4EGYA 3QWLA 1LL8A 3F8CA 1GO8P 3BTLA 5EM1A 2QSGX 1TS6A 1S4SA 4N9LA 2X01A 3EWJA 1WH5A 3P24A 1AYKA 4R6LA 2XA7S 3FXRA 3UMDA 1VEUB 1F98A 2ZO4A 2JRTA 1NRFA 2BY1A 3V8KA 3M8JA 2Z9OA 4QB8A 1CGFA 1ZYRF 3FC7A 2O0YA 1G3WA 2L02A 5DCMB 4QWOA 4B4XA 2KJBA 5A8BA 1TTYA 3BJAA 2GJ3A 4HG2A 3IXDA 1FIAA 1S3JA 2Y6CA 3PFIA 2L7KA 5TR7A 3F1PA 4AIHA 4RLFA 1T39A 3N7WA 1XM5A 2LBFB 3OYFA 3S16J 2ZQAA 2CWEA 2TCLA 3WU0A 2V1NA 3JTGA 4UA9A 5CTNA 4B44A 4NC7A 5HLGA 2P7CB 4UVCA 1LEBA 3ZDJA 3EYIA 4NG2A 3EPZA 1OPXA 3Q7VA 4S2IA 1X2NA 5HLIA 4R8HA 3UDXA 1FM1A 5HDDA 3SZGA 3NY4A 3TOAA 3IC7A 2MW8A 2AXLA 1JE8A 2OWHA 3TO6A 1ZXCA 3F1OB 4Y17A 1ULYA 2O03A 1MDMB 1CK3A 3NJAA 5M5WJ 2K5CA 1DP9A 1PW8A 3OYLA 5HW3A 1JVJA 4JXWA 1GE7A 1ZKGA 4O6JA 2R7QA 4L6TA 3LAPA 3RTRA 3IX3A 4BBSJ 1VQMI 2MLKA 2CQKA 2CMPA 4DYQA 5E79C 5CPRB 1K38A 4MN5A 1MWTA 2HPBA 2DJIA 4N0BA 3M4OJ 3ISPA 4Y0TA 5HFOA 5IT3A 1UG0A 4A3KJ 1QO0D 3K2NA 1CEFA 3SH9A 3DEUA 4XK4A 3M8EA 3ZG8B 3P9CA 1CGLA 1FBSA 4M72A 3Q81A 2Y30A 5DD8A 1GVJA 4F93B 2XF3A 2H6CA 5F6FA 1WE4A 4RQ9A 1S29A 5D6EA 3CCQI 1WKMA 2L7ZA 1JHHA 4HMAA 1B72B 4QU3A 4LGWA 5E3LA 3HOYJ 2W48A 3DQVC 3L7WA 4EM2A 3FHZA 3WODF 1JUMA 2FF4A 1MDMA 3QPHA 3ZNYA 3LUMA 5D2BA 1YRNB 2Y79A 2RKHA 2CG4A 1IAEA 2GWRA 5GTIC 1TS7A 4N9HA 1G4KA 3BWGA 4RAFA 4MHGA 1K7IA 3J80Z 2IRFG 3KYCB 4NQWA 3KLNA 2GXAA 4EGZA 4KUKA 4ZDLA 4MDZA 1GHMA 4L0ZB 1QIBA 5CTMA 2LNBA 2VBXA 3BLYA 4U88A 4ENKA 3HSRA 1MWUA 3E5QA 3ML6A 3FF5A 1EH6A 1OLTA 3S7QA 5M3MJ 4R3AA 3E5XA 2FMYA 3KCCA 4NC6A 4NHJA 3S1MJ 4PZJA 4FCYA 1QNTA 5A93A 4ARZB 3D5SC 2UWXA 2YKHA 3I59B 1ZG6A 1XFVA 2ZMEC 2R4GA 3C3WA 1A86A 1ZTUA 3BG5A 2VN2A 3SZTA 4B3XA 3CUEA 1FP2A 1ZRCA 5FKKA 1VM1A 5DF9A 2XSJC 3LOCA 4XRSA 5D3OA 2WAQN 3I53A 2KQRA 1BUEA 1LSVA 4DKIA 4A5MA 2OLUA 3GBGA 4GD6A 1BI2A 4HW0A 4ZZDA 4EVIA 2D1NA 1RETA 5C5KA 2X3BA 2V6EA 1XDSA 3JTHA 2JT1A 4LG0B 5EEAA 4RBOA 3H82A 4OMZA 5FKLA 5H6QA 5J8XA 3SHIA 4E3IA 4I2OA 3E7LA 2RJPA 5BOYA 1XSXA 2MZEA 3BFCA 2M7AA 2GXBA 4PJLA 2EFXA 4L0LA 3LA3A 1SANA 4IHXA 2VQHA 4JPAA 2VJIA 5DYMA 2QBYB 1IRXA 1OR7A 2GBYA 1ZRDA 3TVCA 1FYLA 5CGSA 1AOYA 1H9GA 4Q48A 1FYMA 1OMJA 3DTKA 5KVRA 1K54C 3O86A 2WTEA 1IDZA 3CPTB 3H5AA 1HW1A 3KEYA 2ZMVA 5CHJA 1ZHHB 2BZTA 4ZTJA 1K61A 4B1RA 3LSHA 1PFLA 1FMVA 1YMSA 3ZMTA 2LLKA 4QLCU 3H3UA 3GTGJ 4GCVA 3ZQQA 3NOPC 2C6WB 2XK1A 1RP5A 4E7SA 2R9XA 4R3BA 2VBWA 5FD5A 3S4XA 4PFOA 3VP0A 1EB6A 1CQAA 3A01A 4AD9A 2QENA 2DCFA 3PXPA 2Y48A 2E7WA 4ZJZA 1G2HA 4HSTA 5I94A 4ETZA 3S93A 1QU3A 1JT6A 5KCMA 3OPHA 2Y31A 1T0FC 5J4VA 3ZQLA 4AFIA 3TL4X 2DT7B 5FRNA 1ES5A 2E2HJ 1NK3P 1ZLKA 2XQZA 2KIQA 3HDBA 4B8XA 1AXBA 1R1HA 2NXNB 1G28A 2CKIA 4OAZA 4O8GA 4ZYDA 5CZMA 3OYCA 2CQXA 3BY9A 2WY8Q 2PQ8A 3WG9A 1OMIA 4OIRF 2Y2HA 3K4LA 2ACGA 2VKSA 1PDNC 2KZGA 4KZ5A 4XQFA 5L3FA 2FEZA 3TO7A 3ZN0A 2FNAA 3S14J 2HYGD 1S72I 3MJQA 1HY7A 4XM3A 4CCOA 3CUQA 2LG4A 2WKQA 3IWZA 2ZXJA 3ZQFA 1ETQA 4HPQA 4A0ZA 2HDDA 2JSCA 4NNJA 1DJCA 1T1AA 3JREA 2XFTA 3E0JB 4G9YA 3QRFF 4PJMA 4A93J 1YQSA 1H89C 2DODA 4LFUA 5D6FA 2HVRA 4H30A 1OM6A 1WFXA 3HOVJ 2X3CA 3TW8A 4B4ZA 5F27A 5LD2C 3S2DJ 5HLHA 1S1YA 2EJRA 3L09A 2RCXA 1B8IA 5FQ9A 2YX4A 2DDAA 4H1QA 3E0YA 4H8RA 1UTTA 5DTDA 2QVOA 3MMHA 3OOUA 1G68A 3W6VA 2F5EA 4EERA 3WTTC 4A0YA 2EX2A 2NYXA 5B5EC 3N6IA 4ME4A 2P4WA 4QSHA 1ZHFA 2KLOA 4RGUA 5TISC 3DKXA 3PFYA 1EJ9A 4Y0OA 1YSQA 1P4XA 2XROA 4PHTA 2KIFA 1RIOH 1GHPA 5DD4A 4G7OF 4BJ6C 2A2LA 1CGPA 3E4OA 1WVRA 2Y2OA 1LSWA 4HNVA 4E3MA 4DXCA 3CG5A 5M3FJ 2XSSA 2JPCA 3UB8A 4GS9A 3BY6A 3QPSA 2VA0A 3NECA 4PAUA 3GLXA 4OH0A 1E3PA 1BR4A 3LSPA 2MG4A 1MNMC 5DUKA 2IS6A 1E25A 1P0ZA 1RM8A 4H4KC 3P01A 3OIQA 4FHTA 1MBJA 2EK5A 3NDEA 3WS1A 4E04A 2O61A 1V5EA 2J9PA 2ELJA 4UV9A 3ERED 5CXAA 3CI6A 2UWMA 4EESA 1AWIA 1OTAA 1JANA 4S2NA 2K40A 2BW3B 4X6TA 1YTYA 4XLCA 1FJLA 2IA2A 4EJOA 3O87A 2Y69H 3HLBA 3WG7H 2GOMA 1Z6TA 1YS6A 2AQFA 2B0LA 4LITA 1J09A 3H0DA 1YLZA 2EX9A 1AKHA 4JBFA 5J4EA 5D5UB 5HAIA 2XSDC 2EFPA 4JF5A 1R1IA 3CCSI 4J01A 4EXOA 4HOIA 1ZXVA 1NXYA 2FOWA 1R23A 1XX2A 2ZC3B 3NX7A 4O7DA 3R0AA 3CLQA 3OIPA 1UCRA 1XC5A 2RREA 4N4OB 4IX7A 1LI0A 1Z91A 2M34A 1BLHA 3LEQA 2Z6DA 4XLPF 5J3WA 1MD0A 3HREA 3KIOA 3LUQA 3QODA 2WGIA 1OJGA 4RX2A 1XJ2A 3ZN1A 4CICA 4BACA 2F48A 2P74A 4UA7A 2DMNA 1K79A 2NOGA 3VODA 2HDCA 3EHYA 1FSYA 4EU0A 1PYYA 2KLIA 2PJRA 3C2WA 2ISYA 1OISA 3DLAA 1I2WA 1QIAA 2M8EA 2V7FA 1S5LC 2WADA 3LSGA 3C38A 1OPCA 3VV4A 3U2AA 1Z3JA 1K4FA 2WGWA 1XA1A 2PN6A 2ID6A 2JA6J 1Z21A 4A69C 2ZQDA 1D7EA 1GKCA 2JMWA 5I43A 1HKQA 3ZOBA 3L1PA 1HC8A 4KQDA 4YG2F 4F55A 4EJUA 3JAMZ 2K3PA 2DI3A 1P97A 1XURA 2Y2IA 1MMSA 3D3OA 3FMRA 1VZ0A 2A3SA 2ZJQF 3G31A 4BXUA 2HKOA 5JHUA 4B93A 4P96A 1MWRA 1RUNA 3IXHA 1VQLI 4XT2B 2OVXA 5D4RA 1DMTA 2Y75A 2UXXA 2WKPA 3MFXA 4P6BA 2CLTA 3K4KA 4OQ0A 3TOIA 3IWOA 1A85A 4IVNA 1YLJA 5FLMJ 3S1RJ 1EH8A 2KP6A 4WF2A 4LMYA 2XH9A 3JAMK 1T33A 2L9VA 2X1EA 1K7QA 1FIPA 4HDVA 2P7JA 2JKFA 4BKXA 1KGGA 4N1HA 4OOLA 4DDSA 3EDIA 1JHFA 3B42A 3F19A 3N4MA 1BJZA 1G3YA 2ICWG 3GR2A 4OOYA 2LTPA 1G9KA 1MMRA 1MPLA 4C6YA 4GR3A 2R9WA 3ECOA 4NDLA 2X0LA 2Y6DA 966CA 4DQ2A 1G6NA 2DNSA 4KZAA 1BKCI 2H0YA 3LSTA 3Q0WA 2IA1A 5KZHA 4NXFA 4WMCD 1WCMJ 2Y9ZA 4KG5A 3MAJA 1FOKA 4PKWA 2J8YA 2LBFA 3DU5A 4BJ5C 2HDRA 4DF6A 2IJLA 5LGTA 3OCLA 2BTFP 3K7AJ 4IHTA 1XGSA 4O01A 3F8NA 4P55A 4PSWA 1NY0A 3LAJA 2W4SA 2W3DA 2DK5A 5JR3A 4KDPA 2R93J 1S0WA 1T1BA 2NUTC 4OPYA 1ENHA 2M4GA 1MNDA 1MKMA 2OSUA 4UQIM 2IGOA 1FYKA 3UMEA 2JQ7A 4Y33A 2F5FA 2X6OA 3WTZA 1P2FA 3D9YA 2R92J 2XEPA 3GTMJ 2WAEA 5CHMA 2J80A 2LR8A 4Z1WA 5F1FA 2VXZA 3F21A 5HAQA 5F1RA 4GDBA 3JRBA 4OP8A 3SW1A 3IH2A 2QEXI 3HRTA 2VQCA 3PSFA 2O9AA 1X2MA 1LJ9A 2VKHA 4F3LA 1DU0A 2BY2A 5C44J 3E1SA 3A0BC 4XOTA 4R79A 5DM6F 3S2HJ 3NIAA 4MN7A 1VTNC 5GTHC 1BM6A 4DIQA 1BI0A 1NG7A 1G8XA 2OAZA 5D8KB 4GHIB 5U47A 3DKWA 2F5CA 3LFUA 3WU2C 2XF5A 4WEJA 4EBPA 3DU6A 3I71A 2W1OA 5BOHA 1K6YA 3F9KA 4HLXA 4RAZA 3SQNA 4WCGA 3KETA 3JSOA 3PR6A 4Q4ZF 1TW3A 4JXVA 1EWZA 4UEYA 5EFWA 1DU6A 1TQPA 3WRTA 5EVIA 3G2BA 2NNYA 2LP0A 3U9GA 4DW6A 1MJBA 4ETXA 3GVAA 1NTCA 5FLXK 5CX7A 4E3LA 4XUXA 2XA7M 5IPAA 3HGYA 3ZMDA 3R0JA 1SVMA 3C1DA 5H6RA 2TDXA 4R3VA 3CF2A 2JSDA 2M3AA 2EV0A 5EPHA 1LDKB 4W97A 4Q0HA 4WKIA 3RPQA 5FASA 4JQGA 3HY7A 3LUNA 1MZUA 2W13A 2WA0A 3V3RA 1NYMA 3TW7A 1ETYA 2P6SA 4M3GA 4KFCA 2X85A 1N77A 1V5GA 1ONHA 3KHIA 1WH7A 2TCTA 2EZLA 1OTDA 3FK7A 1TS0A 2HYJA 4JYKA 4XLHA 3DXJF 1CF0A 5FKOA 2ISZA 4X25A 1YCMA 2J0TA 2QHKA 3UB6A 4U7DA 3CAXA 1TWHJ 1HLVA 2L01A 2ZMEB 1MXOA 1IADA 2JNPA 1IG7A 3M7GA 1D0ZA 1YM1A 3I4MJ 1YPRA 4DYRA 1LDJA 2FFFB 2XKPA 2WO8A 2M5WA 4PPRA 4ON1A 1H8YA 3F1AA 2JVGA 4CGZA 3KWVC 2FBIA 2V6CA 5FATA 5K5OA 3U1RA 2MZIA 1HD8A 4NXBA 2DO7A 2GA2A 1M1EB 4FE7A 1XX5A 3JRHA 2VQLA 2VGJA 5G4YA 1DPUA 3MS6A 1KBCA 3CCEI 2COMA 4CCLA 2D01A 3W8KA 3ZVSA 4PKYA 4IQ4A 2HOEA 4M9ZA 3I4NJ 1W63Q 5HWTA 4GXOA 1OO9A 3SDBA 1L6JA 4R4RA 1FSEA 5D3CA 4BBRJ 2O99A 2CU7A 4LV2A 1V3FA 3CMZA 3VE3A 1P9WA 3GO5A 2EZKA 3ABLH 1YW9A 3J80K 4CA0A 3ONQA 2GX5A 2L4AA 4WXCA 1OJLA 2CQQA 1G3SA 1ON2A 5CJ9A 4QTRA 1LLBA 1GHIA 2WK0A 3EGDC 4JGQA 3S3NA 3LQRA 5L09A 5BS6A 4FU4A 1GE5A 1S7EA 2OI0A 4QY5A 1F36A 4BAYA 4CLCB 2FX0A 4HF1A 1D1BA 2IBDA 3IF6A 4OKPA 4EEUA 1E3HA 1OCOH 2JA8J 3BQ8A 4AYBN 3MXSA 3NOUC 3V4GA 4OIOF 1T19A 2W85A 3BG3A 2LC2A 5EEHA 3FKJA 5M18A 1R58A 1GXDA 3C4OA 3VWBA 2JHEA 3DPFA 1BA5A 2Y4AA 5LGNA 1FR1A 5IT9K 1I1SA 1DP8A 5IHVA 1GXQA 3QU3A 4OIPF 1JI8A 2DOFA 4KIGA 4XKBA 1TWAJ 1Z6RA 3KP6A 5FD6A 3UE1A 3CJQB 3ECHA 1O07A 1T0FA 4WZ4A 1UMQA 4QD4A 3S8PA 1T95A 2EX6A 3LO7A 4CXFA 1L0OC 1XPXA 2ZM2A 5I2ZA 4I3AA 5GAGJ 5IP6A 3DKYA 3KZIC 2IS2A 2VLGA 4Q0IA 5FJ8J 4EV4A 2BVMA 4WL9A 3PBOA 2H8RA 1D8MA 2FUG2 3R61A 4IEJA 1E3UA 1YYVA 1XGJA 3T4QA 2DA7A 2JUGA 4EJTA 1FILA 4DJ3A 3BA0A 4V19K 1JXSA 4OQIA 1YE9A 3I7JA 5E2EA 2LF8A 4JP4A 3GTQJ 1RR7A 2XIGA 2VB6A 4A3DJ 1ZGWA 2J3WA 1Q1VA 4YIRX 3OYBA 1SFUA 1YLYA 2WBMA 5TGTA 5LGUA 3OS2A 1BTLA 3IXGA 1Z67A 2K4BA 4L18B 4JX4A 4J19A 1N9OA 3UDIA 4BJPA 3HBRA 2QQAA 5AVFA 3G4SI 2DMPA 4HRIA 2FBKA 3F72A 1E3UD 2EFOA 4BU2A 3G2ZA 3TE8A 2NS7A 3O64A 2V1BA 3PM1A 4KIFA 1ETKA 1SKFA 3SDGA 4PCQA 1UHWA 3E97A 3LNQA 2PG4A 1R9TJ 1T38A 5C3EJ 3DTEA 1ALQA 1S6RA 3IWQA 3F23A 1YOUA 4MEXF 4KT6A 4E3NA 3NAUA 3DNGA 3H9JA 4YINA 3WTSC 1PWUA 2XAFA 2V4BA 5EOEA 2ACJA 1LVKA 3KLOA 4DGWB 3OSFA 5CVUA 1MBFA 4P87A 3OBFA 3VYRB 5LFAA 2OZUA 4L63A 3X2QH 3MKZA 2JC7A 1NYYA 3P5JA 3M3YJ 2IWBA 4HP9A 1YRNA 1K57C 5AQ9A 4EUZA 1ROSA 4I35A 2L7MP 4IRHA 4YIFA 2F2EA 3F8FA 3SEZA 3HHHA 3UNGC 1YITI 2RN7A 4ESJA 3CUEC 5DS9A 3WWXA 3WE2A 1CEGA 3LI9A 3IAS2 3I56I 1H3QA 3NCKA 1BKCA 5J6XA 3G4PA 4WYYA 1XGOA 5L8MA 4PUSA 1R22A 4MNRA 3SS5A 4CJNA 2KRCA 2DW4A 3I0TA 1W4MA 2IS1A 4MMNA 4LENA 1TVIA 4XBHA 4F3LB 1CK7A 3KE2A 5DTKA 2LB5A 2XPUA 1D8JA 2VK3A 4DJ2A 3EDZA 3W2VA 1DQUA 3DCFA 1BZAA 5HS7A 3OR1C 1HQCA 4E7KA 3S22A 2BLSA 1P7IA 1K56A 2DN0A 1HF0A 4E7IA 4IBRA 2NUPC 5LHHA 1D3YA 2W57A 3KYEA 1OCCH 9ANTA 1YLFA 4MN6A 1XMKA 1LE8B 3S1NJ 3N2UA 2ELKA 1K25A 2BASA 3FDYA 4FH4A 3HOUJ 1GT0C 4XBFA 3DW0A 4YNRA 3WS5A 2D2WA 4IKFA 2QQ9A 2W7NA 5IYDJ 1ONGA 2J3TC 4FX0A 4HV5A 2GZAA 1BIBA 4ANJA 1F1ZA 1USNA 5DDGA 1U5TB 4ILWD 3DPEA 1LFPA 4AM3A 2JKGA 3CMEI 3O8HA 3GMWA 2WC2A 2XAUA 2ZD8A 4KQQA 2HU6A 1KVLA 2CUJA 5J40A 3LIEA 3ZR8X 4IVIA 3ISGA 2O3EA 4A5NA 1HBXG 3MFKA 3O6BB 2BV6A 3IF6C 3ELKA 3IWIA 5MC7A 1GUUA 3HEFA 1S6LA 3QNCA 3FMSA 2L9NA 4BDYA 1J75A 2P0WA 5FI7A 4DF9A 5ICFA 1YHQI 4L5EA 4HJ3A 2QLZA 1UHSA 1Q1HA 2CW0F 1USTA 1FLIA 3R7WA 2DYRH 4FQGA 2IA0A 2LY1A 4FT8A 3ZRGA 2OC6A 4C9YA 5JLWA 3K70D 2JKTI 2V9KA 4RAYA 3NHQA 4CCNA 3O8GA 4IF4A 4A3JJ 1JKOC 1JTDA 3LMMA 3FM3A 4GGGA 2ZQCA 2FJ1A 2P5VA 5JFRA 3CCLI 1E0EA 2DDFA 2OY4A 2VQGA 3VSKA 3TEDA 3PUBA 4E7LA 2E34A 3HIFA 1XGIA 2LKXA 3OYNA 2HR3A 1Z7LA 4NB5A 4P5OA 4CYCA 3HLFA 3DSLA 3NWTA 2XGXA 2JPBA 5DEQA 4E7ZA 1ON1A 2P9VB 2W3GA 5E2HA 1YLPA 2LDUA 4XKCA 3T4JA 2GDNA 3PBSA 4UVAA 1NG6A 2VGLM 2JRMA 2HP5A 4WELA 4E3OA 1JT0A 2PBYA 3BEBA 3PHYA 5L2FA 3GYHX 2YB9A 3AYUA 2JA7J 5FDHA 1L3LA 3CO7C 2GNXA 5F69A 4Q1LA 3VMAA 1XN7A 2ZBKA 5FI6A 4DDYA 3BR3A 3MQOA 1JIWP 5DCMA 4GD8A 1TLHB 2GZWA 5E1ZB 1B1BA 4PKUA 1DRMA 5FLVA 2O36A 4PKTA 1MBHA 2J7VA 2W84A 1SLNA 3F18A 4C3JJ 5FFXA 3J7YJ 2PD8A 3CDLA 4XL9A 2KZVA 2UV0E 3D4FA 1A35A 1UTZA 4H2EA 4OP5A 4PGHA 5KHDA 3HOWJ 1TDGA 1WSUA 1XJ6A 3IF6B 4QPRA 3CMAI 5HAPA 3O88A 1G05A 2XUBA 2VE9A 4IEDA 2DW1A 2MBFA 4FXYP 2L2OA 2O9BA 2EA9A 4BY1J 4IJOA 3OYJA 4I76A 1T56A 3V7RA 3AG2H 2YU9J 2EB7A 1F9IA 3TRCA 1W7PA 4FOFA 2HQAA 2YKFA 2UUZA 2D1OA 3G73A 4XKVA 4P6ZM 4GR8A 3A0RA 1EUBA 5CKTA 5AIQA 2EFNA 4WUJA 4K0WA 4D7NA 3HLEA 3IS2B 3H9QA 5B1BH 4YFNF 3CPTA 4MFDA 4RAGA 1R1JA 4E6WA 3DAVA 2XPVA 1U78A 1ONVA 3EETA 4H0EA 5I3MA 3QHYA 4CO8A 5IU1A 2FFYA 2RV8A 3FXMA 2B18A 1OJ5A 5TBMB 5B1AH 2K2GA 2VV8A 4GR0A 3HJEA 4L5JA 2MFZA 3SH8A 5GPCA 2X9DA 3CMYA 1BIWA 2ERQA 1VQ7I 1PZOA 1FBUA 2XAQA 4XKWA 1LHYA 3IHBA 2N8RA 3K7NA 2HOSA 2LSOA 4KICA 1G4DA 5GADJ 4BE0A 2ZSHB 3WS4A 4MQVA 1BI1A 1SD4A 2L7FP 4W1UA 2PMUA 3M07A 3PIOF 3MXQA 4FH2A 3A4CA 2CV1A 4DYCA 3F8MA 5E1WA 2D45A 1MMGA 1TW2A 2ME6A 1ES3A 3PBTA 3BR6A 2VUMJ 3GXOA 2DYSH 3S1YA 4BQQA 1JWZA 3CDIA 3SH7A 2MJ6A 1WGXA 2Z33A 1TWGJ 2XGCA 4NC8A 1QMEA 1MSEC 2R7FA 3C7UA 1K78B 4RB1A 1FZPB 4RGRA 4D0PA 2C5WB 1OTEA 1FSWA 4L9GA 2B5RA 3UPNA 4GB7A 1D1CA 4GKUA 3FXKA 2MABA 4GDFA 4HNBA 1ERQA 1PP8F 3UE0A 5F1JA 3OC2A 1KUIA 3GTJJ 4HF2A 1TVFA 2X1DA 2O9LA 2DLLA 3J7AO 1R1UA 1CQTA 2XVCA 3NARA 4ARZA 4BS9A 3B8ZA 1MGTA 1W5DA 1PIOA 2L5QA 2V1DA 1U5TC 4KZ3A 3P9KA 1IYSA 1ZG1A 1YW8A 1V5FA 2LKSA 4Z2YA 3BFEA 2JKRI 1MMAA 3O5YA 4RB2C 3DF8A 1BKCE 3RIRA 4DPEA 4GFBA 1ACIA 1R6RA 1BT5A 1SAXA 2ZMAA 2ESNA 4JQFA 4EATA 4FUWA 2KRHA 3P98A 2H8WA 4YOFA 3I9V2 1AKLA 2R5ZA 1D8FA 2M87A 4BLMA 4B88A 4P0MA 4ZJ2A 3H82B 1HXDA 1R54A 1JKPC 1OT6A 2L9SA 4HX8A 3E6BA 4Y2FA 1HZOA 3Q9VA 5BQTA 1RRJA 2NS0A 3WV1A 3JR9A 2OQRA 1OCZH 1O3RA 4ZYEA 2ZJ2A 3CHWP 2X3AA 3ZP5A 3WGIA 4EWFA 4BQOA 1J9IA 3WE3A 1VQ6I 3HKZA 3RYRA 3F1PB 5IT5A 4L9JA 3LJZA 1P9QC 2WGVA 2ZKZA 3DEWA 4UAAA 2E1NA 3K70C 3ULFA 3ZQ5A 4IN9A 5J7EA 3KZZA 1VQNI 4KT5C 2O9CA 3FX3A 4GNUA 2P5LC 3BTIA 5BNGA 2OTLI 2Q8KA 2E8JA 1IN7A 3VB2A 1Y1WJ 2JA5J 4MCWA 3HL2A 4KZ8A 1XUDA 5CQEA 4XIDA 1MSFC 2CV0A 1MMBA 4PJ0C 3K3DA 1U6GA 3HRUA 2PR6A 3SOIA 5TJJA 4G3VA 2XDVA 3BCAA 1XFXA 3NEUA 2WKIA 3GTPJ 3D1NI 4PDKA 2V8CA 4L9VA 2QMIA 1BLCA 1KQ9A 3PO3J 5HL6A 3DWLE 1WJFA 1RR8C 2XDMA 3HL9A 4KG6A 3KZYA 3JRFA 3S32A 1SZVA 3LIAA 5HPFA 830CA 5CVIA 2ZL1B 1XP4A 2EBIA 4HI4A 3VP2A 4PKVA 1BBYA 1FCOA 3PSIA 1TNSA 2J9OA 1O7EA 2XHKA 2FV5A 4OLDA 2DOEA 4RM2A 3M9AA 1XUCA 3FXUA 1QBJA 3AG4H 2JK3A 3BECA 1XCBA 4GLQA 4RYEA 5M1AA 1RZ4A 2LOOA 3I54A 3BCBA 3I5UA 4IUKA 1PWWA 5E18F 3B47A 2E5NA 1MBLA 1LE8A 1ZC2A 3WTWC 3W3CA 1MJAA 2ZCWA 3GFLA 3RYPA 5IS1A 1MMPA 1NLZA 2CW8A 2CUEA 1FBQA 3DFGA 1IYQA 4P9UA 1N9LA 4DE1A 4I09A 4UB8C 1UAAA 4A3MJ 1R55A 5H2FC 3L0TA 1OFCX 5KK1A 1JWVA 1P92A 4OPZA 2H1KA 2PAVP 1FY7A 1PWVA 1S4RA 1T8IA 5IP9J 4JP0A 3T5XA 1H0MA 3ZQCA 1FOXA 3UR3C 4BMWA 2HGCA 3CCYA 4RB0A 1XGNA 1VQ9I 2B9SA 1FCMA 4DNCA 4ITVA 3AL0B 4XLEA 2FH5A 3FV7A 1MW7A 2KIMA 4IHWA 4FD8A 2WB1N 4FTXA 4R70A 5L10A 3TBIA 4Y5FA 5DKKA 3NULA 4UUSB 3LKAA 3Q82A 4IUHA 5CVRA 3LILA 4A2UA 1IRZA 1JWPA 4AIKA 4OMYA 5CLSA 4Y3IA 2FQ4A 5GLBA 4G6TB 2A68F 2NNNA 2D1HA 3F22A 4HLYA 1ZTQA 2WO9A 4ZH4F 2O8KA 3H9GA 1I39A 1Y28A 4MBKA 5EVLA 2M0MA 2VJWA 2W25A 1PUFA 2JVHA 2GA1A 5EECA 5F68A 1YJNI 2LVSA 3IV5A 3G2YA 3NQOA 3PYPA 1ZVXA 2QCOA 4JF4A 5I0LA 2H0TA 3W2ZA 1CXVA 3LSIA 2FZ0A 1Y93A 3HPHA 4BWIA 2HPIA 3QOPA 5K5RA 5EVIB 1QQIA 1WRJA 1O3SA 5IYCJ 1WQ2A 1V9ZA 2ZC7A 2RQPA 1WJBA 1TQIA 3KPHA 2KOIA 2PHYA 2PD7A 2ZC5B 5EGOB 4EBLA 2V1AA 2DW2A 4HX3A 3IXBA 3ZGAB 1X19A 3ESWB 1XSVA 3MD2A 1VQKI 2KHMA 4QKZA 1U0JA 3G32A 5G4ZA 1ZGJA 1ES2A 2W1TB 2QKPA 1OTIA 4MIMA 1G49A 5KAFC 4DOZA 3AAFA 3GDIA 2JIHA 3CESA 3S17J 1FEXA 3LCEA 1O57A 2R7OA 2XPWA 4BXFA 3FZVA 4RDUA 1REPC 1ETOA 4LV0A 4Y0UA 3GEZA 3VEPA 2M2EA 3ZMUA 3ZMSA 3L9KA 2WV0A 2FA5A 2HP9A 3FKWA 1Y8QB 3WS2A 1I1GA 2QSHX 2EXAA 1S7OA 2MD0A 3HUGA 3CC7I 2WKRA 4HIAA 4Y7PA 1RMZA 3A1YA 4XXRA 4L9EA 2PJPA 4QWQA 3V39A 3OYMA 4KZ9A 3ZQIA 1RKWA 4BY7J 3HTSB 5L3GA 5J1UA 3BTJA 2PBIA 2RNJA 2P5KA 4FETA 4KJZA 3VPRA 1JAOA 4C2MJ 3CLOA 3FXQA 4A6DA 3W6KB 1W36C 2K9NA 3MZDA 5HDCA 1SMTA 1SLMA 1SD5A 4XRMA 3OV8A 4BGDA 2G0EA 4DD8A 2K85A 4ENJA 1E2XA 4KZ4A 3TKYA 1UWNX 3MR0A 3O3KA 3FK6A 5F64A 3DEEA 1HV5A 1IV6A 2E1OA 5JYPA 2QQBA 1E17A 3GVBA 5E17F 4JXSA 2F5VA 1BQQM 1TDLA 1QRYA 2PU4A 4MFEA 3KEKA 3LGPA 2OWJA 1PJRA 3CJRB 1ZREA 1S67L 4R3JA 2HTSA 3IKVA 1K0KA 2BYVE 4GO1A 3OYIA 2ZL1A 2EIMH 4MLLA 1SDNA 3KSHA 3G30A 1XJ3A 4EBNA 3C4PA 2ERPA 3OYDA 4ZC3A 3LR4A 3TP3A 1H88C 3OMYA 1GSWA 5IP7J 5DF7A 2QYOA 1Q2QA 1OM8A 3FMQA 3KMCA 3C18A 1JAPA 1T98A 3CUOA 4H3XA 1SD7A 2COBA 1EAKA 2YPRA 2A24A 4ZZLA 2M7UA 5HSQA 2VV7A 4EMSA 1GSVA 4HH2A 3R7WB 4WMCA 2PJTA 2Q2EA 3D5RC 2K02A 3Q2HA 3CZ6A 3FISA 4M6YA 5CEBA 5TGFA 1O7LA 2R7TA 3BG9A 3HC7A 2WKHA 3CC2I 2DDBA 2O7OA 4ETSA 2HYFA 3G1MA 3PBRA 4XONA 1UJ8A 3V50A 1IV8A 3PBQA 2DA2A 3GW2A 1I50J 4AU7A 5F04A 3VOEA 1RCJA 1VETA 3MZ8A 1IYPA 3GFMA 3UDFA 4JLFA 1VNDA 3K1NA 3E6CC 1JTXA 1IN6A 2B63J 3IX8A 3T4LA 1O3QA 4DXBA 1X3WB 4AUXA 4X55A 5FEFA 1XFWA 3BR0A 3HRMA 3A3JA 3KYQA 1HOMA 1UG2A 3OZHA 4FCFA 4GF1A 4R38A 4DZJA 2KKOA 3HG9A 4HSRA 4KN7X 4BH9A 3LI8A 1Y4OA 2K9MA 3GZNB 4XSZF 3FYZA 3HKZN 2RDPA 2HFHA 1OCTC 1TS8A 5FSRA 4DE0A 4WWCA 1Y39A 3PAEA 2NVYJ 1DP3A 1WJEA 2RL3A 2BHYA 1BR2A 1F4KA 1IKIA 3L7HA 1B72A 5CERA 1KE3A 3AYKA 3G1LA 1MY8A 3HZJA 3LYXA 1OM7A 2E1MC 3DWKA 4LLLA 2XB5A 3CJTB 4KISA 1MBGA 2ZC6B 1WNIA 3KX0X 3LR5A 4YFKF 4HJ4A 5HLTA 3J81Z 2HDUA 4GYIA 3B3XA 3H3ZA 1KUHA 4L5IA 5HVQC 2DRWA 3TT4A 1Z77A 3F1NB 2CC1A 2I72A 1AF0A 3LMCA 4AXQA 5DFYA 2R7SA 2INWA 3FPVA 1STZA 3U21A 3TW6A 2R7VA 4XMYA 1QPIA 5EOOA 1FCNA 3H36A 5EVEA 3KYLA 1BZSA 1N9BA 1VETB 1YIJI 3P1VA 4G8XA 3PTEA 2VLAA 1EA3A 1XTAA 3BR2A 5CEDA 2I47A 1K83J 4Q5SF 4OLGA 3S1QJ 5B66C 2HI3A 1HW5A 3E8RA 1W7PB 1XKZA 1ZRFA 3KSIA 2QBYA 1Y54A 2D02A 5GLAA 3CDHA 3BRMA 3VOYA 1ZLJA 1IABA 2XR0A 2JKTM 4HZFA 2R7XA 1SMYF 3E6MA 2GIZA 4ZYHA 1KGSA 3HOZJ 2Q0OA 1L2SA 2K7SA 4BL2A 5AQ7A 3MZFA 5K5BA 2OXWA 3HTUA 3TO9A 2JCHA 2YUSA 2EH3A 2ZXWH 3E3VA 2ZQ7A 5TBMA 2W12A 2XKOA 3I7GA 1X1PA 3HSFA 4NUBA 3BW6A 2ZFUA 3K4NA 1LSXA 4S0HB 1Q2PA 2IT0A 2X6WA 2R7WA 5A2QK 3ZHHA 4WKEA 3T8RA 1BULA 3C5AA 3UY6A 2HQNA 3T1RA 2IGNA 2EV6A 4S2JA 1GV2A 2X4HA 1H8MA 2FQ3A 3UB5P 4DE3A 3GTOJ 1R1VA 2V0UA 4GS9B 3FIWA 1OCPA 1Y6IA 2EIKH 1B3DA 2P6TA 3GZ5A 5HPIA 1HDDC 3LR3A 5ED4A 2R7ZJ 1PWQA 5CGXA 4PKQA 1LVAA 3L0VA 1O7FA 4X53A 2I9VA 5G18A 2MLSA 1QGPA 4DN0A 5JHFA 1KUGA 2XF7A 2HVSA 4IO9F 3FBIB 3L2RA 4M3DA 5HS8A 3WU1B 1BR1A 5M19A 4KITB 4OVDA 3MN2A 2WOAA 2CUZA 4TV7A 3CWFA 4GHIA 4MGRA 3KP5A 4KYWA 4C2TA 3SJMA 1K4EA 5GHXA 3DPUA 1FOFA 2HDQA 3MF0A 1O0QA 3G5CA 3QP1A 3TJZC 2WUQA 3QYEA 3Q0VA 3IAM2 2FBHA 3HGGA 5M5XJ 3T1XA 3F8BA 4AYBA 3DV8A 2UV1A 3L2QA 3EQVA 3ERMA 3RKXA 3GTKJ 1W8QA 3USNA 1QHGA 2ZFWA 3QU6A 2X6YA 3E2LA 4KN4X 2J3TD 2O8XA 4JXGA 4KA4A 2W3EA 3Q2GA 4GWNA 3O2PE 1Y8JA 1IC8A 1UMTA 3FXOA 5D1UA 4XRFA 2A07F 2XS4A 1HOVA 4BE1A 1YO5C 4KZ6A 3H7WA 3OPRA 2W1TA 1CAQA 4QIWN 3FZCA 1HVBA 1KQ0A 4HQEA 3GTCA 3C7JA 4CYDA 4II2A 1KOUA 4S2OA 3O2XA 3KSFA 3DBLB 3LQQA 2DT6A 3JVVA 5EJCA 4X69A 1N75A 3QQAA 3S7PA 2M45A 1VQ8I 3WS0A 3CO6C 3CCMI 2LF7A 3EHXA 3N4IA 3T4KA 1Y0VA 5D5XB 4G6DA 2OZ6A 4F7ZA 4IRGA 4BQNA 5J3LA 1IAWA 4NKPA 1J7KA 3T8TA 4DJAA 2Z2MB 4I99C 4YWZA 2LYCA 3GV9A 2PMHA 2VBZA 2HOTA 3PNVA 1OMEA 4HBUA 1SATA 1ZKJA 1QPMA 3EEAA 2DQLA 1B59A 4R0QA 1MJ9A 4JA1A 2JKRM 2I5UA 3I58A 4PM7A 2H09A 2EV5A 2VEAA 4K2EA 2ZM8A 5FAOA 5FEGA 3VFHA 3N2VA 3QP4A 2JZYA 1PWPA 2O3FA 1OT9A 1NZUA 2A5YB 3RQ4A 1Z3XA 3C7VA 4WN5A 4RM3A 2OUMA 1CF7A 3MFDA 4IQJA 3TDZC 4EEPA 1PVEA 3A0VA 4BENA 3QPLA 1P7JA 1UWPX 4I3JA 4E7HA 2F5DA 4JKTA 1Q3AA 2J5OA 2M9HA 3P7NA 1J3WA 2Z1DA 2MLGA 3T4SA 4NK3A 3AKZA 4P9FA 2XV4S 3LSKA 3DWBA 2WKEA 3KYZA 3VOLA 1GKDA 5B5PA 3T12B 4CZCA 2ZOIA 4XCTA 5LHIA 4B3AA 4M71A 4LJZF 1NWZA 1A5JA 2EXBA 1OKRA 2K9LA 3OY9A 3W4OA 4U7BA 3GZ6A 3UB7A 3I4PA 5D4SA 4I3IA 2AHQA 2FMLA 1UELB 2JJ7A 1SMPA 2ZMEA 4GRIA 3A0HC 2MYSA 2A6HF 2BOLA 4LIVA 5EVIC 2VIXA 3RZDJ 3W4PA 1W63M 1U8BA 3UB9A 4UHUA 5CUHA 1LL9A 4Y4RA 1CF7B 4PSXA 1DTHA 1TZLA 4MTEA 1PP7U 5D8LB 2JTVA 4WZVA 1KGFA 2DJNA 3UE3A 1VF9A 1XFNA 1YQYA 1T6SA 2AQEA 2ZXHA 1R4MB 3MWMA 1NZOA 1H8ZA 1JIZA 4U0WA 4G7HF 3JRCA 1YIOA 5E3MA 5EGOA 1YSPA 3FM5A 1MC0A 4GQLA 2HF6A 1ODVA 1HSJA 4ON0A 5IYBJ 4EETB 4QY6A 4H76A 1PW1A 3I59A 4HY8A 2IP2A 2X51A 3BPVA 3F0CA 2JUCA 3LJTA 5KAIC 1U2WA 4WK8F 3G35A 2SRTA 1W1WE 3HM5A 2V1XA 1D8KA 4BNCA 2JN7A 5D5VB 1AWCA 1W5SA 1GHCA 4ENMA 1HTDA 3T0YA 2R3SA 2CO5A 1F5TA 3Q0UA 4ZR5A 1PUFB 2M1CA 3EOIA 1IXSB 3IX4A 4BBUA 4JIJA 4J00A 3LFKA 1DPRA 1KU2A 3RCOA 2F6CA 3JPUA 4B09A 1GCEA 3T1SA 1S1ZA 3MVPA 2ECBA 1NH3A 3REOA 5L3DA 3I7IA 5DM7F 1JJ6C 4IPAA 4DE2A 4JOMA 4HNTA 1N9NA 3F1NA 1TWFJ 3N8SA 1HKTA 1TP4A 3NWSA 2QKLB 3B6AA 1Z1DA 3PQKA 1QUAA 1HTZA 1I6XA 3NC8A 1K7AA 2MA3A 2OBPA 5DCFA 3GECA 4H6JA 3BZKA 5DFXA 1K78A 4M4XA 3OPPA 3L2VA 3JRIA 4HQMA 3CCVI 4HH3A 1HFCA 2O6GE 4OIQF 2IS4A 1IAGA 4X0GA 4BL0B 1RGYA 1QZYA 2PU2A 5ERIA 4OWRB 4FVLA 4IUWA 1UB9A 3BQZA 4HAMA 4BHCA 5GPAA 4ESBA 1I3QJ 1DJAA 4F92B 1QHHD 2RVCA 2F4OB 3U2RA 3N05A 2OTJI 1GSXA 3Q1FA 2E2IJ 3RJUA 2JT6A 1JUSA 3H5NA 2OU2A 4EM1A 5FQQA 3S7OA 4FISA 4CPKA 3AIGA 1EF4A 4XLFA 4L7AA 3RXXA 2H94A 2VODA 4KQRA 3M1CA 4GWMA 3FWEA 2L0RA 4IZZA 5F0CA 2H28A 3B92A 4L19A 5JLXA 1TL8A 3WV3A 2Y91A 2DMUA 3BR5A 3KEQA 3VOZA 4G0DA 4U0YA 4OU0A 4IOCF 2WYXA 2G2WA 4LV3A 4UA6A 2Y0MA 4KG2A 5GLCA 5F82A 4C3IJ 2FE3A 2HVQA 1MZBA 4Q47A 2QWWA 2IWDA 3FKVA 3M6BA 2E19A 4Y52J 2PEXA 1LKXA 2HV1A 4OPQA 1KU9A 2DAOA 3CP8A 4HNUA 2QWSA 3JVUA 5E43A 5HL1A 2HZTA 3NRVA 1CIZA 4M6XA 1K6SA 3FWLA 1N25A 1GE6A 3C8CA 3CJMA 3G6OA 3Q07A 3NI9A 5I4OA 1I3AA 3BJ6A 2JSPA 3K4MA 1UZCA 4GYGA 3E98A 3MSHA 3KRYA 4E70A 4ZTKA 2QGUA 1FIKA 4JGPA 3F6VA 456CA 2R7RA 5AVEA 4XM6A 1S8NA 5GL9A 2XB0X 3RH8B 1W5TA 3F17A 3VI1A 1Z09A 2LY9A 2Y2JA 4U0TA 4A3FJ 4RX3A 4ZAMA 3SFZA 2LH9A 1YJ9I 3MKEA 1JNUA 3KECA 3OWTA 5EEGA 1ORKA 4A3IJ 4XNFA 1KONA 1BSGA 1JH1A 1LEAA 4DRTA 3PUFA 2ZOHA 2ECCA 1W36D 1O4XA 1QVTA 5FKNA 3H1CA 3B73A 5EDNA 1PWCA 1PZPA 1YI2I 3H7WB 4WX9A 2STWA 2M8GX 1ATLA 1FSHA 2Y0SA 4I7HA 1MBKA 2EILH 1YX3A 1O3TA 3A2KA 3C2BA 4X1EA 4KUMA 2V0WA 3RFBA 5LEJA 1PRQA 3GMEA 3CP2A 2XRNA 3W2AA 1PI4A 5DJUA 1C3BA 1YS7A 1IXCA 4YEJA 1F2KA 2E8IA 4HX7A 4JX5A 2PFBA 3JSPA 4I98B 3TSKA 3UNWA 3T4OA 3V8JA 1NLYA 1YX5A 4XSXF 3LQ0A 2VJJA 4G9LA 2L1MA 3GWZA 4M3EA 1SU3A 1WHUA 4FASD 1A6IA 4PK4A 4JGOA 4IBXA 4KZBA 2NVTJ 2QPJA 2LMDA 4CCKA 4XM7A 2DXIA 5EUAA 3J7ZI 2IPQX 5L79A 4HYEA 1QZEA 1Z3YA 1FTTA 4CCMA 4EQQA 1XGMA 2Y2QA 4R1GA 3T1BA 4A6EA 1ZG4A 3LIFA 3M6HA 3MBZA 5FQIA 4X56A 5CVVA 1J5YA 5DVAA 3IH3A 3W4QA 4L9NA 3PO2J 1ACFA 2OAP1 4ZJ1A 2MLRA 2VOOA 3EQLF 4BXXJ 2J5PA 2N8GA 5ICEA 1XMXA 2L3DA 3MZYA 2VPLA 1ITYA 4R4SA 4BHPA 4RA7A 1T08B 1IZ1A 1WJCA 2NOJB 3KX2A 4G6QA 1K6OA 3K9TA 3S3OA 4P6ZS 1G3TA 1LT0A 3G42A 4LLNA 1YFHA 4ZTFA 3G34A 4CQHA 3VFFA 3MKLA 4ABZA 2FOKA 1LFBA 2KT0A 2UXNA 2BW3A 2W24A 4AVZA 2B95A 3BLMA 1AHDP 4XM8A 2YSRA 3QPTA 2EWNA 3KP4A 3C2HA 2YX7A 4N9KA 2YUFA 1YG2A 2AO9A 2E2DA 4HX4A 1H5XA 1FBLA 5FA7A 1UEAA 3N8RA 1UGUA 5HWWA 4N4NB 4LB5A 1OS2A 3HSEA 1B9MA 3IRRA 2OVZA 3S2WA 4C2UA 2A24B 3DPTA 2Y2NA 3ASOH 3K4CA 1MIJA 1KZHA 1VI0A 2BY0A 2BGCA 2DA3A 2OV5A 2DW0A 3LWFA 3MXRA 5L07A 3PIPF 3OHOA 4QPOA 4BUPA 3BZ6A 2QKMB 4ZDXA 1FWZA 3LQBA 2V79A 3LE9A 2VZWA 5HS9A 4B48A 1F9NA 1KAPP 3VYUB 1FC3A 3LIDA 5AQAA 3UE6A 3L9FA 2O5RA 4WLAA 1QJIA 2IVMA 3G71I 4DBRA 3U1KA 3H3VK 5F5YA 3K4JA 1TT5B 4OINF 1RUOA 1MWSA 3PAGA 1NHAA 5A91A 3LIRA 1MKIA 3DP7A 3V3SA 2P04A 3HVFA 2HWVA 3IUOA 1BIAA 1IKGA 4M3KA 1D0YA 1XG1A 1BLPA 2ZJ9A 4A3CJ 1FT9A 1UHMA 5IOYA 3HCYA 2Z3YA 4UUTA 3UVCA 3IH9A 2DQRA 1Z0XA 1TC3C 1X4OA 3LA7A 3HBLA 2DA4A 2HNHA 2MSYA 4BBTA 1EH7A 2Y2MA 4CDGA 4ESFA 5B3SH 3EUAA 2H1LA 1BOAA 2XASA 3NDGA 4X1LA 1GA9A 5I5LA 1IN8A 2HTJA 3OOPA 1LDDA 1NRJA 3C30A 2VE8A 4ZBEA 3J7AY 1BW6A 3QAHA 4GOGA 4LOCA 2ME0A 1AU7A 2DA5A 1JJ9A 5LEKA 1W7PD 3OYEA 1ZR2A 1RI7A 1HDPA 1J2XA 1XCVA 4Y3OA 4B4CA 2Y9YA 5JVGF 5LRSA 4Z6YA 1G59A 2GM4A 3W2WA 6PAXA 1A0KA 1XMAA 1EW0A 5K7FA 3BFDA 3CITA 1TT0A 4XUZA 4G7ZF 4C3QA 4C3HJ 1I73A 1B6AA 1ETXA 3MA2A 3OYKA 3OOVA 3VDXA 4AIGA 3FBNB 1B8IB 1VEUA 1KUKA 3HUOA 1R7JA 1ZTRA 1KE0A 3KP3A 4L9FA 2K9CA 4LCMA 5FI2A 1UFMA 2G7UA 2PMZN 4YIIA 1ERMA 4HEFA 1QJJA 3K7LA 1FX7A 3CMMA 1X1AA 2OOLA 4Y15A 1HW2A 1W0TA 4KQOA 1W5CC 4ZRRA 4E6XA 2KDKA 1B4AA 3HUGB 3BWLA 5EM0A 4PM8A 2CGPA 4N9IA 3QYBA 3KEOA 2JT5A 1WPKA 2VKEA 1BC8C 2HKXA 4XOPA 3LIBA 1W7FA 3RQIA 3HJIA 1XD7A 4D7MA 1DDNA 3KYDB 4LG3A 3PQJA 3HYIA 3A02A 1IO2A 3EUHA 2GIVA 5HOOA 2CV2A 3M2KA 4H6JB 3FXJA 4AC0A 2CRGA 3D0SA 3BJNA 1SVLA 2VGLS 4X68A 5F0FA 5A92A 4UQIS 4BBVA 4LCLA 3JCUC 2RJQA 4PM5A 1WJDA 1VQQA 3EUHC 2ZC4B 1IGNA 2R5YA 3ZG0A 2K4JA 1H9TA 1RC9A 5EV0A 3UPOA 2X02A 3DWZA 5J47A 2XD5A 2ADUA 3P9IA 3GSGA 3OHLA 2I8DA 3L2UA 2W15A 1QA6A 1YKDA 2Y2LA 1GV5A 3TP0A 1JUPA 4EEFG 2V9AA 2FXAA 3HXLA 5E8IA 5L3CA 1IW7F 3OSGA 2XFSA 3EQUA 3AFHA 2W0NA 2VI6A 4LRYC 5H8XA 3CUQB 2HS5A 1ESIA 5ILVA 5HDSA 1ZG5A 3MQ0A 2A5WA 3GLLA 1ZR4A 2A61A 3A0SA 1KE4A 1YQAA 4M9XA 5AQBA 4HQAA 4B47A 3K3CA 2E2JJ 2XF6A 4AWXB 4WXDA 2HPMA 1TEMA 1OZ9A 1L0EA 4NBQA 3HB9A 2VT3A 3I55I 2JWTA 2K7LA 1EI5A 2IEKA 2M7VA 4P85A 3GBOA 1ZN2A 4S2KA 3BPXA 5F83A 1IXRC 4PMAA 2NRAC 5LHGA 2HJ9C 2EIJH 1XFZA 1EROA 3A3FA 2YIGA 1JKYA 3BR1A 3V5MA 1PWGA 3HBVP 3I3LA 3EDPA 3WV2A 4IOAF 4G12A 5ILSA 4O5VA 4OPRA 4HF0A 5IY5H 5JI6A 3ICYA 4A5RA 5KSCA 2OW9A 4EFSA 1WWXA 1R5HA 3OS0A 2YU3A 1H8AC 4OOMA 1I1IP 1L0FA 1XFYA 2OQGA 3ABTA 1M40A 1K54A 4PM6A 1XDUA 5E2FA 5FQMA 3ZVWA 2BEOA 1O0TA 2Y2ZA 1E3OC 3IHUA 4XR6A 3MKYB 2Y2PA 5CYVA 5FKMA 3V7SA 2P81A 1BN5A 1U9NA 3OL4A 1ZK8A 4C30A 3OYHA 1KU7A 2W3HA 2KDZA 1LNWA 1CI8A 1FNNA 4ID4A 2RC4A 3PBNA 4LB6B 2WY7Q 2ZJRF 5EG0A 4FTHA 2HEOA 1CJFA 3PL8A 3WHBA 1KDSA 2A49A 4V2FA 3FPWA 4GDNA 2PJRB 5CQGA 5K7HA 5EYRA 3WGHA 1T18A 3RZOJ 3L2CA 3EUKL 2W00A 4S04A 3FKIJ 1C8TA 4YELA 2DMWA 3U4LP 3DBRB 3IHAA 2V9PA 1L0GA 2FRHA 4I5SA 5J8FA 2LD5A 3A3DA 2E3XA 2P7VB 3LEAA 3BQYA 2A05A 1PWDA 3BG7A 5FQKA 2ZSIB 3AGEA 1BSWA 3MQQA 1KYWA 4XLAA 5AIPA 2AIGP 2D1VA 4CLCA 3MZEA 4PKYG 4F94A 2LREA 2NAZA 4MLOA 2ELHA 2PI0A 4HBTA 1RPWA 2Z2SB 1Y56A 2Y2KA 4RMNA 3ZG9B 4I0BA 4CCJA 2GXGA 3HDDA 1YAXA 1QVUA 4HESA 4R23A 2VJ4A 4H49A 1X58A 1YLWA 4U87A 1R71A 4RB3C 1TD5A 1ZG3A 1I2SA 3GCMA 2EZHA 1Y0UA 2HDWA 2QA4I 1WYBA 1ZARA 4M73A 2XLNA 4GJ4A 3H5RA 1P4WA 1Y0NA 2VPRA 3LY3A 2KL4A 5F08A 4HJ6A 4DMZA 2HXOA 3TOBA 5FQJA 2JN6A 4UY8I 4JPMA 1N4OA 2A69F 2LK2A 4F3QA 1T1CA 2P08A 3HLGA 4Q8IA 3LL7A 1R1TA 3HLCA 3T1QB 1ZP5A 2V26A 3DPLC 3BJOA 3H35A 4A3LJ 3QYFA 1CQRA 1F43A 1G12A 2KRJA 1MNEA 1VHMA 2Y2GA 4EW7A 4DBQA 1YW7A 3VYTB 1J0RA 3D5LA 5L3EA 5HD5A 4XT2A 5BOTA 3T50A 3V67A 1MNCA 3QP2A 2RAEA 2DMQA 5J1RA 3OS1A 1JJ8C 1OTBA 2CUFA 2H6BA 1R49A 1CI9A 1BM9A 2OF7A 2WZXA 2BHZA 2RGVA 3AG1H 1SCWA 4FE4A 5HDKA 2EWWA 4AYKA 1VQOI 5GHYA 2A8HA 3M1EA 3KMEA 3ZMVA 2PLYA 2QQ8A 2K31A 3GFIA 4LRZE 3ASNH 3LFVA 1C0WA 2R5ZB 2OW0A 1Z9CA 5F6AA 2DCEA 2QZ8A 4UHTA 4D9JA 2Q9MA 4S2LA 3EDHA 3HHGA 4GN2A 2Q1ZB 1VQ4I 2XAGA 4MO7A 3WTYC 1K4TA 2LB9A 4IVKA 4J4MA 3WGGA 2K86A 2KX6A 2EWVA 4XORA 3O3VA 5TRDA 1K57A 4UUVA 3H0GJ 2Z5UA 5DJTA 4CZZA 4S05A 1ZELA 3BFFA 3F16A 1X3UA 5EF6A 5HDNA 1BYWA 4RVAA 3ZXHA 3LJGA 1A6QA 5C4XJ 3ZCOA 2V9VA 4BQAA 2M1BA 4RA2A 1XA7A 1KYZA 2PMZA 4ZDOA 5EZGA 1MMDA 2G2UA 4D5FA 4BDZA 3FHNA 1SHVA 2F4IA 3SZPA 4CSWA 1RESA 2BVLA 4EJVA 3K0LA 2E5ZA 4YFXF 4ASNA 2H27A 2ESHA 2Y59A 4EQIA 3SYTA 3OLOA 5BMZA 1P4AA 2I10A 2K9SA 2EROA 1C7KA 1RNLA 1XJ4A 2Q2EB 2DMTA 2LKPA 4M74A 3CD6I 3ZG5A 2HXIA 2OA4A 2H5SA 4LLOB 3K1MA 1MH4A 4GUYA 5AJGA 1AA7A 2HOAA 3ZQGA 1SEUA 2X6XA 3Q5FA 1P6RA 3GRJA 1BUDA 2L9RA 1E4DA 1Y1VJ 4JK1X 5J8CA 4EQ1A 4IRIA 3IF5A 2FNPA 3EDGA 1IRFA 1BI3A 1ETVA 2Y8HA 3V7CA 3E4QA 2P9VA 3PNTA 4M3FA 2VKDA 3RKYA 5J1YA 5FLXZ 2FD5A 2OXZA 2JE5A 2AS5F 1IUFA 2HGVA 3NOTC 5CVJA 2POJA 2EFWA 3BDDA 5HX9A 1IJWC 3R6SA 1A36A 3ABMH 3I64A 3S3MA 4LD5A 1T2KA 1D5VA 4NETA 2VKVA 1IF1A 2W14A 4JBAA 3TG9A 3ZPLA 2VASA 3F15A 3GUDA 2VXDA 4WZ5C 2K27A 2DTRA 2XC7A 4BQMA 4C75A 3DBHB 4N92A 5HD3A 5E20A 1MH3A 2E71A 3K69A 1HKSA 3TGNA 3DLLF 3LICA 5EE8A 1JK3A 4MQ9F 4ZYAA 4AUOA 5HNHA 5K1YA 1HSTA 4DZPA 4CUGA 2IWCA 1HFSA 4U0VA 2MZHA 1SVOA 3IKTA 2JBFA 4ESPA 3KP2A 1VFCA 2GLOA 1JAQA 4CYCB 1JGSA 4L9TA 2QUFA 3M2JA 2Z99A 2LY2A 2NVXJ 3HY9A 3GFJA 5F0HA 5C4JJ 1D1AA 4ZDPA 5FL3A 3RTYA 1X1BA 3MKWB 2R0QC 3WHCA 1KVMA 3IBRA 4S2MA 1XAXA 2V1ZA 2ZLYA 3CF5F 3ZVTA 3B6CA 2QJ5A 2ZXIA 3NBLA 4GZBA 1SC7A 2KIUA 5KIZA 5GP9A 3BM6A 1UMSA 5TFQA 1ND1A 3HOSA 2R7DA 3ZNTA 5DF8A 1FR6A 4NXGA 1ZQ3P 1I27A 4LG0A 2VONA 4EUVA 4UB6C 1HCRA 1FOWA 3OYGA 2R7UA 2VX8A 2DA1A 3LY4A 1BLSA 3RTSA 3LIKA 5D1TA 1BJAA 3K6GA 2UZKA 1DP6A 2XAJA 5FFZA 1VQPI 2DFIA 4LLGF 1KU3A 4OQGA 3IL2A 3SS4A 1BL0A 2STTA 1BW5A 1TF1A 3MKFA 3N8LA 3Q3SA 4HDUA 3FG8A 4BEHB 1PNEA 4CLCE 4AIJA 3CKIA 4KENB 3DTIA 5LLQA 1LI9A 3BLSA 1ZS0A 2MH2A 2W1RA 2XD1A 5KMWA 3QP8A 2DDYA 4PKSA 5JMYA 1V4RA 3LSJA 2KMUA 2VC1A 5IT9Z 4X1MA 3HUMA 5B5OA 4UXNA 4MNUA 5ICGA 4G3KA 5J4YA 1DP7P 2VL8A 1X1DA 3FXLA 4HBLA 4XN0A 4PM9A 1FLSA 2PDRA 3RPUD 3GF2A 4EV0A 5BPAA 1YMXA 2OW2A 4OAYA 1J7NA 3VFZA 1SFOJ 2DFEA 2Z2DA 1OR7C 2ETHA 2R78A 1DUXC 4IJAA 5HDGA 2B7EA 2NS8A 1FMWA 4V2GA 2EFQA 1S9HA 1USSA 3OL3A 1FOYA 4E6KG 2XGDA 2YR2A 2CW7A 2FSWA 3COAC 5BOXA 2M4KA 3ZXSA 1MMNA 2OCCH 2AVXA 3N97A 2OLVA 1FP1D 1OCRH 2CSOA 2IGMA 1RGZA 2K2NA 3BT9A 2KPMA 2ZQ8A 3B2ZA 1KGEA 4LV1A 3ITBA 5DUIA 2BG1A 4I39A 2ZJPF 3ZYTA 2OPTA 4AIDA 1VB6A 3IP4B 4A3EJ 2HDSA 3B33A 2GOXB 2ZC2A 4PJNA 5GAEJ 5BPDA 4KMFA 2VJ5A 1IYOA 4Z9QA 1WI3A 1C3IA 3RTTA 2V20A
chains in the Genus database with same CATH topology
3K4MA 1KUIA 3KRYA 2RNGA 5FRMA 1D7XA 2X1DA 456CA 2R7RA 4XM6A 3B8ZA 5LABA 2KLOA 4BS9A 3HOTA 3DKXA 3PFYA 3F17A 1OS9A 2L5QA 3VI1A 2LH9A 1N78A 1V5FA 1I76A 4BJ6C 1D5JA 1MMAA 4II3A 3OR2C 3KECA 3OWTA 1BKCE 1PYVA 4DPEA 4XNFA 1KONA 1JH1A 1R6RA 1C8TA 1W36D 3AL0C 4JQFA 4EATA 2W0DA 2KRHA 2E1MB 3VSLA 1ATLA 1BR4A 2Y0SA 3I9V2 2IS6A 1AKLA 1D8FA 1YX3A 3A2KA 1RM8A 4I03A 4H4KC 2OXUA 2L9SA 3OIQA 3W2AA 3CP2A 1V5EA 3WV1A 1D0XA 2ELJA 5CXAA 4YEJA 2UWMA 2IGKA 1JANA 2X3AA 2BW3B 4XLCA 4BQOA 2GOMA 3H0DA 2AQFA 1YX5A 3BG6A 4LITA 1J09A 2VJJA 3HKZA 1KUKA 3LQ0A 1SU3A 4G9LA 3LJZA 4FASD 1P9QC 1R1IA 4PK4A 4J01A 3K70C 3HBUP 1ZXVA 2QPJA 4IN9A 4CCKA 4XM7A 2DXIA 3NX7A 5L79A 2KDOA 1Z3YA 3OIPA 4N4OB 4CCMA 2RREA 4B43A 4IX7A 2JA2A 3HL2A 1XUDA 5CQEA 2CV0A 3QODA 1MMBA 1WJ5A 2MLRA 1X4PA 4BACA 2XDVA 3BCAA 1XFXA 2VPLA 4BE2A 3EHYA 2NOJB 1WJCA 3KX2A 1XFUA 3S3OA 2PJRA 1EUBA 3G42A 3DWLE 1WJFA 3DLAA 4QPQA 4E7JA 1YP1A 1QIAA 1DGWY 4ZTFA 2V7FA 830CA 3S32A 2WADA 3LSGA 2A6TA 1Z3JA 4A7BA 4PKVA 4WKEA 4XM8A 2BW3A 4AVZA 1Z21A 3PSIA 1DGRM 1GKCA 5I43A 2FV5A 4RM2A 3C2HA 1XUCA 4F55A 2K3PA 1XURA 4PFPA 3K4BA 1D1CA 2YUFA 2LOOA 2E2DA 3BCBA 4CTHA 1UEAA 1VZ0A 4FXQA 4WK7A 4N4NB 1OS2A 1PWWA 2OVZA 2E5NA 4C2UA 2OVXA 3DPTA 1H71P 1DMTA 3K4CA 3W3CA 3HB2P 1B8YA 1MMPA 2DW0A 2CLTA 3OHOA 3K4KA 2CW8A 2WAQA 1A85A 4QPOA 4BUPA 1SRPA 2QKMB 3LQBA 2KP6A 3QOEA 1UAAA 3LE9A 1R55A 2OV7A 4B48A 1K7QA 2X1EA 3VYUB 1KAPP 3HYGA 3L0TA 2CFOA 2O5RA 1QJIA 1PWVA 3EDIA 5D7WA 4DBRA 3K4JA 1WJAA 3K10A 3F19A 3UR3C 4GR3A 3LIRA 1G9KA 1MMRA 3BC8A 3AL0B 4ITVA 3V42A 4XLEA 1MW7A 3IUOA 2Y6DA 966CA 1D0YA 1BKCI 3TBIA 3LKAA 1ASTA 3LILA 1GLNA 2DDFA 1CGEA 4G6TB 4PJJA 2OY2A 4LIUA 1X4OA 3UVCA 4PKWA 1ZTQA 2HNHA 2WO9A 3DU5A 2LBFA 4BJ5C 3H9GA 4WF6A 2M0MA 2JVHA 3EUAA 4PKRA 1SAUA 2HU9A 5I12A 3J7AY 4PSWA 1ZVXA 2W4SA 1GO7P 1JJ9A 2HZDA 2M7BA 1CXVA 1Y93A 3LSIA 5I0LA 3OYEA 2M4GA 1MNDA 3HPHA 2HPIA 2IGOA 2CH0A 4Y3OA 4Y33A 1G59A 1WJBA 3W2WA 1TT0A 2X1CA 2DW2A 1I73A 2WAEA 3MA2A 4HX3A 1X19A 3MD2A 3OYKA 2E60A 2VXZA 2KHMA 3VDXA 2USNA 4QKZA 1U0JA 3FBNB 4RLQA 4AIGA 2VQCA 3PSFA 5L7FA 2VKHA 1G49A 2K9CA 4DOZA 2JIHA 2XS3A 3DL1A 3E1SA 3CESA 4XOTA 4R79A 1G05A 4BXFA 2R7OA 1QJJA 3ELMA 3K7LA 3V96B 4DIQA 3CMMA 1BM6A 1NG7A 1G8XA 1X1AA 3LFUA 2XF5A 1RMZA 2MD0A 3DU6A 3HUGB 2W1OA 1BOBA 3A1YA 1K6YA 3F9KA 3QYBA 2JT5A 3OYMA 4XOPA 3VTGA 3HPGA 3PNYA 3G2BA 1JAOA 4KJZA 4FETA 4LG3A 1BUVM 2AIGP 5D1SA 1W36C 1K7GA 5HOOA 2CV2A 1SLMA 4BGDA 4A3WA 4DD8A 4R3VA 3CF2A 4NQWB 3DEEA 1HV5A 2M3AA 2RJQA 1LDKB 4WKIA 1WJDA 3TS4A 2WB1A 3EUHC 2F5VA 1BQQM 4E4HA 2W13A 3HY7A 2WA0A 3KEKA 3LGPA 3LUNA 1PJRA 3CJRB 3TSKA 2X85A 3MMYB 1N77A 1V5GA 4F52A 3OYIA 3OHLA 3KHIA 2I8DA 3ZGKA 2ERPA 3L2UA 3OYDA 4ZC3A 2W15A 4XLHA 3OMYA 3L2WA 3KMCA 3HXLA 1O0QA 1OM8A 1YCMA 2AYKA 1JAPA 2J0TA 3AFHA 2J83A 4H3XA 5H8XA 2OZRA 1IADA 1EAKA 2A5WA 2JNPA 1D0ZA 3Q2HA 3SEQA 2PJTA 3D5RC 3CZ6A 2WO8A 4DV8A 1HA8A 2R7TA 4ON1A 5B5PA 1MMQA 2JVGA 3F1AA 3KWVC 3HC7A 4XN3A 3TMOA 4B47A 3ZUKA 3U1RA 2XF6A 2HPMA 2MZIA 4XONA 1KBCA 2VQLA 3GBOA 4CCLA 2CS3A 4AU7A 3ZVSA 4H82A 4IQ4A 1OO9A 1S4BP 1KUFA 3C2GA 1IACA 3SDBA 5FROA 2MC4A 1L6JA 2X7MA 1XFZA 5D3CA 1XFWA 1JKYA 4GF1A 4F91B 3I3LA 3WV2A 3HG9A 4HSRA 5KNLA 1BQOA 2RQQA 2K9MA 4CA0A 3ONQA 3VYSB 2OW9A 2YIGA 4EFSA 4FU4A 3OS0A 3S3NA 1WJEA 1DP3A 1I1IP 1BR2A 2V4JC 1XFYA 3AYKA 1GE5A 2OI0A 1OM7A 2A8HA 1O0TA 2E1MC 1QICA 4XR6A 3LSMA 1D1BA 3MKYB 3PJRA 4KISA 1KUHA 1WNIA 5HLTA 3OL4A 4C30A 5HVQC 3OYHA 3TT4A 1AF0A 3LMCA 2LC2A 4AXQA 3FKJA 2R7SA 2WY7Q 3U21A 2R7VA 3VWBA 3PL8A 4XMYA 4D1QA 1GXDA 3DPFA 1BZSA 2IXSA 3KYLA 5CQGA 2PJRB 4YRVA 3P1VA 4H84A 3OYAA 2W82A 2VLAA 1EA3A 3EUKL 2W00A 4BEHA 1JI8A 2I47A 4XKBA 4CH7A 2OW1A 4P1WA 1SFKA 4YELA 1ERDA 3E8RA 3LEAA 3LK8A 4HEA2 4JQGA 4ZR5A 3CJQB 1IABA 2FV9A 3S8PA 1T95A 2R7XA 3KEJA 2Y6CA 2OXWA 2E3XA 5I2ZA 3RSNA 3BG7A 2ZSIB 3EWJA 3DKYA 2Z16A 2IS2A 1BSWA 2W12A 3HDAP 3I7GA 4XLAA 2BVMA 4ILWD 4NUBA 2ZFUA 3K4NA 2DOAA 2WAFA 2LREA 2X6WA 4MLOA 2FUG2 5HNFA 2R7WA 1D8MA 2Z2SB 1IAAA 1Y56A 4RMNA 2JUGA 4CCJA 1X1CA 3BA0A 2IGNA 1YE9A 2LRDA 4JP4A 2VJ4A 4BJTA 2VB6A 4H49A 4U87A 1B3DA 1Y6IA 3OYBA 1GO8P 2WBMA 5TGTA 2HDWA 3OS2A 1PWQA 3P24A 4PKQA 1AYKA 3L0VA 3H5RA 2KL4A 2MLSA 5JHFA 1KUGA 2XF7A 1CGFA 3M8JA 2HVSA 3FBIB 3L2RA 4HRIA 1BR1A 4KITB 4F3QA 2OY4A 4BU2A 3LL7A 2WOAA 2CUZA 1ZP5A 2V26A 3DPLC 3O64A 3H35A 1CQRA 4HG2A 3QYFA 1G12A 2KRJA 1MNEA 4C2TA 2L7KA 4DBQA 3DPUA 3VYTB 3D5LA 4RLFA 5BOTA 3G5CA 2LBFB 3DTEA 3OYFA 1MNCA 1YOUA 3OS1A 3QYEA 4KT6A 2TCLA 3DNGA 3F15A 2V1NA 3H9JA 3IAM2 1PWUA 4B44A 4NC7A 3HY9A 2V4BA 4AYKA 4AYBA 1LVKA 2UV1A 3EPZA 3OOUA 4DGWB 3L2QA 3USNA 1QHGA 2X6YA 3VYRB 5LFAA 3KMEA 3SZGA 4L63A 3MKZA 1FM1A 3Q2GA 4GWNA 1ZXCA 1UMTA 2OW0A 1ROSA 5D1UA 4I35A 2XS4A 1HOVA 2DCEA 3SEZA 3UNGC 4D9JA 4BE1A 3EDHA 2K5CA 3OYLA 2Q1ZB 1GE7A 1R54A 3IAS2 1CAQA 2R7QA 4J4MA 1BKCA 4L6TA 3RTRA 4PUSA 4XORA 4II2A 2KRCA 3O2XA 2CMPA 5CPRB 2IS1A 2DT6A 4XBHA 1ZELA 3F16A 3ZXHA 1N75A 1CK7A 2DJIA 3LJGA 3ZCOA 3EDZA 3W2VA 3EHXA 1DQUA 1UG0A 1Y0VA 2PMZA 4ZDOA 3OR1C 4E7KA 4BQNA 1MMDA 1CGLA 4BDZA 4DJAA 3FHNA 4E7IA 2F4IA 4CSWA 4FVLA 2LYCA 2BVLA 2E5ZA 3PNVA 1SATA 4F93B 4JA1A 3SYTA 2EROA 3N2UA 1C7KA 4HMAA 3FDYA 2Q2EB 3DQVC 4IKFA 2W7NA 3N2VA 3LUMA 5D2BA 4GUYA 1PWPA 1AA7A 4ANJA 3RQ4A 1Z3XA 1IAEA 1USNA 4RM3A 2OUMA 2X6XA 1G4KA 4IQJA 1K7IA 3DPEA 1LFPA 1BUDA 2XAUA 4ZDLA 1QIBA 4E7HA 2HU6A 2CUJA 3EDGA 3BLYA 1Q3AA 3ZR8X 2O3EA 2Z1DA 1OLTA 2VKDA 3PNTA 3AKZA 3LSKA 3DWBA 3D5SC 1GKDA 2POJA 1XFVA 4CZCA 2R4GA 2L9NA 4BDYA 1A86A 2P0WA 4XCTA 4DF9A 4B3XA 3S3MA 2W14A 2K9LA 2VASA 2VXDA 2XSJC 4U7BA 3OY9A 2KQRA 2XC7A 2LY1A 4C9YA 1UELB 3GBGA 2OC6A 3ZRGA 1SMPA 3K70D 4GRIA 2V9KA 1Y8JA 2MYSA 4CCNA 2BOLA 4LIVA 1JK3A 2VIXA 2D1NA 2X3BA 2V6EA 3LMMA 4ZYAA 5CUHA 4Y4RA 1E0EA 5HNHA 4PSXA 2VQGA 3VSKA 1TZLA 4CUGA 1DTHA 1HFSA 4WZVA 2MZHA 3PUBA 4E7LA 3SHIA 1YQYA 2ZXHA 2AQEA 3OYNA 1Z7LA 4P5OA 1JAQA 3DSLA 2RJPA 3NWTA 1JIZA 5BOYA 2MZEA 4E7ZA 2M7AA 2LY2A 4PJLA 4XKCA 4GQLA 1NG6A 1D1AA 2VQHA 4ZDPA 4H76A 2YB9A 3AYUA 4JPAA 1X1BA 2VJIA 3MKWB 1IRXA 3TVCA 2X51A 4Q1LA 3LJTA 2SRTA 1OMJA 3DTKA 1JIWP 2ZXIA 3H5AA 4PKUA 1HTDA 3KEYA 2O36A 4PKTA 4ZTJA 1ND1A 1UMSA 3HOSA 1SLNA 3LSHA 3F18A 1FMVA 4JIJA 4XL9A 2KZVA 4J00A 3RCOA 2F6CA 1UTZA 4H2EA 3ZQQA 5KHDA 3OYGA 2R7UA 4E7SA 1EB6A 2OXZA 4FXYP 4PFOA 2DW1A 3I7IA 4IJOA 2L2OA 3RTSA 3LIKA 5D1TA 4JOMA 4HNTA 3K6GA 3OYJA 3NWSA 2QKLB 1QUAA 4ZJZA 4HSTA 3S93A 1QU3A 5KCMA 1T0FC 2HQAA 2UUZA 3L2VA 2D1OA 4BEHB 4XKVA 4GR8A 3TL4X 2DT7B 5CKTA 5FRNA 2IS4A 1HFCA 1IAGA 4X0GA 4BL0B 3CKIA 3DTIA 1ZS0A 4OWRB 2DDYA 4IUWA 3H9QA 5JMYA 4PKSA 3HDBA 4AUOA 1R1JA 1R1HA 2CKIA 4F92B 1QHHD 4OAZA 5I3MA 5CZMA 3N05A 3OYCA 2KMUA 2JT6A 3H5NA 2WY8Q 5B5OA 3K4LA 2K2GA 3AIGA 4XLFA 4GR0A 1FLSA 2VL8A 1X1DA 4XN0A 4XQFA 4L7AA 2MFZA 4L19A 3M1CA 3RPUD 2ERQA 1BIWA 4IZZA 2L0RA 4OAYA 2OW2A 2N8RA 3B92A 5BPAA 4XKWA 4XM3A 4CCOA 1J7NA 1HY7A 3K7NA 2LG4A 2Z2DA 1OR7C 3WV3A 1FBLA 4HPQA 4GWMA 4BE0A 1FMWA 2ZSHB 3OL3A 1S9HA 4NNJA 4E6KG 3E0JB 4G0DA 2CW7A 4PJMA 2M4KA 3A4CA 1MMNA 3ZXSA 2CV1A 3HBVP 2HVQA 3B2ZA 1MMGA 2IGMA 2KPMA 4H30A 2HVRA 4BQQA 1LKXA 1WFXA 1OM6A 3CP8A 4HNUA 2JSDA 2X3CA 5LD2C 4NC8A 1CIZA 3IP4B 4H1QA 1UTTA 2GOXB 4PJNA 1C3IA 1GE6A 3RTTA 5I4OA 2VJ5A 2MABA 2JSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTI A;  3DTE A; 
#chains in the Genus database with same CATH topology
 3MEX A;  5ILU A;  2R5Y B;  1ESU A;  2X71 A;  4UNO A;  2EFU A;  4NXE A;  2OD5 A;  2RNG A;  5FRM A;  1JKR C;  1WZ2 A;  3GTL J;  1PI5 A;  1D7X A;  1OYY A;  5LAB A;  1V9Y A;  1D06 A;  3HOT A;  1OS9 A;  1XSD A;  4KIB A;  1YOV B;  1N78 A;  2K3F A;  2E35 A;  1I76 A;  4HV6 A;  1D5J A;  4II3 A;  3OR2 C;  2Y55 A;  1IDY A;  3EGX C;  1DJB A;  1S66 L;  1PYV A;  5HOD A;  2WZZ A;  4HA8 A;  3CCJ I;  2G9W A;  1G5U A;  3HJK A;  5LBR A;  4QJG A;  2L4M A;  5A90 A;  4XLN F;  1SD6 A;  1R36 A;  1M6K A;  3AL0 C;  4WF0 A;  2W0D A;  4EM0 B;  4M3B A;  1P9R A;  2BBY A;  2E1M B;  3VSL A;  2IAI A;  3QP6 A;  1DY6 A;  2V8F A;  3D72 A;  2ZNY A;  2OCE A;  3LR0 A;  3EYY A;  3CQZ J;  4I03 A;  2OXU A;  5D5W B;  4FSF A;  4MEZ A;  2E7X A;  4LK1 F;  1D0X A;  1EKE A;  3RKW A;  2ZMF A;  5DTS A;  2IGK A;  1SFE A;  2KIS A;  4GW9 A;  1TBX A;  1EV7 A;  5JVT A;  5JYO A;  5GAH J;  1F5M A;  2B02 A;  3JRA A;  1XXM A;  2M30 A;  5L3B A;  3BG6 A;  4MBF A;  4BL3 A;  2MGQ A;  5AON A;  4MBH A;  3Q7Z A;  2Q9N A;  1ETW A;  1QMF A;  3IBJ A;  4G3W A;  3HBU P;  2X48 A;  3KFW X;  3DTM A;  3LA2 A;  2CQN A;  2FU4 A;  1K6R A;  1K55 C;  1NK2 P;  2L54 A;  2KDO A;  4U3T A;  1R5G A;  3B02 A;  2PR5 A;  4B43 A;  2PT7 A;  1ZAO A;  2JA2 A;  3SHF A;  4AVP A;  1SKO A;  2CJJ A;  2DFH A;  3OCN A;  1WJ5 A;  2D5V A;  1X4P A;  4CLC D;  1POG A;  2QM3 A;  1K55 A;  3E5U A;  3ITA A;  4BE2 A;  2DA6 A;  4IXA A;  1XFU A;  4XRS G;  1U5T A;  5CEC A;  1L0D A;  4KMU X;  3LGO A;  4QPQ A;  4E7J A;  4JX6 A;  4LRX C;  1YP1 A;  1DGW Y;  1JTY A;  3K1P A;  1TWC J;  4I6Z A;  2W27 A;  4RGS A;  3OIO A;  2A6T A;  2XRL A;  5K5Q A;  5BPI A;  4A7B A;  4D2O A;  4D5C A;  4MTD A;  2Z2L B;  4JGR A;  3AGD A;  5KSH A;  1KA8 A;  1DGR M;  1LL5 A;  3MCZ A;  2KJC A;  1IUY A;  1AKH B;  4A0X A;  2CYY A;  5DTT A;  2EZI A;  3A3I A;  4PFP A;  3CUQ C;  3K4B A;  3KO6 A;  4A12 A;  5CGW A;  2AXT C;  3BTC A;  2VV6 A;  3BFG A;  4CTH A;  4FXQ A;  4WK7 A;  2EPF A;  3CTA A;  3BP8 A;  3TQN A;  4BYY A;  3CJN A;  5F1G A;  2F4M B;  2EIN H;  1H71 P;  4E3J A;  1XB4 A;  3E6D A;  1WYC A;  1B8Y A;  3HB2 P;  4IHY A;  2WAQ A;  4L0Y B;  1YT4 A;  3VP1 A;  3RJP A;  1SRP A;  2Y0S N;  3HOX J;  1OQY A;  4KNY A;  3Q7V B;  2H10 A;  3QOE A;  5LBQ A;  1IN4 A;  2GQQ A;  2WV1 A;  3L00 A;  2OV7 A;  3HYG A;  2CFO A;  1A04 A;  3H92 A;  4LPZ A;  4WM9 A;  1LB2 A;  3ZCZ A;  3K2Z A;  4D60 A;  5D7W A;  3G1O A;  2NVU B;  1XFQ A;  2PRF A;  2HZ5 A;  1WJA A;  3K10 A;  1WA9 A;  5ICC A;  2ZM0 A;  3BC8 A;  3AG3 H;  4U0X A;  4O0P A;  3V42 A;  4OOI A;  2WGW B;  3RKQ A;  3J81 K;  3IS2 A;  1YJW I;  1W0U A;  4UUS A;  3JRG A;  2A3U A;  1AST A;  4NEE D;  3IQA A;  2EQR A;  4MEY F;  1GLN A;  2OY2 A;  1CGE A;  4PJJ A;  1W79 A;  4LIU A;  4UVB A;  4B9O A;  4WF6 A;  3LEZ A;  4S2N C;  3SS3 A;  2KFD A;  2VT2 A;  2EA2 A;  3UKG A;  4PKR A;  2V1U A;  1R5I D;  1SAU A;  2HU9 A;  2XGE A;  4IJG A;  1GA0 A;  2VGK A;  5GHZ A;  1GVD A;  5I12 A;  5CRF A;  2CQ7 A;  2HQ5 A;  4XIC A;  3BY8 A;  1V54 H;  4ZYG A;  2PYP A;  2DTZ A;  4WEK A;  2HZD A;  2M7B A;  3UN7 A;  1GO7 P;  3KP7 A;  1Y8R B;  4I0A A;  1LPQ A;  4KZ7 A;  1KDW A;  1ZH5 A;  2CH0 A;  1VQ5 I;  3P09 A;  2DBB A;  3ZQ7 A;  1R4N B;  3RDI A;  2X1C A;  1Z05 A;  3CCR I;  2QPN A;  3BZC A;  2E60 A;  2USN A;  4RLQ A;  2HQR A;  3BOQ A;  4I02 A;  1G6A A;  2L0W A;  1TNT A;  1Z7U A;  2GAU A;  5L7F A;  2XS3 A;  2NVQ J;  2A6E F;  2L4R A;  3HLW A;  5GLD A;  3DL1 A;  3LK8 A;  4K08 A;  5FGM A;  2W3F A;  3T4T A;  3ZFZ A;  3V96 B;  2DU9 A;  4RS8 A;  3QNB A;  2PBD P;  1LFU P;  3M8F A;  3AGF A;  3JRD A;  3SXY A;  2P8T A;  5DV5 A;  3RPU A;  3CC4 I;  1G6O A;  4IHV A;  3ABK H;  2HP6 A;  1BOB A;  1IOU A;  3CCU I;  5CXW A;  1U3E M;  3IH4 A;  4II7 A;  5EVI D;  3V8L A;  3IH8 A;  1S7A A;  1SDE A;  3HUN A;  2M0C A;  5E3O A;  3HPG A;  3PNY A;  1IEM A;  4OQH A;  3VTG A;  2VOP A;  1SFX A;  1V55 H;  1BUV M;  5D1S A;  1K7G A;  2ZB9 A;  1PUE E;  2DPU A;  3R60 A;  2VC0 A;  1U8R A;  1LUJ B;  2VBY A;  2HJE A;  4A3W A;  1X3Z B;  3SFI A;  4X6A J;  3ELM A;  4Q0J A;  3E4P A;  4NQW B;  4M9S A;  3VP4 A;  5K7Z A;  4N1X A;  3HLD A;  3TS4 A;  2WB1 A;  5H20 A;  4S2P A;  4E4H A;  4KUO A;  1B9N A;  3GQZ A;  3MMY B;  4F52 A;  1U9O A;  2OAQ 1;  2C6Y A;  1FPQ A;  3ZG7 B;  3ZGK A;  3IWF A;  5CHU A;  1K4S A;  1WI9 A;  4Y7N J;  2E1C A;  4M6V A;  3A03 A;  3L2W A;  5FAP A;  1JKQ C;  3OPL A;  4QHC A;  3ZQH A;  2AYK A;  2J83 A;  1A31 A;  2DFF A;  3UPP A;  1RKT A;  2OZR A;  3K2A A;  5A2Q Z;  5E3N A;  3U1D A;  1GDT A;  4UV8 A;  1APL C;  3S7N A;  1SKO B;  3SEQ A;  3MZH A;  4DV8 A;  1HA8 A;  2XAH A;  1FQG A;  2PX9 A;  3GX4 X;  2QF7 A;  1ODD A;  1J59 A;  4WZ5 A;  3WRZ A;  1MMQ A;  1I5Q A;  4XN3 A;  3ROU A;  4K0X A;  5HAR A;  3TMO A;  3ZUK A;  1XPB A;  5HZH A;  1JGG A;  1I5Z A;  1BC7 C;  1ES4 A;  3EEH A;  1MBE A;  1R00 A;  1Z6F A;  2BY3 A;  4WXH A;  2QZ6 A;  1U60 A;  2CS3 A;  2K9Q A;  5IOZ A;  4H82 A;  3F3X A;  1K56 D;  1S4B P;  1KUF A;  3C2G A;  1XS9 A;  1JTG A;  3BYD A;  2L0K A;  1IAC A;  5FB2 A;  2KRF A;  2MC4 A;  3TDU C;  5FRO A;  3G6E I;  4PGG A;  1IFQ A;  2Z6C A;  2X7M A;  1W8Y A;  1D1J A;  2CMN A;  5FO5 A;  4WBG A;  2CFX A;  4K91 A;  4F91 B;  3A3E A;  4IL6 C;  5KNL A;  4IHQ A;  3BRO A;  3R4K A;  2RQQ A;  2QSF X;  1QZZ A;  3BQA A;  3VP3 A;  3VYS B;  1BQO A;  1KQ8 A;  3ABU A;  4O3M A;  4BD0 A;  2V4J C;  4I01 A;  2BE5 F;  3UO9 A;  3Q9S A;  3CZD A;  2DK8 A;  1YLT A;  2XGN A;  5E2G A;  4HOB A;  2G7H A;  1ZGA A;  2MD5 A;  3ZMZ A;  1QIC A;  3LSM A;  3PJR A;  4A3B J;  5FAQ A;  2PYR A;  4ENN A;  2ID3 A;  5EZH A;  3A01 B;  5FDS A;  3RXW A;  4HHD A;  4CHU A;  4IHS A;  5E8G A;  4D1Q A;  4H84 A;  3IRQ A;  2IXS A;  3EWK A;  4YRV A;  1I6H J;  1IRG A;  3OYA A;  2ZQ9 A;  3DBA A;  3IT9 A;  3TSG A;  2IW5 A;  2W82 A;  2LFB A;  3F6O A;  3HRS A;  2WWY A;  4BEH A;  4I38 A;  4A3G J;  4CH7 A;  2OW1 A;  3G3Z A;  1SFK A;  4P1W A;  4R1H A;  4BHB A;  3WTU C;  1ERD A;  4HEA 2;  4LK0 F;  4FX4 A;  1IEL A;  2ZBB A;  3H9W A;  3VE4 A;  4E3K A;  4RGX A;  5E1X A;  1LQ1 A;  3W6J B;  5LRR A;  1J9M A;  1NJ4 A;  3KSG A;  2YS9 A;  2FV9 A;  3KEJ A;  4EJW A;  2BXY A;  4G94 A;  1GXP A;  3JYI A;  4GCZ A;  1X0O A;  5DKL A;  3JW4 A;  3LSR A;  1D5Y A;  1IN5 A;  2DT5 A;  3RSN A;  2DPD A;  3S15 J;  2EA4 A;  4JF6 A;  2Z16 A;  4BD1 A;  4YFM A;  3HDA P;  2QYB A;  4Y13 A;  2MC3 A;  2E36 A;  1OYI A;  2DOA A;  2WAF A;  2ZNZ A;  5HWV A;  1IAA A;  3WTX C;  1TQM A;  5HNF A;  3ULQ B;  3RI4 A;  2EX8 A;  1X1C A;  2OJE D;  2V2F F;  3WTV C;  1HLU P;  4OON A;  2BXZ A;  5M5Y J;  2LRD A;  1OYW A;  4BJT A;  5EG0 B;  1FTZ A;  4ZJ3 A;  3QP5 A;  2QJ7 A;  3F1O A;  4CLC C;  2TRT A;  3E2K A;  4HP4 A;  2MH9 A;  4EGY A;  3QWL A;  1LL8 A;  3F8C A;  1GO8 P;  3BTL A;  5EM1 A;  2QSG X;  1TS6 A;  1S4S A;  4N9L A;  2X01 A;  3EWJ A;  1WH5 A;  3P24 A;  1AYK A;  4R6L A;  2XA7 S;  3FXR A;  3UMD A;  1VEU B;  1F98 A;  2ZO4 A;  2JRT A;  1NRF A;  2BY1 A;  3V8K A;  3M8J A;  2Z9O A;  4QB8 A;  1CGF A;  1ZYR F;  3FC7 A;  2O0Y A;  1G3W A;  2L02 A;  5DCM B;  4QWO A;  4B4X A;  2KJB A;  5A8B A;  1TTY A;  3BJA A;  2GJ3 A;  4HG2 A;  3IXD A;  1FIA A;  1S3J A;  2Y6C A;  3PFI A;  2L7K A;  5TR7 A;  3F1P A;  4AIH A;  4RLF A;  1T39 A;  3N7W A;  1XM5 A;  2LBF B;  3OYF A;  3S16 J;  2ZQA A;  2CWE A;  2TCL A;  3WU0 A;  2V1N A;  3JTG A;  4UA9 A;  5CTN A;  4B44 A;  4NC7 A;  5HLG A;  2P7C B;  4UVC A;  1LEB A;  3ZDJ A;  3EYI A;  4NG2 A;  3EPZ A;  1OPX A;  3Q7V A;  4S2I A;  1X2N A;  5HLI A;  4R8H A;  3UDX A;  1FM1 A;  5HDD A;  3SZG A;  3NY4 A;  3TOA A;  3IC7 A;  2MW8 A;  2AXL A;  1JE8 A;  2OWH A;  3TO6 A;  1ZXC A;  3F1O B;  4Y17 A;  1ULY A;  2O03 A;  1MDM B;  1CK3 A;  3NJA A;  5M5W J;  2K5C A;  1DP9 A;  1PW8 A;  3OYL A;  5HW3 A;  1JVJ A;  4JXW A;  1GE7 A;  1ZKG A;  4O6J A;  2R7Q A;  4L6T A;  3LAP A;  3RTR A;  3IX3 A;  4BBS J;  1VQM I;  2MLK A;  2CQK A;  2CMP A;  4DYQ A;  5E79 C;  5CPR B;  1K38 A;  4MN5 A;  1MWT A;  2HPB A;  2DJI A;  4N0B A;  3M4O J;  3ISP A;  4Y0T A;  5HFO A;  5IT3 A;  1UG0 A;  4A3K J;  1QO0 D;  3K2N A;  1CEF A;  3SH9 A;  3DEU A;  4XK4 A;  3M8E A;  3ZG8 B;  3P9C A;  1CGL A;  1FBS A;  4M72 A;  3Q81 A;  2Y30 A;  5DD8 A;  1GVJ A;  4F93 B;  2XF3 A;  2H6C A;  5F6F A;  1WE4 A;  4RQ9 A;  1S29 A;  5D6E A;  3CCQ I;  1WKM A;  2L7Z A;  1JHH A;  4HMA A;  1B72 B;  4QU3 A;  4LGW A;  5E3L A;  3HOY J;  2W48 A;  3DQV C;  3L7W A;  4EM2 A;  3FHZ A;  3WOD F;  1JUM A;  2FF4 A;  1MDM A;  3QPH A;  3ZNY A;  3LUM A;  5D2B A;  1YRN B;  2Y79 A;  2RKH A;  2CG4 A;  1IAE A;  2GWR A;  5GTI C;  1TS7 A;  4N9H A;  1G4K A;  3BWG A;  4RAF A;  4MHG A;  1K7I A;  3J80 Z;  2IRF G;  3KYC B;  4NQW A;  3KLN A;  2GXA A;  4EGZ A;  4KUK A;  4ZDL A;  4MDZ A;  1GHM A;  4L0Z B;  1QIB A;  5CTM A;  2LNB A;  2VBX A;  3BLY A;  4U88 A;  4ENK A;  3HSR A;  1MWU A;  3E5Q A;  3ML6 A;  3FF5 A;  1EH6 A;  1OLT A;  3S7Q A;  5M3M J;  4R3A A;  3E5X A;  2FMY A;  3KCC A;  4NC6 A;  4NHJ A;  3S1M J;  4PZJ A;  4FCY A;  1QNT A;  5A93 A;  4ARZ B;  3D5S C;  2UWX A;  2YKH A;  3I59 B;  1ZG6 A;  1XFV A;  2ZME C;  2R4G A;  3C3W A;  1A86 A;  1ZTU A;  3BG5 A;  2VN2 A;  3SZT A;  4B3X A;  3CUE A;  1FP2 A;  1ZRC A;  5FKK A;  1VM1 A;  5DF9 A;  2XSJ C;  3LOC A;  4XRS A;  5D3O A;  2WAQ N;  3I53 A;  2KQR A;  1BUE A;  1LSV A;  4DKI A;  4A5M A;  2OLU A;  3GBG A;  4GD6 A;  1BI2 A;  4HW0 A;  4ZZD A;  4EVI A;  2D1N A;  1RET A;  5C5K A;  2X3B A;  2V6E A;  1XDS A;  3JTH A;  2JT1 A;  4LG0 B;  5EEA A;  4RBO A;  3H82 A;  4OMZ A;  5FKL A;  5H6Q A;  5J8X A;  3SHI A;  4E3I A;  4I2O A;  3E7L A;  2RJP A;  5BOY A;  1XSX A;  2MZE A;  3BFC A;  2M7A A;  2GXB A;  4PJL A;  2EFX A;  4L0L A;  3LA3 A;  1SAN A;  4IHX A;  2VQH A;  4JPA A;  2VJI A;  5DYM A;  2QBY B;  1IRX A;  1OR7 A;  2GBY A;  1ZRD A;  3TVC A;  1FYL A;  5CGS A;  1AOY A;  1H9G A;  4Q48 A;  1FYM A;  1OMJ A;  3DTK A;  5KVR A;  1K54 C;  3O86 A;  2WTE A;  1IDZ A;  3CPT B;  3H5A A;  1HW1 A;  3KEY A;  2ZMV A;  5CHJ A;  1ZHH B;  2BZT A;  4ZTJ A;  1K61 A;  4B1R A;  3LSH A;  1PFL A;  1FMV A;  1YMS A;  3ZMT A;  2LLK A;  4QLC U;  3H3U A;  3GTG J;  4GCV A;  3ZQQ A;  3NOP C;  2C6W B;  2XK1 A;  1RP5 A;  4E7S A;  2R9X A;  4R3B A;  2VBW A;  5FD5 A;  3S4X A;  4PFO A;  3VP0 A;  1EB6 A;  1CQA A;  3A01 A;  4AD9 A;  2QEN A;  2DCF A;  3PXP A;  2Y48 A;  2E7W A;  4ZJZ A;  1G2H A;  4HST A;  5I94 A;  4ETZ A;  3S93 A;  1QU3 A;  1JT6 A;  5KCM A;  3OPH A;  2Y31 A;  1T0F C;  5J4V A;  3ZQL A;  4AFI A;  3TL4 X;  2DT7 B;  5FRN A;  1ES5 A;  2E2H J;  1NK3 P;  1ZLK A;  2XQZ A;  2KIQ A;  3HDB A;  4B8X A;  1AXB A;  1R1H A;  2NXN B;  1G28 A;  2CKI A;  4OAZ A;  4O8G A;  4ZYD A;  5CZM A;  3OYC A;  2CQX A;  3BY9 A;  2WY8 Q;  2PQ8 A;  3WG9 A;  1OMI A;  4OIR F;  2Y2H A;  3K4L A;  2ACG A;  2VKS A;  1PDN C;  2KZG A;  4KZ5 A;  4XQF A;  5L3F A;  2FEZ A;  3TO7 A;  3ZN0 A;  2FNA A;  3S14 J;  2HYG D;  1S72 I;  3MJQ A;  1HY7 A;  4XM3 A;  4CCO A;  3CUQ A;  2LG4 A;  2WKQ A;  3IWZ A;  2ZXJ A;  3ZQF A;  1ETQ A;  4HPQ A;  4A0Z A;  2HDD A;  2JSC A;  4NNJ A;  1DJC A;  1T1A A;  3JRE A;  2XFT A;  3E0J B;  4G9Y A;  3QRF F;  4PJM A;  4A93 J;  1YQS A;  1H89 C;  2DOD A;  4LFU A;  5D6F A;  2HVR A;  4H30 A;  1OM6 A;  1WFX A;  3HOV J;  2X3C A;  3TW8 A;  4B4Z A;  5F27 A;  5LD2 C;  3S2D J;  5HLH A;  1S1Y A;  2EJR A;  3L09 A;  2RCX A;  1B8I A;  5FQ9 A;  2YX4 A;  2DDA A;  4H1Q A;  3E0Y A;  4H8R A;  1UTT A;  5DTD A;  2QVO A;  3MMH A;  3OOU A;  1G68 A;  3W6V A;  2F5E A;  4EER A;  3WTT C;  4A0Y A;  2EX2 A;  2NYX A;  5B5E C;  3N6I A;  4ME4 A;  2P4W A;  4QSH A;  1ZHF A;  2KLO A;  4RGU A;  5TIS C;  3DKX A;  3PFY A;  1EJ9 A;  4Y0O A;  1YSQ A;  1P4X A;  2XRO A;  4PHT A;  2KIF A;  1RIO H;  1GHP A;  5DD4 A;  4G7O F;  4BJ6 C;  2A2L A;  1CGP A;  3E4O A;  1WVR A;  2Y2O A;  1LSW A;  4HNV A;  4E3M A;  4DXC A;  3CG5 A;  5M3F J;  2XSS A;  2JPC A;  3UB8 A;  4GS9 A;  3BY6 A;  3QPS A;  2VA0 A;  3NEC A;  4PAU A;  3GLX A;  4OH0 A;  1E3P A;  1BR4 A;  3LSP A;  2MG4 A;  1MNM C;  5DUK A;  2IS6 A;  1E25 A;  1P0Z A;  1RM8 A;  4H4K C;  3P01 A;  3OIQ A;  4FHT A;  1MBJ A;  2EK5 A;  3NDE A;  3WS1 A;  4E04 A;  2O61 A;  1V5E A;  2J9P A;  2ELJ A;  4UV9 A;  3ERE D;  5CXA A;  3CI6 A;  2UWM A;  4EES A;  1AWI A;  1OTA A;  1JAN A;  4S2N A;  2K40 A;  2BW3 B;  4X6T A;  1YTY A;  4XLC A;  1FJL A;  2IA2 A;  4EJO A;  3O87 A;  2Y69 H;  3HLB A;  3WG7 H;  2GOM A;  1Z6T A;  1YS6 A;  2AQF A;  2B0L A;  4LIT A;  1J09 A;  3H0D A;  1YLZ A;  2EX9 A;  1AKH A;  4JBF A;  5J4E A;  5D5U B;  5HAI A;  2XSD C;  2EFP A;  4JF5 A;  1R1I A;  3CCS I;  4J01 A;  4EXO A;  4HOI A;  1ZXV A;  1NXY A;  2FOW A;  1R23 A;  1XX2 A;  2ZC3 B;  3NX7 A;  4O7D A;  3R0A A;  3CLQ A;  3OIP A;  1UCR A;  1XC5 A;  2RRE A;  4N4O B;  4IX7 A;  1LI0 A;  1Z91 A;  2M34 A;  1BLH A;  3LEQ A;  2Z6D A;  4XLP F;  5J3W A;  1MD0 A;  3HRE A;  3KIO A;  3LUQ A;  3QOD A;  2WGI A;  1OJG A;  4RX2 A;  1XJ2 A;  3ZN1 A;  4CIC A;  4BAC A;  2F48 A;  2P74 A;  4UA7 A;  2DMN A;  1K79 A;  2NOG A;  3VOD A;  2HDC A;  3EHY A;  1FSY A;  4EU0 A;  1PYY A;  2KLI A;  2PJR A;  3C2W A;  2ISY A;  1OIS A;  3DLA A;  1I2W A;  1QIA A;  2M8E A;  2V7F A;  1S5L C;  2WAD A;  3LSG A;  3C38 A;  1OPC A;  3VV4 A;  3U2A A;  1Z3J A;  1K4F A;  2WGW A;  1XA1 A;  2PN6 A;  2ID6 A;  2JA6 J;  1Z21 A;  4A69 C;  2ZQD A;  1D7E A;  1GKC A;  2JMW A;  5I43 A;  1HKQ A;  3ZOB A;  3L1P A;  1HC8 A;  4KQD A;  4YG2 F;  4F55 A;  4EJU A;  3JAM Z;  2K3P A;  2DI3 A;  1P97 A;  1XUR A;  2Y2I A;  1MMS A;  3D3O A;  3FMR A;  1VZ0 A;  2A3S A;  2ZJQ F;  3G31 A;  4BXU A;  2HKO A;  5JHU A;  4B93 A;  4P96 A;  1MWR A;  1RUN A;  3IXH A;  1VQL I;  4XT2 B;  2OVX A;  5D4R A;  1DMT A;  2Y75 A;  2UXX A;  2WKP A;  3MFX A;  4P6B A;  2CLT A;  3K4K A;  4OQ0 A;  3TOI A;  3IWO A;  1A85 A;  4IVN A;  1YLJ A;  5FLM J;  3S1R J;  1EH8 A;  2KP6 A;  4WF2 A;  4LMY A;  2XH9 A;  3JAM K;  1T33 A;  2L9V A;  2X1E A;  1K7Q A;  1FIP A;  4HDV A;  2P7J A;  2JKF A;  4BKX A;  1KGG A;  4N1H A;  4OOL A;  4DDS A;  3EDI A;  1JHF A;  3B42 A;  3F19 A;  3N4M A;  1BJZ A;  1G3Y A;  2ICW G;  3GR2 A;  4OOY A;  2LTP A;  1G9K A;  1MMR A;  1MPL A;  4C6Y A;  4GR3 A;  2R9W A;  3ECO A;  4NDL A;  2X0L A;  2Y6D A;  966C A;  4DQ2 A;  1G6N A;  2DNS A;  4KZA A;  1BKC I;  2H0Y A;  3LST A;  3Q0W A;  2IA1 A;  5KZH A;  4NXF A;  4WMC D;  1WCM J;  2Y9Z A;  4KG5 A;  3MAJ A;  1FOK A;  4PKW A;  2J8Y A;  2LBF A;  3DU5 A;  4BJ5 C;  2HDR A;  4DF6 A;  2IJL A;  5LGT A;  3OCL A;  2BTF P;  3K7A J;  4IHT A;  1XGS A;  4O01 A;  3F8N A;  4P55 A;  4PSW A;  1NY0 A;  3LAJ A;  2W4S A;  2W3D A;  2DK5 A;  5JR3 A;  4KDP A;  2R93 J;  1S0W A;  1T1B A;  2NUT C;  4OPY A;  1ENH A;  2M4G A;  1MND A;  1MKM A;  2OSU A;  4UQI M;  2IGO A;  1FYK A;  3UME A;  2JQ7 A;  4Y33 A;  2F5F A;  2X6O A;  3WTZ A;  1P2F A;  3D9Y A;  2R92 J;  2XEP A;  3GTM J;  2WAE A;  5CHM A;  2J80 A;  2LR8 A;  4Z1W A;  5F1F A;  2VXZ A;  3F21 A;  5HAQ A;  5F1R A;  4GDB A;  3JRB A;  4OP8 A;  3SW1 A;  3IH2 A;  2QEX I;  3HRT A;  2VQC A;  3PSF A;  2O9A A;  1X2M A;  1LJ9 A;  2VKH A;  4F3L A;  1DU0 A;  2BY2 A;  5C44 J;  3E1S A;  3A0B C;  4XOT A;  4R79 A;  5DM6 F;  3S2H J;  3NIA A;  4MN7 A;  1VTN C;  5GTH C;  1BM6 A;  4DIQ A;  1BI0 A;  1NG7 A;  1G8X A;  2OAZ A;  5D8K B;  4GHI B;  5U47 A;  3DKW A;  2F5C A;  3LFU A;  3WU2 C;  2XF5 A;  4WEJ A;  4EBP A;  3DU6 A;  3I71 A;  2W1O A;  5BOH A;  1K6Y A;  3F9K A;  4HLX A;  4RAZ A;  3SQN A;  4WCG A;  3KET A;  3JSO A;  3PR6 A;  4Q4Z F;  1TW3 A;  4JXV A;  1EWZ A;  4UEY A;  5EFW A;  1DU6 A;  1TQP A;  3WRT A;  5EVI A;  3G2B A;  2NNY A;  2LP0 A;  3U9G A;  4DW6 A;  1MJB A;  4ETX A;  3GVA A;  1NTC A;  5FLX K;  5CX7 A;  4E3L A;  4XUX A;  2XA7 M;  5IPA A;  3HGY A;  3ZMD A;  3R0J A;  1SVM A;  3C1D A;  5H6R A;  2TDX A;  4R3V A;  3CF2 A;  2JSD A;  2M3A A;  2EV0 A;  5EPH A;  1LDK B;  4W97 A;  4Q0H A;  4WKI A;  3RPQ A;  5FAS A;  4JQG A;  3HY7 A;  3LUN A;  1MZU A;  2W13 A;  2WA0 A;  3V3R A;  1NYM A;  3TW7 A;  1ETY A;  2P6S A;  4M3G A;  4KFC A;  2X85 A;  1N77 A;  1V5G A;  1ONH A;  3KHI A;  1WH7 A;  2TCT A;  2EZL A;  1OTD A;  3FK7 A;  1TS0 A;  2HYJ A;  4JYK A;  4XLH A;  3DXJ F;  1CF0 A;  5FKO A;  2ISZ A;  4X25 A;  1YCM A;  2J0T A;  2QHK A;  3UB6 A;  4U7D A;  3CAX A;  1TWH J;  1HLV A;  2L01 A;  2ZME B;  1MXO A;  1IAD A;  2JNP A;  1IG7 A;  3M7G A;  1D0Z A;  1YM1 A;  3I4M J;  1YPR A;  4DYR A;  1LDJ A;  2FFF B;  2XKP A;  2WO8 A;  2M5W A;  4PPR A;  4ON1 A;  1H8Y A;  3F1A A;  2JVG A;  4CGZ A;  3KWV C;  2FBI A;  2V6C A;  5FAT A;  5K5O A;  3U1R A;  2MZI A;  1HD8 A;  4NXB A;  2DO7 A;  2GA2 A;  1M1E B;  4FE7 A;  1XX5 A;  3JRH A;  2VQL A;  2VGJ A;  5G4Y A;  1DPU A;  3MS6 A;  1KBC A;  3CCE I;  2COM A;  4CCL A;  2D01 A;  3W8K A;  3ZVS A;  4PKY A;  4IQ4 A;  2HOE A;  4M9Z A;  3I4N J;  1W63 Q;  5HWT A;  4GXO A;  1OO9 A;  3SDB A;  1L6J A;  4R4R A;  1FSE A;  5D3C A;  4BBR J;  2O99 A;  2CU7 A;  4LV2 A;  1V3F A;  3CMZ A;  3VE3 A;  1P9W A;  3GO5 A;  2EZK A;  3ABL H;  1YW9 A;  3J80 K;  4CA0 A;  3ONQ A;  2GX5 A;  2L4A A;  4WXC A;  1OJL A;  2CQQ A;  1G3S A;  1ON2 A;  5CJ9 A;  4QTR A;  1LLB A;  1GHI A;  2WK0 A;  3EGD C;  4JGQ A;  3S3N A;  3LQR A;  5L09 A;  5BS6 A;  4FU4 A;  1GE5 A;  1S7E A;  2OI0 A;  4QY5 A;  1F36 A;  4BAY A;  4CLC B;  2FX0 A;  4HF1 A;  1D1B A;  2IBD A;  3IF6 A;  4OKP A;  4EEU A;  1E3H A;  1OCO H;  2JA8 J;  3BQ8 A;  4AYB N;  3MXS A;  3NOU C;  3V4G A;  4OIO F;  1T19 A;  2W85 A;  3BG3 A;  2LC2 A;  5EEH A;  3FKJ A;  5M18 A;  1R58 A;  1GXD A;  3C4O A;  3VWB A;  2JHE A;  3DPF A;  1BA5 A;  2Y4A A;  5LGN A;  1FR1 A;  5IT9 K;  1I1S A;  1DP8 A;  5IHV A;  1GXQ A;  3QU3 A;  4OIP F;  1JI8 A;  2DOF A;  4KIG A;  4XKB A;  1TWA J;  1Z6R A;  3KP6 A;  5FD6 A;  3UE1 A;  3CJQ B;  3ECH A;  1O07 A;  1T0F A;  4WZ4 A;  1UMQ A;  4QD4 A;  3S8P A;  1T95 A;  2EX6 A;  3LO7 A;  4CXF A;  1L0O C;  1XPX A;  2ZM2 A;  5I2Z A;  4I3A A;  5GAG J;  5IP6 A;  3DKY A;  3KZI C;  2IS2 A;  2VLG A;  4Q0I A;  5FJ8 J;  4EV4 A;  2BVM A;  4WL9 A;  3PBO A;  2H8R A;  1D8M A;  2FUG 2;  3R61 A;  4IEJ A;  1E3U A;  1YYV A;  1XGJ A;  3T4Q A;  2DA7 A;  2JUG A;  4EJT A;  1FIL A;  4DJ3 A;  3BA0 A;  4V19 K;  1JXS A;  4OQI A;  1YE9 A;  3I7J A;  5E2E A;  2LF8 A;  4JP4 A;  3GTQ J;  1RR7 A;  2XIG A;  2VB6 A;  4A3D J;  1ZGW A;  2J3W A;  1Q1V A;  4YIR X;  3OYB A;  1SFU A;  1YLY A;  2WBM A;  5TGT A;  5LGU A;  3OS2 A;  1BTL A;  3IXG A;  1Z67 A;  2K4B A;  4L18 B;  4JX4 A;  4J19 A;  1N9O A;  3UDI A;  4BJP A;  3HBR A;  2QQA A;  5AVF A;  3G4S I;  2DMP A;  4HRI A;  2FBK A;  3F72 A;  1E3U D;  2EFO A;  4BU2 A;  3G2Z A;  3TE8 A;  2NS7 A;  3O64 A;  2V1B A;  3PM1 A;  4KIF A;  1ETK A;  1SKF A;  3SDG A;  4PCQ A;  1UHW A;  3E97 A;  3LNQ A;  2PG4 A;  1R9T J;  1T38 A;  5C3E J;  3DTE A;  1ALQ A;  1S6R A;  3IWQ A;  3F23 A;  1YOU A;  4MEX F;  4KT6 A;  4E3N A;  3NAU A;  3DNG A;  3H9J A;  4YIN A;  3WTS C;  1PWU A;  2XAF A;  2V4B A;  5EOE A;  2ACJ A;  1LVK A;  3KLO A;  4DGW B;  3OSF A;  5CVU A;  1MBF A;  4P87 A;  3OBF A;  3VYR B;  5LFA A;  2OZU A;  4L63 A;  3X2Q H;  3MKZ A;  2JC7 A;  1NYY A;  3P5J A;  3M3Y J;  2IWB A;  4HP9 A;  1YRN A;  1K57 C;  5AQ9 A;  4EUZ A;  1ROS A;  4I35 A;  2L7M P;  4IRH A;  4YIF A;  2F2E A;  3F8F A;  3SEZ A;  3HHH A;  3UNG C;  1YIT I;  2RN7 A;  4ESJ A;  3CUE C;  5DS9 A;  3WWX A;  3WE2 A;  1CEG A;  3LI9 A;  3IAS 2;  3I56 I;  1H3Q A;  3NCK A;  1BKC A;  5J6X A;  3G4P A;  4WYY A;  1XGO A;  5L8M A;  4PUS A;  1R22 A;  4MNR A;  3SS5 A;  4CJN A;  2KRC A;  2DW4 A;  3I0T A;  1W4M A;  2IS1 A;  4MMN A;  4LEN A;  1TVI A;  4XBH A;  4F3L B;  1CK7 A;  3KE2 A;  5DTK A;  2LB5 A;  2XPU A;  1D8J A;  2VK3 A;  4DJ2 A;  3EDZ A;  3W2V A;  1DQU A;  3DCF A;  1BZA A;  5HS7 A;  3OR1 C;  1HQC A;  4E7K A;  3S22 A;  2BLS A;  1P7I A;  1K56 A;  2DN0 A;  1HF0 A;  4E7I A;  4IBR A;  2NUP C;  5LHH A;  1D3Y A;  2W57 A;  3KYE A;  1OCC H;  9ANT A;  1YLF A;  4MN6 A;  1XMK A;  1LE8 B;  3S1N J;  3N2U A;  2ELK A;  1K25 A;  2BAS A;  3FDY A;  4FH4 A;  3HOU J;  1GT0 C;  4XBF A;  3DW0 A;  4YNR A;  3WS5 A;  2D2W A;  4IKF A;  2QQ9 A;  2W7N A;  5IYD J;  1ONG A;  2J3T C;  4FX0 A;  4HV5 A;  2GZA A;  1BIB A;  4ANJ A;  1F1Z A;  1USN A;  5DDG A;  1U5T B;  4ILW D;  3DPE A;  1LFP A;  4AM3 A;  2JKG A;  3CME I;  3O8H A;  3GMW A;  2WC2 A;  2XAU A;  2ZD8 A;  4KQQ A;  2HU6 A;  1KVL A;  2CUJ A;  5J40 A;  3LIE A;  3ZR8 X;  4IVI A;  3ISG A;  2O3E A;  4A5N A;  1HBX G;  3MFK A;  3O6B B;  2BV6 A;  3IF6 C;  3ELK A;  3IWI A;  5MC7 A;  1GUU A;  3HEF A;  1S6L A;  3QNC A;  3FMS A;  2L9N A;  4BDY A;  1J75 A;  2P0W A;  5FI7 A;  4DF9 A;  5ICF A;  1YHQ I;  4L5E A;  4HJ3 A;  2QLZ A;  1UHS A;  1Q1H A;  2CW0 F;  1UST A;  1FLI A;  3R7W A;  2DYR H;  4FQG A;  2IA0 A;  2LY1 A;  4FT8 A;  3ZRG A;  2OC6 A;  4C9Y A;  5JLW A;  3K70 D;  2JKT I;  2V9K A;  4RAY A;  3NHQ A;  4CCN A;  3O8G A;  4IF4 A;  4A3J J;  1JKO C;  1JTD A;  3LMM A;  3FM3 A;  4GGG A;  2ZQC A;  2FJ1 A;  2P5V A;  5JFR A;  3CCL I;  1E0E A;  2DDF A;  2OY4 A;  2VQG A;  3VSK A;  3TED A;  3PUB A;  4E7L A;  2E34 A;  3HIF A;  1XGI A;  2LKX A;  3OYN A;  2HR3 A;  1Z7L A;  4NB5 A;  4P5O A;  4CYC A;  3HLF A;  3DSL A;  3NWT A;  2XGX A;  2JPB A;  5DEQ A;  4E7Z A;  1ON1 A;  2P9V B;  2W3G A;  5E2H A;  1YLP A;  2LDU A;  4XKC A;  3T4J A;  2GDN A;  3PBS A;  4UVA A;  1NG6 A;  2VGL M;  2JRM A;  2HP5 A;  4WEL A;  4E3O A;  1JT0 A;  2PBY A;  3BEB A;  3PHY A;  5L2F A;  3GYH X;  2YB9 A;  3AYU A;  2JA7 J;  5FDH A;  1L3L A;  3CO7 C;  2GNX A;  5F69 A;  4Q1L A;  3VMA A;  1XN7 A;  2ZBK A;  5FI6 A;  4DDY A;  3BR3 A;  3MQO A;  1JIW P;  5DCM A;  4GD8 A;  1TLH B;  2GZW A;  5E1Z B;  1B1B A;  4PKU A;  1DRM A;  5FLV A;  2O36 A;  4PKT A;  1MBH A;  2J7V A;  2W84 A;  1SLN A;  3F18 A;  4C3J J;  5FFX A;  3J7Y J;  2PD8 A;  3CDL A;  4XL9 A;  2KZV A;  2UV0 E;  3D4F A;  1A35 A;  1UTZ A;  4H2E A;  4OP5 A;  4PGH A;  5KHD A;  3HOW J;  1TDG A;  1WSU A;  1XJ6 A;  3IF6 B;  4QPR A;  3CMA I;  5HAP A;  3O88 A;  1G05 A;  2XUB A;  2VE9 A;  4IED A;  2DW1 A;  2MBF A;  4FXY P;  2L2O A;  2O9B A;  2EA9 A;  4BY1 J;  4IJO A;  3OYJ A;  4I76 A;  1T56 A;  3V7R A;  3AG2 H;  2YU9 J;  2EB7 A;  1F9I A;  3TRC A;  1W7P A;  4FOF A;  2HQA A;  2YKF A;  2UUZ A;  2D1O A;  3G73 A;  4XKV A;  4P6Z M;  4GR8 A;  3A0R A;  1EUB A;  5CKT A;  5AIQ A;  2EFN A;  4WUJ A;  4K0W A;  4D7N A;  3HLE A;  3IS2 B;  3H9Q A;  5B1B H;  4YFN F;  3CPT A;  4MFD A;  4RAG A;  1R1J A;  4E6W A;  3DAV A;  2XPV A;  1U78 A;  1ONV A;  3EET A;  4H0E A;  5I3M A;  3QHY A;  4CO8 A;  5IU1 A;  2FFY A;  2RV8 A;  3FXM A;  2B18 A;  1OJ5 A;  5TBM B;  5B1A H;  2K2G A;  2VV8 A;  4GR0 A;  3HJE A;  4L5J A;  2MFZ A;  3SH8 A;  5GPC A;  2X9D A;  3CMY A;  1BIW A;  2ERQ A;  1VQ7 I;  1PZO A;  1FBU A;  2XAQ A;  4XKW A;  1LHY A;  3IHB A;  2N8R A;  3K7N A;  2HOS A;  2LSO A;  4KIC A;  1G4D A;  5GAD J;  4BE0 A;  2ZSH B;  3WS4 A;  4MQV A;  1BI1 A;  1SD4 A;  2L7F P;  4W1U A;  2PMU A;  3M07 A;  3PIO F;  3MXQ A;  4FH2 A;  3A4C A;  2CV1 A;  4DYC A;  3F8M A;  5E1W A;  2D45 A;  1MMG A;  1TW2 A;  2ME6 A;  1ES3 A;  3PBT A;  3BR6 A;  2VUM J;  3GXO A;  2DYS H;  3S1Y A;  4BQQ A;  1JWZ A;  3CDI A;  3SH7 A;  2MJ6 A;  1WGX A;  2Z33 A;  1TWG J;  2XGC A;  4NC8 A;  1QME A;  1MSE C;  2R7F A;  3C7U A;  1K78 B;  4RB1 A;  1FZP B;  4RGR A;  4D0P A;  2C5W B;  1OTE A;  1FSW A;  4L9G A;  2B5R A;  3UPN A;  4GB7 A;  1D1C A;  4GKU A;  3FXK A;  2MAB A;  4GDF A;  4HNB A;  1ERQ A;  1PP8 F;  3UE0 A;  5F1J A;  3OC2 A;  1KUI A;  3GTJ J;  4HF2 A;  1TVF A;  2X1D A;  2O9L A;  2DLL A;  3J7A O;  1R1U A;  1CQT A;  2XVC A;  3NAR A;  4ARZ A;  4BS9 A;  3B8Z A;  1MGT A;  1W5D A;  1PIO A;  2L5Q A;  2V1D A;  1U5T C;  4KZ3 A;  3P9K A;  1IYS A;  1ZG1 A;  1YW8 A;  1V5F A;  2LKS A;  4Z2Y A;  3BFE A;  2JKR I;  1MMA A;  3O5Y A;  4RB2 C;  3DF8 A;  1BKC E;  3RIR A;  4DPE A;  4GFB A;  1ACI A;  1R6R A;  1BT5 A;  1SAX A;  2ZMA A;  2ESN A;  4JQF A;  4EAT A;  4FUW A;  2KRH A;  3P98 A;  2H8W A;  4YOF A;  3I9V 2;  1AKL A;  2R5Z A;  1D8F A;  2M87 A;  4BLM A;  4B88 A;  4P0M A;  4ZJ2 A;  3H82 B;  1HXD A;  1R54 A;  1JKP C;  1OT6 A;  2L9S A;  4HX8 A;  3E6B A;  4Y2F A;  1HZO A;  3Q9V A;  5BQT A;  1RRJ A;  2NS0 A;  3WV1 A;  3JR9 A;  2OQR A;  1OCZ H;  1O3R A;  4ZYE A;  2ZJ2 A;  3CHW P;  2X3A A;  3ZP5 A;  3WGI A;  4EWF A;  4BQO A;  1J9I A;  3WE3 A;  1VQ6 I;  3HKZ A;  3RYR A;  3F1P B;  5IT5 A;  4L9J A;  3LJZ A;  1P9Q C;  2WGV A;  2ZKZ A;  3DEW A;  4UAA A;  2E1N A;  3K70 C;  3ULF A;  3ZQ5 A;  4IN9 A;  5J7E A;  3KZZ A;  1VQN I;  4KT5 C;  2O9C A;  3FX3 A;  4GNU A;  2P5L C;  3BTI A;  5BNG A;  2OTL I;  2Q8K A;  2E8J A;  1IN7 A;  3VB2 A;  1Y1W J;  2JA5 J;  4MCW A;  3HL2 A;  4KZ8 A;  1XUD A;  5CQE A;  4XID A;  1MSF C;  2CV0 A;  1MMB A;  4PJ0 C;  3K3D A;  1U6G A;  3HRU A;  2PR6 A;  3SOI A;  5TJJ A;  4G3V A;  2XDV A;  3BCA A;  1XFX A;  3NEU A;  2WKI A;  3GTP J;  3D1N I;  4PDK A;  2V8C A;  4L9V A;  2QMI A;  1BLC A;  1KQ9 A;  3PO3 J;  5HL6 A;  3DWL E;  1WJF A;  1RR8 C;  2XDM A;  3HL9 A;  4KG6 A;  3KZY A;  3JRF A;  3S32 A;  1SZV A;  3LIA A;  5HPF A;  830C A;  5CVI A;  2ZL1 B;  1XP4 A;  2EBI A;  4HI4 A;  3VP2 A;  4PKV A;  1BBY A;  1FCO A;  3PSI A;  1TNS A;  2J9O A;  1O7E A;  2XHK A;  2FV5 A;  4OLD A;  2DOE A;  4RM2 A;  3M9A A;  1XUC A;  3FXU A;  1QBJ A;  3AG4 H;  2JK3 A;  3BEC A;  1XCB A;  4GLQ A;  4RYE A;  5M1A A;  1RZ4 A;  2LOO A;  3I54 A;  3BCB A;  3I5U A;  4IUK A;  1PWW A;  5E18 F;  3B47 A;  2E5N A;  1MBL A;  1LE8 A;  1ZC2 A;  3WTW C;  3W3C A;  1MJA A;  2ZCW A;  3GFL A;  3RYP A;  5IS1 A;  1MMP A;  1NLZ A;  2CW8 A;  2CUE A;  1FBQ A;  3DFG A;  1IYQ A;  4P9U A;  1N9L A;  4DE1 A;  4I09 A;  4UB8 C;  1UAA A;  4A3M J;  1R55 A;  5H2F C;  3L0T A;  1OFC X;  5KK1 A;  1JWV A;  1P92 A;  4OPZ A;  2H1K A;  2PAV P;  1FY7 A;  1PWV A;  1S4R A;  1T8I A;  5IP9 J;  4JP0 A;  3T5X A;  1H0M A;  3ZQC A;  1FOX A;  3UR3 C;  4BMW A;  2HGC A;  3CCY A;  4RB0 A;  1XGN A;  1VQ9 I;  2B9S A;  1FCM A;  4DNC A;  4ITV A;  3AL0 B;  4XLE A;  2FH5 A;  3FV7 A;  1MW7 A;  2KIM A;  4IHW A;  4FD8 A;  2WB1 N;  4FTX A;  4R70 A;  5L10 A;  3TBI A;  4Y5F A;  5DKK A;  3NUL A;  4UUS B;  3LKA A;  3Q82 A;  4IUH A;  5CVR A;  3LIL A;  4A2U A;  1IRZ A;  1JWP A;  4AIK A;  4OMY A;  5CLS A;  4Y3I A;  2FQ4 A;  5GLB A;  4G6T B;  2A68 F;  2NNN A;  2D1H A;  3F22 A;  4HLY A;  1ZTQ A;  2WO9 A;  4ZH4 F;  2O8K A;  3H9G A;  1I39 A;  1Y28 A;  4MBK A;  5EVL A;  2M0M A;  2VJW A;  2W25 A;  1PUF A;  2JVH A;  2GA1 A;  5EEC A;  5F68 A;  1YJN I;  2LVS A;  3IV5 A;  3G2Y A;  3NQO A;  3PYP A;  1ZVX A;  2QCO A;  4JF4 A;  5I0L A;  2H0T A;  3W2Z A;  1CXV A;  3LSI A;  2FZ0 A;  1Y93 A;  3HPH A;  4BWI A;  2HPI A;  3QOP A;  5K5R A;  5EVI B;  1QQI A;  1WRJ A;  1O3S A;  5IYC J;  1WQ2 A;  1V9Z A;  2ZC7 A;  2RQP A;  1WJB A;  1TQI A;  3KPH A;  2KOI A;  2PHY A;  2PD7 A;  2ZC5 B;  5EGO B;  4EBL A;  2V1A A;  2DW2 A;  4HX3 A;  3IXB A;  3ZGA B;  1X19 A;  3ESW B;  1XSV A;  3MD2 A;  1VQK I;  2KHM A;  4QKZ A;  1U0J A;  3G32 A;  5G4Z A;  1ZGJ A;  1ES2 A;  2W1T B;  2QKP A;  1OTI A;  4MIM A;  1G49 A;  5KAF C;  4DOZ A;  3AAF A;  3GDI A;  2JIH A;  3CES A;  3S17 J;  1FEX A;  3LCE A;  1O57 A;  2R7O A;  2XPW A;  4BXF A;  3FZV A;  4RDU A;  1REP C;  1ETO A;  4LV0 A;  4Y0U A;  3GEZ A;  3VEP A;  2M2E A;  3ZMU A;  3ZMS A;  3L9K A;  2WV0 A;  2FA5 A;  2HP9 A;  3FKW A;  1Y8Q B;  3WS2 A;  1I1G A;  2QSH X;  2EXA A;  1S7O A;  2MD0 A;  3HUG A;  3CC7 I;  2WKR A;  4HIA A;  4Y7P A;  1RMZ A;  3A1Y A;  4XXR A;  4L9E A;  2PJP A;  4QWQ A;  3V39 A;  3OYM A;  4KZ9 A;  3ZQI A;  1RKW A;  4BY7 J;  3HTS B;  5L3G A;  5J1U A;  3BTJ A;  2PBI A;  2RNJ A;  2P5K A;  4FET A;  4KJZ A;  3VPR A;  1JAO A;  4C2M J;  3CLO A;  3FXQ A;  4A6D A;  3W6K B;  1W36 C;  2K9N A;  3MZD A;  5HDC A;  1SMT A;  1SLM A;  1SD5 A;  4XRM A;  3OV8 A;  4BGD A;  2G0E A;  4DD8 A;  2K85 A;  4ENJ A;  1E2X A;  4KZ4 A;  3TKY A;  1UWN X;  3MR0 A;  3O3K A;  3FK6 A;  5F6