3DTIA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
243
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSLTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
molecule keywords IRRE protein
total genus 73
structure length 243
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtiA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtiA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtiA01
3DTIA 3DTKA 3DTEA
chains in the Genus database with same CATH superfamily
4L9NA 3M1CA 4X6AJ 2VV8A 2ZMFA 3D5RC 3F8BA 4F3QA 3AYUA 4CH7A 1KUHA 3F21A 4H4KC 1D8JA 4AIKA 2HYFA 2GJ3A 3MMYB 3H7WB 3P09A 1YQAA 4RA2A 3F16A 3E0YA 1OYWA 2LD5A 1B6AA 4EETB 1O3RA 2X3BA 3WS1A 4KZBA 4FH2A 3ABKH 2VXZA 3P98A 3SH9A 1J0RA 1XTAA 4NBQA 2DPDA 1IELA 4ESFA 4EW7A 5M19A 3MR0A 2DW2A 2DOFA 1PUFA 4XSXF 2PMZA 3R0AA 2R5YB 3VOEA 3IX4A 5J3LA 5LLQA 4QU3A 3UMEA 1QHGA 2FX0A 5KSHA 4UY8I 1UHSA 1Q2QA 3LY4A 1EH8A 4DV8A 3WTTC 3KFWX 2JKGA 1S0WA 5BOHA 3CUEC 4IBXA 4FASD 4BEHB 3GFMA 1FMVA 5TR7A 2KIQA 1HY7A 2JA7J 2KP6A 4A2UA 2LOOA 3IQAA 1Y0UA 2DJIA 4N9IA 1U9NA 1IV6A 1B8IB 4G3VA 3H36A 2IGNA 1GXQA 2XGCA 3ABTA 3NEUA 2Y2KA 2Z2MB 3VP0A 1XUCA 3BC8A 1ZN2A 4I3JA 5JVTA 3T1QB 1PRQA 1W36D 5EVIB 1TQPA 3K4KA 1TNSA 1YOVB 3OS0A 1TQIA 2ZL1A 4PFOA 2DDFA 1W7PB 4EQQA 2K9LA 5FKNA 4KZ9A 2D2WA 4K2EA 4DPEA 1A6IA 3E5XA 5IYCJ 5F6AA 2YB9A 1L3LA 3GTMJ 2OW1A 2NS7A 3HOXJ 2Z3YA 4O5VA 3NIAA 3HBUP 2ZKZA 1XJ3A 2V1BA 2J3TD 3RH8B 3D1NI 3O5YA 1AYKA 1I2WA 5A8BA 5IP7J 2Q2EB 3WTWC 4GKUA 4PKQA 4HY8A 2MLGA 4PGHA 1JJ9A 4RAGA 2OAQ1 2KIUA 4NG2A 4CGZA 3WRTA 1N4OA 1OQYA 3F8FA 5TGTA 1YLWA 2ZCWA 1OYYA 1X1PA 1LNWA 4EUZA 3SEQA 5J8XA 1W79A 1YLTA 1TC3C 3JAMK 1UZCA 2BBYA 3MAJA 3O87A 3ZNYA 1U0JA 5GHXA 2X6YA 3CMEI 2XC7A 1EJ9A 4LENA 2COBA 4IHWA 3MKLA 1IJWC 2JA8J 4MMNA 2W1OA 2W15A 4F94A 2M0MA 3RPUD 3L2UA 3B6CA 5HWTA 4PM8A 3WG7H 2CJJA 3PQJA 2ZMVA 1YG2A 3MKFA 1BR2A 3CCVI 3M8EA 3OYDA 1KDSA 1XJ6A 1LE8B 4ARZB 1TWFJ 2EZIA 2R5ZA 2PJPA 3E6MA 3G35A 3HRUA 4S2LA 3G2BA 3IC7A 2HOAA 2IS1A 1SMYF 4IUHA 4H3XA 4J00A 4X69A 1TT0A 4BBUA 3CMMA 3AKZA 4A0YA 2YX7A 2F4IA 3W6KB 3OYJA 4KIFA 2AIGP 1V5EA 3BFEA 1UEAA 2MA3A 2PMZN 4PJNA 2PJRB 4QLCU 2R9WA 4PJLA 5HPIA 3V8JA 3HTSB 4EJWA 1A04A 1WQ2A 2X48A 3GF2A 4FT8A 2BV6A 1S5LC 2XPUA 3FMQA 4XORA 3TW6A 2CFOA 1TW2A 2NNYA 3HOSA 1ZR4A 2R93J 1XUDA 3CC2I 1TL8A 2F4OB 3H9JA 1FP2A 4F92B 3S7OA 5ILVA 5KNLA 5CHUA 1CGPA 1PP8F 2WGWA 5FQMA 2JUGA 3WE2A 2ZM0A 3IWIA 3T4LA 3BP8A 2WB1N 5J40A 4A3IJ 4JXGA 1DTHA 3TT4A 1O57A 3OR1C 4PGGA 5IT9Z 1VM1A 1MNCA 2Y9YA 3OOUA 3WGHA 3BFCA 4BJPA 1BM6A 4NC6A 3FV7A 1MWTA 1ZG3A 2RGVA 3CC4I 5HW3A 1GA9A 3HIFA 3WTZA 2Y59A 3K0LA 3L2QA 4IUKA 1HV5A 2CKIA 5M3FJ 4BQMA 1ALQA 4CCNA 5F04A 1R1VA 2ZD8A 1JTXA 3QP8A 1JTDA 3KZIC 3RKQA 3HLFA 1OCRH 2OWHA 3HJEA 4HV5A 1IC8A 4EJOA 2WZZA 3HPGA 4BY1J 1OTAA 2DPUA 3EQUA 1R00A 1H71P 2Y6DA 1I50J 3ZCZA 1BLHA 3IXHA 4Q0JA 2GZWA 1VFCA 2IT0A 3GCMA 3TOAA 4EU0A 2CUFA 5KK1A 1QGPA 3E98A 3SFIA 4R0QA 3HY9A 5DM7F 5E3OA 2JE5A 2R9XA 1VNDA 4L18B 4BQNA 3T1BA 2Y9ZA 3MKEA 3LSTA 2HV1A 4FSFA 2E1CA 1BR4A 2CUJA 2JPCA 5K5RA 4R79A 4A3EJ 4OU0A 1ZRCA 4H2EA 4J4MA 4X56A 1AKHA 1HF0A 3P9CA 4HQMA 2VA0A 2Z6DA 1S7OA 4HOBA 1P4XA 4I0AA 2XF5A 2MD0A 3LSGA 4NC7A 4UVAA 4BBRJ 3J80Z 3LSRA 3JRIA 1GXPA 2A5YB 1IYSA 2LVSA 1W0TA 3QNCA 2ZLYA 4KQOA 4WZ4A 2W3HA 5CX7A 4OOIA 4H82A 3IRRA 2Z33A 4MTEA 1KU2A 2E5ZA 1YRNA 3FK6A 1S4RA 2IGMA 3HOTA 3ZG9B 1C3IA 3DPFA 3WU1B 1Y39A 2VBZA 3I55I 3WTYC 1QUAA 3HOWJ 2RV8A 5FROA 4WCGA 2DTRA 1J9MA 2L9SA 4IZZA 2PHYA 3COAC 2TCLA 3DSLA 4I76A 1NXYA 3VI1A 3I59A 3KZYA 3L2CA 4XONA 3ZG7B 5K7FA 4IQ4A 3ZN1A 4AVZA 4DN0A 1BKCE 3JVUA 1MMAA 2R7SA 1YOUA 2GQQA 2HXOA 4P9FA 1ZXVA 1S72I 1DGRM 4HX3A 1K6OA 4RYEA 5J1RA 2BVLA 2J9OA 1PWQA 4R1GA 3C8CA 1UJ8A 2VJIA 3LSHA 3Q9VA 5ICCA 3CD6I 1BIBA 1BA5A 2QSFX 3KP6A 2EIJH 3HBLA 3BLMA 3SJMA 2GIZA 2QKMB 4YFXF 1LVKA 2LF7A 4PM6A 1EB6A 3CUQA 3RTSA 5CXAA 4II2A 3ZP5A 5L3DA 2K4JA 4EESA 3L09A 5D4SA 4N1XA 3TVCA 3P7NA 2EFXA 3F1PB 4L5EA 3NBLA 2VB6A 3CF2A 4I6ZA 2ZMEC 2ZMEA 3A2KA 4EGZA 3I4NJ 1PNEA 1Y54A 1N9OA 4WEJA 2X6XA 3B33A 3LYXA 3BY6A 3PO2J 2PG4A 2HP9A 4KQDA 2M1CA 4DKIA 3LEAA 5B3SH 2YUFA 2XF7A 2QUFA 5EZHA 3ZG8B 1NRFA 4EEUA 5CRFA 2Z16A 1IKGA 3U2AA 5FKKA 4EWFA 1IXCA 5A93A 4WF2A 2Z5UA 5DJUA 3VYTB 1O0TA 4ABZA 5CPRB 4B43A 1RGYA 4UEYA 2RNJA 3D0SA 5FFZA 1H88C 3VFHA 1QMEA 5CLSA 4BU2A 4Q1LA 4XKWA 4IX7A 1ES5A 2OF7A 4H49A 1T1AA 5DJTA 3UB6A 2RC4A 1LUJB 4RS8A 3HBRA 4BL3A 3IUOA 1Z05A 4ZDPA 1LEBA 2P81A 4ZJ2A 4N1HA 2M87A 2Z2DA 3L0TA 4HF0A 3CMYA 2FQ3A 2HQ5A 2VGLS 3FXKA 3V3RA 3PBNA 1Y28A 4BMWA 3V8LA 3HVFA 1EI5A 1HQCA 5IT9K 4WWCA 2M30A 2QJ7A 4U0TA 1WVRA 4KZAA 2WV0A 3GECA 1ES3A 3TSKA 3UE3A 1Z91A 3LSJA 2OV5A 1B59A 1TTYA 1YW7A 2M1BA 4LOCA 4OQGA 4F55A 3CQZJ 4HMAA 1T8IA 4AD9A 4DF9A 2DMNA 4ZZLA 1U5TA 1X3WB 4LV3A 5D3CA 4HI4A 2V4BA 2QHKA 3ZDJA 2GXAA 1YKDA 3I9V2 4XLPF 2JKRM 3RJPA 2L1MA 4O01A 2PBIA 5BS6A 2QJ5A 4ARZA 4CDGA 4KIGA 5CQGA 4OMYA 1O07A 2UZKA 2D45A 5ICFA 4A0XA 3HDDA 2J7VA 2WGVA 3F1NA 3W4QA 1S9HA 2HYJA 2STTA 1PW1A 1ACFA 3QRFF 3FC7A 3CUEA 4JP0A 3PAEA 4HX8A 4UAAA 3GV9A 1HA8A 3DBLB 4N9KA 1SFOJ 2MLSA 4K08A 2D1OA 2KDOA 4CLCD 5A2QZ 1JWZA 3E2LA 1MBFA 1OTEA 3IHBA 1ERMA 3HYGA 3BLSA 3RQIA 4MGRA 1FTZA 4OOYA 3ZG0A 2PD8A 2DJNA 1RETA 3E1SA 1AKLA 3DWLE 3HTUA 3ZUKA 4KZ4A 1BBYA 4P5OA 4I3IA 1U78A 1R58A 2VK3A 1K0KA 2ZC4B 2CQQA 4I7HA 4A3JJ 4RB0A 1ZLKA 1Z6RA 2IW5A 1K6RA 4ZYHA 1BUEA 1WJBA 1CEFA 2DA5A 3QOEA 1I73A 4ZYEA 4H84A 1NJ4A 5BPAA 3ZMDA 1ULYA 3WGGA 2WKEA 2WY8Q 2ZOIA 1WE4A 1W7PA 2E8JA 4AXQA 1XJ2A 5I5LA 3CCRI 1S3JA 5L3FA 1H89C 5FQ9A 1SATA 3D5SC 3CUQB 4EM2A 4KNYA 1A6QA 3K4NA 1V4RA 1MWSA 2KOIA 1PI5A 5GLAA 1FBUA 3MZDA 4DOZA 3T0YA 1PWUA 5FLXK 3ZNTA 3ZVWA 1GVDA 4R8HA 3V8KA 1R1UA 1PJRA 3JW4A 3PFYA 1P4AA 3KEOA 4HNVA 3IXDA 5GL9A 1Z3YA 2XIGA 4KUOA 2KRJA 3E6DA 1X2MA 3PUBA 2EX9A 2BYVE 2BE5F 2VKVA 1WYCA 2MZHA 1Z9CA 1FCNA 4EGYA 1BZSA 5CTNA 2EWVA 3I59B 1H3QA 3LR3A 2JRMA 2GA1A 1RCJA 5AIPA 5DDGA 4GZBA 1T38A 4JP4A 4AUXA 4CXFA 1FSHA 1OCPA 2LG4A 2X4HA 4B8XA 2CLTA 2F5CA 5I0LA 3DEWA 2R5YA 3PQKA 2DT7B 1S67L 4DIQA 1W63M 3MD2A 4JBFA 3HOUJ 1SKFA 4IN9A 4XN3A 1WJCA 3ZMTA 2CS3A 3LQRA 1I3QJ 3J7ZI 2EV6A 4XKVA 3RTRA 2PI0A 2MJ6A 3L9FA 4JX5A 5C4XJ 1SFEA 3HLCA 4BEHA 2CW7A 2ZQ9A 4GWMA 3T4SA 1SC7A 3DAVA 2IA2A 4I09A 5L3BA 5LD2C 1U9OA 4CCJA 3BPXA 4BJTA 4YG2F 4WK7A 1ZKJA 2V0UA 2Y2IA 3F18A 2WAFA 5LGNA 4OLGA 4LCMA 3T1RA 4GW9A 3ZXSA 1EA3A 1JT6A 3K10A 3MXQA 4QIWN 1FBSA 2IS2A 5EVIA 4HEFA 1NK2P 4U7DA 4AYKA 1FILA 2C5WB 3S3NA 3A01A 1HBXG 3KO6A 5AONA 4DXCA 4CZZA 2FBHA 4G12A 1PWCA 1YM1A 3QHYA 1V5FA 3BG7A 3AL0B 1VEUA 1JK3A 1XC5A 3AGDA 2LC2A 4UXNA 1P2FA 3W4OA 1TS0A 2R78A 4S04A 4HH2A 4Y15A 2OLUA 4ZAMA 2ELHA 1ZKGA 5D6FA 1MWUA 3Q1FA 3HGGA 2B0LA 1HTDA 2DMQA 2EPFA 1F98A 2B02A 3VFFA 2PAVP 1OTDA 2PQ8A 2FXAA 2V0WA 1R36A 1PVEA 2UWMA 3T4KA 5E8GA 1GE6A 4G0DA 5DUKA 3J7YJ 3EWKA 5H8XA 2OSUA 1YLYA 4NNJA 3CKIA 1YX3A 3A01B 4AFIA 1LSWA 2DMUA 3ISGA 1L0OC 1IAAA 3K2AA 5LEJA 2WGIA 1R7JA 4Z2YA 3NC8A 3QP4A 5D7WA 5DUIA 3LA3A 2X7MA 4AIJA 2XAJA 1SD6A 4N0BA 2HZ5A 5F5YA 3EOIA 3U1KA 3H35A 2VQHA 4ETSA 3HJIA 5EFWA 2LYCA 1PFLA 2DA6A 1XX2A 3KYCB 1IXRC 2ZBBA 2A2LA 3X2QH 3SYTA 4FX4A 5HD5A 1DP6A 1MMNA 4JGQA 1ZK8A 3CCUI 1EF4A 2VT3A 5CUHA 3L2RA 1IABA 5CVJA 1NK3P 2V1XA 3DW0A 1IADA 4IJAA 4O8GA 3VDXA 3BY9A 3TSGA 3JTHA 1HOVA 5F0FA 3BFDA 5K5OA 3KE2A 4ZYDA 3IAM2 5DTSA 2L2OA 2XRNA 1WJDA 2F5VA 1ETOA 3DKYA 2JSPA 2E2JJ 3TJZC 2QM3A 1JE8A 5GAGJ 1N25A 4WMCD 4WYYA 2WKQA 1ETWA 2OC6A 3F0CA 1ZTQA 2X02A 1IV8A 2LBFA 2WA0A 3BZCA 2ZJPF 3LA7A 3FWLA 4WMCA 3RJUA 4HBTA 4DDSA 3E5UA 1W36C 3CJMA 3ECOA 2M7BA 4EEFG 2VJWA 4B47A 2I47A 4BHCA 1P97A 3IH3A 4JXVA 4XCTA 1SCWA 1HFSA 3JYIA 4G9LA 2HS5A 1S1ZA 4LV1A 2OBPA 3L00A 1XGJA 4KQRA 3LIDA 1UFMA 2ADUA 2L9VA 4FE7A 3ZMUA 1YO5C 1GVJA 1K4SA 1XCBA 2MD5A 3FXRA 2H09A 3CJRB 1ERQA 1JJ8C 1HVBA 3KSFA 4XT2B 1JAQA 1WNIA 2XGNA 3H9GA 4CYCB 4G6TB 3OOVA 3QYEA 4P0MA 1UG0A 2JJ7A 5TISC 4XBFA 1YX5A 2E1MC 4UUSA 3E6CC 4L0YB 3HGYA 5HAIA 4RB1A 1YYVA 4V19K 2XD5A 1J5YA 3N2UA 4AYBA 4DBQA 1JHFA 5J4VA 1AWCA 2E5NA 1RKWA 3GR2A 4XSZF 3MQQA 4HIAA 1PWWA 2OI0A 2LBFB 1A35A 2NUPC 3HBVP 5L79A 5CEDA 1A36A 2QBYA 2UUZA 4WXHA 3FYZA 2GOMA 3CUOA 2UV1A 3TP0A 1WYBA 2CV2A 4A3WA 2BTFP 4CHUA 2XASA 1ATLA 3MN2A 3I54A 1Z6FA 1ZG6A 3B8ZA 1EH7A 4BY7J 2X6OA 3BYDA 1ZTUA 3HB9A 3UB9A 4BYYA 3WTXC 4HX4A 1XSVA 4MTDA 2TRTA 2HDUA 2KDKA 2KZGA 2V2FF 3MXSA 1XFWA 3LE9A 2VV7A 3S93A 1BOBA 1HDDC 1G05A 2OXWA 4ZTKA 5D4RA 4P55A 1ZR2A 3W2ZA 3M07A 1H9TA 4NUBA 4ENMA 2D1NA 4EFSA 5CTMA 1ONHA 3F8MA 2POJA 5FD6A 1V9YA 5TFQA 2YS9A 4L0LA 4KZ3A 1IZ1A 1X2NA 2KDZA 3LICA 5HLTA 2ZC6B 4LD5A 2V6CA 2HPIA 1X1CA 3DWZA 3K2NA 4GUYA 2K7LA 2XFSA 1IN4A 3GQZA 3LI9A 4H6JA 2ECCA 1YJNI 2ERQA 3W6VA 3G4PA 1JVJA 4N9HA 3PUFA 4UVCA 1ON2A 1P4WA 3PIPF 2B95A 3SEZA 4E7SA 5FI6A 4KA4A 3UPNA 1N77A 2A5WA 3N7WA 2RCXA 3OPLA 4L9FA 2CQ7A 5IT3A 1OMEA 4DW6A 4ASNA 2HJ9C 4GHIB 3A3JA 4P85A 3TP3A 3CLQA 4EERA 2HKXA 2OD5A 2P7CB 2NYXA 4EMSA 2HDSA 4L7AA 3MQ0A 2OVZA 2PT7A 2HFHA 2EB7A 4DYRA 3OSGA 2DXIA 3KX0X 4GD6A 4MBKA 1CK3A 4P87A 1TT5B 2M8GX 3VE4A 3LMCA 2E19A 1DJAA 2A6EF 5CVRA 1N9NA 1P9RA 2CQNA 2ACJA 3UY6A 3CPTB 3RFBA 1MBEA 1YLPA 2M4GA 2W00A 2XGXA 5M5YJ 3E8RA 2QQBA 4Q5SF 3L7WA 4KUMA 4G94A 1JJ6C 2XS4A 4CCKA 1OJLA 1WJEA 3M2JA 4GS9B 4IBRA 1E3PA 3OIOA 4PAUA 2M8EA 4DRTA 1AF0A 1MC0A 2VUMJ 3LSMA 1R4NB 2D1HA 5FB2A 3ZOBA 3UB7A 3KCCA 3NWSA 3HDAP 2HDRA 2HQAA 2OA4A 4MEZA 2MLRA 2LKSA 4HG2A 4E7IA 5LBQA 4LRZE 2D5VA 2J5OA 4NXEA 4X6TA 5DF7A 3UNGC 2WC2A 5KAFC 3BR0A 4E6XA 4E3OA 4EJTA 4EQIA 4V2FA 4OPQA 1I2SA 2L7FP 3USNA 1E3HA 2H94A 2C6WB 2DQLA 1D06A 3B3XA 1GKCA 4ON1A 3GW2A 2DODA 5FSRA 4IEJA 1K57C 3ERMA 3EHXA 4UUTA 4ZYAA 1ZYRF 2ZQDA 3MF0A 3DU5A 1PP7U 1TF1A 2LF8A 5J8FA 2MH9A 4GR0A 4XT2A 4A12A 2K7SA 4IF4A 3A0RA 4E6WA 4GR8A 1FOYA 1IYPA 1QVTA 2DI3A 3MA2A 3S1QJ 4L6TA 2P9VB 5HL1A 3PBTA 1Z0XA 2E3XA 5EPHA 3DWKA 2ELJA 5GLBA 4FTXA 1JH1A 3OR2C 1O7FA 5I94A 3OYLA 3A0BC 1CQAA 3CMZA 1T2KA 4FCFA 4ZJ3A 3W3CA 3MSHA 1N9LA 1JGGA 1R1IA 1KGEA 5M5WJ 2B9SA 2XRLA 4S2OA 3CG5A 5D3OA 2Y2HA 4XXRA 1PIOA 2JRTA 4JPAA 4RGXA 1EAKA 3C7VA 1FOFA 2CW0F 1LEAA 2W24A 2EFQA 3AG4H 1E4DA 2J9PA 4E3IA 5DCMA 3S22A 4JXWA 1G4DA 5EGOA 1XA1A 2EZLA 3G1MA 5FA7A 1YJ9I 2A24A 1RGZA 1E17A 3Q07A 3JRBA 5EUAA 3S8PA 4JPMA 3TE8A 5BNGA 3MZHA 3IBJA 3AIGA 3KLOA 1JIZA 2J0TA 3BCBA 5LGUA 1IN6A 1FOWA 3A0VA 2ZJRF 3V42A 1MMRA 1IAEA 3ASNH 4BQQA 2JA6J 4XBHA 1JKRC 3U9GA 2AQFA 2W13A 4M3DA 3KP4A 1B8YA 1MBGA 3KMCA 1IXSB 1W5DA 3NOPC 3SDGA 1H8ZA 2DDBA 1ITYA 4KMUX 1EWZA 3AL0C 1XMKA 2XKPA 2DA4A 1J75A 1SANA 3EUHA 5LABA 4A3MJ 4ITVA 3VP4A 3VSLA 4C3JJ 1CGFA 2WAQA 2OU2A 5JI6A 1GHMA 4WKEA 2I10A 4DJAA 3LMMA 4G7HF 1S7AA 2WZXA 4RGUA 2W1TA 2QCOA 1MNEA 2DO7A 1FCOA 4BWIA 3DTIA 3E7LA 4J01A 2X0LA 4BDZA 1IYQA 2PFBA 1W1WE 2CRGA 3G3ZA 3W6JB 2K3FA 4L9EA 1R54A 2USNA 2W0DA 3KEJA 4KJZA 3BOQA 1LSVA 1DP7P 2E7WA 2LP0A 2MW8A 4KT6A 1XMXA 3O2PE 2ME6A 2Y48A 5E1ZB 3EQLF 5B1BH 2V20A 3F1PA 2Q1ZB 4MQVA 5J4YA 3D72A 2O99A 1MBHA 4MN6A 4WF0A 1JTYA 3V96B 1I6XA 3LNQA 1NHAA 3MKWB 5KCMA 4GRIA 4QHCA 3JTGA 5J3WA 3V67A 1X3UA 4PJ0C 5CYVA 3LAPA 3BFFA 2DOAA 4ESPA 4GLQA 3IH8A 4NEED 1S1YA 1R55A 4QB8A 1G9KA 3W4PA 4RBOA 4LRYC 3CITA 1OJGA 3HL9A 3FKJA 4L5JA 1IF1A 2HPBA 1R1HA 2X3CA 5IS1A 3F8CA 2CSOA 2JKFA 3UDFA 3RTYA 2KJBA 5JVGF 5K7ZA 2WGWB 3H82A 4ETXA 2A8HA 3EWJA 3WWXA 3BM6A 1X1AA 2HU9A 2DK5A 1KUKA 3WV2A 3CJTB 3B6AA 4MQ9F 3RKYA 4BH9A 3PL8A 3MFXA 4A3LJ 4FOFA 3EETA 4KN4X 4MFEA 3SQNA 2EFUA 2XD1A 5FLVA 1IACA 3CO7C 2PDRA 2XS3A 1JKQC 3ASOH 4NQWB 4BE1A 3T4TA 4MBFA 5I43A 1KQ9A 3BTCA 2IXSA 1ETQA 3BG5A 1BLCA 2WTEA 2COMA 4L9TA 5KZHA 4A3KJ 2MC4A 2DOEA 4KG6A 1ZELA 4ESJA 3ULFA 3E97A 3A0SA 1BM9A 3MQOA 5F69A 4JA1A 3JREA 1I1IP 1TWAJ 2DW4A 1Y93A 3LQBA 5FATA 1T33A 5GTIC 3MKZA 4Z9QA 2EWNA 2JA2A 2NOGA 2BY1A 1OT9A 2HWVA 3C4OA 5DFYA 3F22A 4ZDLA 3ERED 3R7WA 3TKYA 4UA7A 4KG2A 1M1EB 2VLGA 2XA7M 1FNNA 4OAYA 4GS9A 4X1LA 2VBWA 1LI9A 2R7ZJ 2XAFA 1FYMA 1NY0A 4UUVA 3UVCA 3VYRB 4CSWA 3KEKA 3ZVSA 1O0QA 1QIBA 3Q81A 2A61A 4JYKA 3TBIA 2IS6A 3IT9A 3NI9A 3RYPA 3HLDA 1YFHA 1GKDA 4C3IJ 4S2PA 5FJ8J 2KZVA 5E1WA 1CQRA 4FXYP 4NQWA 1K4TA 3IL2A 3FM5A 2Y2GA 4OPRA 4A5RA 2OW2A 1USTA 2FNPA 4BNCA 5CHJA 2W1RA 1DPRA 1HW2A 4B93A 4MCWA 4NC8A 3V50A 1SKOA 2O5RA 2OCCH 3CZ6A 4JQFA 2KKOA 4HDUA 3BPVA 4FH4A 2BVMA 2Y2OA 2GX5A 3E4QA 4U88A 2CC1A 4HQEA 1A86A 2VBXA 2K2GA 2K02A 1ODVA 1R23A 3E6BA 1GO8P 2MLKA 4FQGA 4DD8A 3V7RA 3FXMA 3W2WA 5E3MA 5F0HA 3NHQA 2FSWA 2XAQA 2Z9OA 4I5SA 4MO7A 3OYGA 1B9MA 3V5MA 4GCVA 1SEUA 2NVUB 2PLYA 1Y8QB 3SW1A 1WJ5A 4B4XA 1MW7A 1U6GA 4RLQA 1AOYA 5LFAA 4YELA 3S2WA 3C7UA 4HW0A 2DA2A 3P24A 5AIQA 2LSOA 1IRZA 1IUFA 1K6YA 3LIEA 1UHMA 3KYDB 1TDGA 2VKSA 1YT4A 3WHCA 5FI7A 1CJFA 3H7WA 3I7GA 2MZIA 3WV1A 4FCYA 4BJ5C 3U1RA 3NOTC 4LV0A 1SD5A 2DAOA 2W85A 2Y0SN 4I01A 3JRGA 1BT5A 1SKOB 2N8GA 3IHAA 3FBIB 1LVAA 2A69F 4NXGA 3AAFA 3CESA 3W2VA 2RJQA 4I03A 3HUGB 1YQSA 2W1TB 3VV4A 2ZMEB 4BENA 2JPBA 1RMZA 3HKZN 2JSCA 5E17F 3VMAA 1AWIA 1IDZA 1U8RA 1IYOA 4X68A 4NXFA 4C75A 4PM9A 3UO9A 1MZBA 1BQOA 1K7GA 1U2WA 1GHCA 1FSEA 1MJ9A 2QZ6A 2Y91A 3WU0A 1CQTA 3LY3A 5EVEA 5I2ZA 4XR6A 1EROA 3LK8A 3K3DA 4MDZA 3F8NA 3GVAA 3MS6A 3C1DA 1QPIA 4XUZA 1B1BA 1NZUA 2O8KA 4DMZA 1W5TA 1BUVM 2VI6A 3H0GJ 2SRTA 1OFCX 4CCLA 3TG9A 4C2TA 1G5UA 5A90A 5D8LB 2VZWA 4AC0A 4JIJA 3SH8A 2VKDA 2ZFUA 5HS8A 2V1AA 4YFMA 1QBJA 3T50A 1QZYA 2F5FA 3CP2A 1TBXA 4Y13A 5IOZA 1LLBA 5GHZA 3F17A 2PU4A 3LJTA 2HTJA 1BZAA 1BI1A 2CH0A 1VQ9I 4B9OA 1OM6A 4EQ1A 1YQYA 1IO2A 1L0FA 4EBNA 4E7ZA 2Q8KA 2A24B 4G3WA 3M4OJ 4L5IA 2P4WA 5HLIA 2L9NA 2C6YA 1HZOA 2GXBA 3AGEA 3S7QA 2A6TA 4WXDA 1E3OC 4EBLA 2BOLA 3ULQB 5JHFA 1YTYA 2K4BA 3MZEA 4MNUA 4IUWA 3FX3A 5GPAA 4HBUA 1ETXA 4G7ZF 2Z2SB 1JKOC 3A4CA 5TGFA 1B72A 2E71A 2M7UA 1XFNA 2BASA 4A3DJ 2WB1A 3BQ8A 1E3UD 2L7MP 4WXCA 4PM7A 2CQKA 4GWNA 2E1MB 1D3YA 2H0TA 2QSGX 2ZO4A 2W3GA 3KHIA 2X71A 1WWXA 2EFNA 2MG4A 1XPXA 5K5BA 2KLIA 2L4RA 5EOOA 3IBRA 4R3AA 1X19A 5B5OA 1FPQA 1W8YA 1RR8C 3B02A 1MBLA 2MZEA 3UR3C 4XLCA 3BG3A 2HVRA 3G42A 3IWFA 3VOZA 3HL2A 3U4LP 1T0FC 1G3SA 3Q82A 3LIKA 3A1YA 2CGPA 5EM1A 1L6JA 3VE3A 4YIFA 3QPTA 1SZVA 4QPRA 3GBOA 4IL6C 2BEOA 4X0GA 4R38A 1K7IA 3FXUA 4D5CA 4GJ4A 1ORKA 2WKRA 4KZ5A 3PSFA 5D1TA 1KZHA 3S14J 3RXXA 4QWQA 3DP7A 3HLWA 1F2KA 1HLUP 1VQKI 2CFXA 2VX8A 3F3XA 2EX6A 2ZL1B 4RA7A 3ABUA 3LSIA 1YJWI 2E35A 3H5AA 4M3FA 1BI3A 3A3DA 1XFVA 3N8RA 1SRPA 1KU9A 4M9ZA 5GAHJ 4XKCA 3FHZA 1ENHA 2KX6A 3BY8A 3H82B 5E2EA 1DP8A 1YE9A 3DQVC 4M4XA 4A6DA 5DKLA 2V79A 1PW8A 2QLZA 4GDFA 2CMPA 4G3KA 4FXQA 1TLHB 4MEXF 2XSJC 2O6GE 1OJ5A 2ZJ2A 3KSHA 2O7OA 4C9YA 3OL4A 2HDWA 2GBYA 1ND1A 3LIRA 3EDIA 4P6BA 2EXAA 1P7IA 2VGJA 4K0XA 2Y75A 2DFIA 3ZYTA 3U1DA 2J3TC 2IP2A 5D5VB 4NB5A 1GSXA 1F4KA 4R3BA 2FJ1A 5IY5H 2BLSA 1IRGA 4IKFA 3NDGA 3QYBA 2HPMA 1DU6A 1U60A 2QPNA 3IWOA 2R7VA 2K9SA 4IHQA 3QNBA 2LB5A 1BQQM 4IHXA 2L02A 2VODA 1XA7A 2K5CA 3CMAI 3HSFA 1KBCA 1Q3AA 1HTZA 4JXSA 3IAS2 4XLNF 4LB5A 2DYRH 4I2OA 5DF8A 3EDZA 3FPVA 4OPZA 2OVXA 2ZXJA 1O7LA 4CO8A 1D0ZA 3BROA 1X4OA 1K55C 1PWVA 3IHUA 4RLFA 1M6KA 2W57A 3ZQHA 2KFDA 2WUQA 5F1JA 1HKQA 4LITA 5LRSA 5FGMA 3QPLA 1F9IA 4KG5A 1S66L 4M3GA 3H9WA 4OP5A 3T8RA 4H6JB 3GFIA 1XGOA 3OHLA 4OP8A 4DYCA 3JPUA 2L4AA 1IN5A 5FL3A 4ON0A 1FIPA 2KJCA 3A0HC 3LWFA 4LMYA 4U0WA 2DCEA 4RB3C 4IHVA 2V1UA 4LLOB 3AYKA 2F6CA 3ELMA 4YNRA 2QA4I 1FR1A 1YI2I 2JN6A 2Y2JA 2X1EA 3KX2A 1XX5A 1G6NA 1WFXA 3ABMH 4R1HA 2J5PA 5IYBJ 2M9HA 1ZRDA 4F3LB 3TO7A 2H1KA 1MMPA 5BPDA 1VQ4I 1I1SA 3GWZA 1K6SA 2HXIA 2W27A 1KE4A 4IJGA 3H5NA 2X6WA 4HPQA 5C4JJ 4OINF 1LQ1A 3SOIA 1X3ZB 4KZ7A 1Z77A 4BBSJ 1ZS0A 5IHVA 3N4MA 4BAYA 4OIOF 2XH9A 4XRSA 3K4BA 1V5GA 4IVKA 4IVIA 2LKPA 1B8IA 3DBAA 2ZC2A 5CKTA 3OCLA 3K1NA 4XNFA 3F6VA 3MFKA 3GLXA 3K7LA 5F27A 2R7FA 1MSFC 2KIMA 5KVRA 3C2WA 3QPSA 4U0XA 3I53A 3OV8A 5TJJA 2YKFA 4IRHA 3M2KA 1ZQ3P 4S2NC 5CXWA 3LJGA 2A3SA 3F72A 1P0ZA 3J81Z 2DK8A 3BR3A 3S32A 3PM1A 4F91B 1KE0A 2EV5A 2DDAA 1FY7A 4U87A 4Q4ZF 2RQQA 4QD4A 4A6EA 3KP5A 3BQAA 1GHPA 1ROSA 1NYMA 3J7AY 4YEJA 2OWJA 2Y2PA 1KUGA 2HR3A 4B3XA 4ID4A 4H76A 5AQ9A 2JSDA 3U21A 1ESUA 3PNTA 2E36A 3HOYJ 3TO9A 1OT6A 4A5MA 3RYRA 3F1NB 1EKEA 2F5EA 3ZQLA 1J9IA 3L9KA 1XGIA 3LR5A 2RQPA 4F3LA 2QSHX 3TO6A 3GSGA 3EGDC 3IRQA 2YUSA 1FTTA 1L0EA 2F5DA 2M3AA 3NOUC 5DD4A 2JT1A 2E60A 1SDEA 4WF6A 4BS9A 2HP5A 1FIKA 4UA6A 4X53A 1QZEA 3CTAA 3WHBA 4B48A 4EVIA 1LL5A 3MBZA 1PWPA 2J83A 2JN7A 1OR7A 1IG7A 1VHMA 4NXBA 4E3NA 3LSPA 3WG9A 2V8CA 2VGKA 2YSRA 3VEPA 2MYSA 2Y69H 4ZZDA 3V7CA 2VOPA 3FG8A 2Y8HA 1V3FA 3IF6A 3GTPJ 1QU3A 3CHWP 3GMEA 1EUBA 1XXMA 4Y7PA 2QEXI 1SU3A 4M3BA 1MKIA 2XKOA 2H8RA 3B2ZA 1RZ4A 1BKCA 2RREA 2EX8A 4UA9A 1ZH5A 5I3MA 4AWXB 1JXSA 3DTEA 3H0DA 3CCSI 3O88A 4I3AA 3PHYA 2J80A 3R0JA 3AFHA 3TW8A 2HEOA 2LKXA 2LY2A 1RIOH 1I6HJ 1NYYA 4L9GA 3HG9A 5DTDA 2W12A 4R23A 4U3TA 2O3EA 3T5XA 4FISA 4I02A 3JRAA 3EUAA 5E2GA 2H1LA 2K3PA 4ZDXA 1ZRFA 1XJ4A 1KUIA 2EIMH 4WZVA 3IX8A 5D8KB 2PYPA 4IXAA 2Y2NA 3DPLC 3HSEA 1ZVXA 2XK1A 4CPKA 1WI9A 4ZH4F 2PX9A 3HRTA 1JWVA 2HF6A 2E1NA 1S29A 1TP4A 2TCTA 1LI0A 3H9QA 3IWZA 3ECHA 4FHTA 4II3A 5EV0A 4E04A 2DW1A 1GCEA 2EILH 1J3WA 3KYLA 1UAAA 1OS9A 4LG0A 3CCLI 4HF1A 3GZ5A 2I5UA 1FOXA 4LRXC 4A7BA 3CDHA 5FDSA 2FFYA 1ETYA 1KDWA 4OIRF 3WS0A 4RX2A 5DTTA 5M18A 2L3DA 3S3OA 2OQGA 1TZLA 1KE3A 1V54H 1GV5A 1T0FA 3VPRA 3O3VA 2R4GA 5LRRA 4HHDA 2RKHA 4HNTA 2UXNA 1LDDA 4RDUA 3OYEA 1TS8A 4XOPA 1C7KA 4BKXA 1G6OA 1XN7A 1K78A 2STWA 2IEKA 1HW1A 3RDIA 4CA0A 3UKGA 3CO6C 1D1CA 4KN7X 2DMPA 1TVFA 1FQGA 4PDKA 4IRGA 4OQHA 4XLAA 2M2EA 1DJCA 2OZRA 5L09A 1U5TB 1CI9A 3OBFA 3FKVA 4JBAA 4GNUA 3F15A 2XF3A 1IW7F 3FWEA 3R4KA 3IKTA 4Y0TA 1GV2A 4EM0B 5J7EA 5KMWA 3KWVC 3C30A 2WV1A 2ZC5B 4JF6A 5CVIA 2L7KA 1ES4A 1UMSA 1ONVA 1IAWA 2MFZA 5JR3A 1ETVA 1BTLA 3BFGA 3Q3SA 2QWSA 2ISZA 3L2VA 1KU3A 3JVVA 2JA5J 1VQ8I 3UDIA 1KAPP 3FF5A 1RNLA 1R49A 1YCMA 3BJNA 1ACIA 2MC3A 4GCZA 2V1NA 1AHDP 2ID6A 4JGOA 1WKMA 2AQEA 5F6FA 3VB2A 2R7UA 4NK3A 2EA2A 2L5QA 3B73A 2PMHA 4O0PA 5CGXA 2HNHA 3M1EA 3DL1A 3DWBA 3OPHA 2ME0A 3S1RJ 4HEA2 1GA0A 1D8KA 1TS6A 3I7JA 3OYNA 1FYLA 1GO7P 3EGXC 2ECBA 4HNBA 5L7FA 2ICWG 5C3EJ 3S1NJ 2VE9A 4XM8A 2IRFG 1G8XA 1MNDA 1HOMA 1HW5A 4JGRA 2P7VB 4A5NA 1N9BA 1D7XA 1N75A 5J8CA 1SMTA 3O8HA 3CJNA 2RL3A 3Q2GA 4PKRA 2P6SA 5HFOA 1YRNB 2VL8A 5L10A 3GFJA 5IPAA 2VC0A 1FLSA 3G2YA 4N4NB 3M8FA 3LIFA 2FV5A 1NTCA 2XPVA 4CLCB 4Y7NJ 2KHMA 1O3SA 2EBIA 1DUXC 2GZAA 4N92A 4ZJZA 1SAXA 2FF4A 2FV9A 4CICA 2L01A 4CJNA 4KISA 3T1XA 4PK4A 5FQIA 1PZPA 3HY7A 1K7AA 1B4AA 2EJRA 2R7RA 1MH4A 2FOKA 3OLOA 2PD7A 2QYBA 4QSHA 1FX7A 4XICA 5EOEA 3FMRA 4CCOA 3L2WA 3SXYA 2HQNA 3OYAA 4C30A 2BY3A 2WK0A 2CO5A 2ZSHB 1POGA 1LFUP 2GM4A 2W3DA 2X51A 3I3LA 3RI4A 4ENKA 2CQXA 4P6ZS 2O9BA 2XR0A 3TRCA 4JLFA 1SD4A 1Y8RB 2YPRA 3KEQA 2FU4A 3PNVA 3Q0UA 5M3MJ 3CCMI 4QY6A 1USNA 1N78A 3CJQB 1BULA 4EXOA 3Q0WA 2DLLA 1UHWA 4M73A 2DNSA 1C3BA 3LGOA 2DMTA 2QQAA 2XGDA 5C44J 4ZJ1A 3ZHHA 2DBBA 2XGEA 2IA0A 5CECA 2L54A 2FRHA 3RZOJ 3RCOA 1UTZA 3VP1A 2WAEA 3FISA 5AVEA 1T39A 3HSRA 3VYSB 4ZTFA 2ETHA 2H10A 4BACA 2ZM8A 3FM3A 2JZYA 3TGNA 3WODF 2H6CA 3Q9SA 1S6RA 1LL8A 3HLBA 3HUNA 2KT0A 3IF6C 3OPPA 2Y31A 4JKTA 4IHYA 1SFKA 2EIKH 3OYFA 3KSIA 1IN7A 4LPZA 4II7A 1RR7A 4PUSA 3EDGA 4QKZA 3RPUA 4CLCC 1MJAA 3UN7A 1QQIA 1OR7C 4MLOA 4AIHA 2ZQ8A 2H6BA 5FO5A 1DPUA 4I35A 4NDLA 4HF2A 4Y3OA 1LKXA 3H1CA 1H5XA 3LGPA 2K85A 3K7AJ 4OWRB 4HP4A 1WSUA 5KHDA 1TEMA 2GOXB 2HJEA 3AG1H 1ZGWA 3LEQA 2P04A 4G7OF 2PEXA 4D1QA 2HOSA 3F1OB 1VQNI 5J47A 3MMHA 3NWTA 3JAMZ 2K9QA 4IHTA 3R60A 1QVUA 3VODA 1E0EA 4D5FA 3LAJA 1XPBA 1Z09A 3PBRA 1PYYA 4OQ0A 4HJ3A 1SD7A 1HC8A 2YIGA 4DQ2A 3OYHA 3Q7ZA 3PSIA 2EFWA 2ACGA 3IV5A 3BA0A 1HXDA 1MD0A 4MNRA 3V3SA 3EQVA 2D1VA 2X9DA 3WRZA 1XAXA 3WTVC 2HDDA 1TWCJ 2E7XA 4AU7A 5FAPA 3FXLA 3OS2A 2QBYB 2W48A 3PTEA 4YFNF 1P6RA 5J6XA 3NAUA 2BG1A 3BT9A 1KOUA 4DE0A 4EV4A 3VTGA 3S17J 2W3FA 2VPRA 1MIJA 3KIOA 1Z7LA 1LB2A 4YWZA 4IRIA 4S2KA 2O36A 2HTSA 3HEFA 1B9NA 4D9JA 2VV6A 2IVMA 3J81K 2K27A 3OS1A 3ZQ5A 2BHZA 2Y30A 1BW5A 1ZC2A 3LKAA 1IFQA 2LTPA 2XA7S 2DN0A 3EYYA 1DDNA 1H8MA 3HOVJ 4M71A 1CAQA 2HGCA 5A91A 1RESA 3LQQA 2VQLA 4H1QA 3FXQA 3K69A 2AXLA 4DYQA 2Y2MA 3EEHA 2M7VA 3GTKJ 3Q2HA 3W2AA 3UNWA 4PHTA 4L9VA 4JOMA 1XDUA 4OKPA 1MMQA 1O4XA 1LSXA 4FD8A 2R7TA 3O8GA 5FFXA 1XM5A 2OCEA 2IJLA 3FKWA 3JSOA 1ZHFA 3QP2A 5L8MA 4BDYA 2CV0A 3G2ZA 2XDVA 3UB5P 4GXOA 2B5RA 3G32A 1YIOA 3N05A 2EA4A 2YU9J 2P08A 3QODA 1T1BA 2WOAA 1OTIA 2VLAA 1FLIA 4OQIA 5D2BA 3LOCA 4UNOA 2E1OA 1QJIA 3S7NA 3G6OA 3ML6A 2ZBKA 2XQZA 3EUKL 2GXGA 3HUOA 4D0PA 1BSWA 4WKIA 2P74A 3KMEA 2OXZA 1WH7A 1UMTA 1UTTA 1YLZA 4RAZA 1W0UA 2FFFB 4OLDA 5DFXA 2XDMA 5AQ7A 5EVID 1F43A 1FSWA 1KVLA 3CCJI 2HDQA 4XIDA 3N8SA 2F4MB 1ZP5A 5BOYA 2K9NA 2V9KA 4JX4A 3TL4X 3BLYA 2Z6CA 4N9LA 3IP4B 3L7HA 3RPQA 5HOOA 4FU4A 2MGQA 4P1WA 4XKBA 3LUMA 1BLPA 3LFKA 4Y52J 3E2KA 3DPUA 4WZ5A 3DV8A 2ELKA 1SHVA 1GE5A 5H6RA 3M6HA 4G9YA 2PJRA 4F93B 2DFFA 2QKLB 1FJLA 2ZOHA 3EEAA 5HX9A 1YW9A 5DCFA 3HOZJ 2UXXA 3LEZA 4GN2A 3JR9A 1QPMA 3DKXA 2BY2A 3J80K 1BUDA 1SFXA 4GDNA 4HSRA 1JTGA 1QZZA 2ZQAA 4GDBA 3K4JA 3RIRA 5IOYA 1X1DA 2W4SA 5EECA 3TOBA 3BEBA 3P1VA 1CK7A 2JWTA 3M7GA 4O6JA 1KYWA 2QZ8A 1D1JA 4U0YA 4AM3A 4IJOA 1MMGA 1ESIA 2VJ5A 3R6SA 2Y55A 1KUFA 4UV8A 5E8IA 4J19A 2P9VA 1R5HA 2ID3A 1F36A 4HJ4A 1BIWA 2X3AA 3C7JA 3WTUC 3FBNB 5E2FA 2IAIA 1USSA 5F1RA 1KQ0A 2VOOA 3GVBA 5DCMB 1C0WA 3IKVA 3QWLA 2DTZA 5L3CA 4CLCA 1JKYA 1OMJA 2DA3A 1GUUA 2VN2A 1CEGA 1L0DA 4Y0OA 4P96A 2P5LC 5KSCA 1R71A 1WPKA 4FE4A 2A49A 5FASA 3HB2P 3NQOA 5HLHA 3BWLA 3GDIA 4IEDA 4UHTA 3NX7A 5HVQC 1PI4A 1D5YA 3BJOA 5L2FA 3T1SA 2WBMA 1NRJA 3PBQA 1RM8A 1ERDA 3LR4A 4Y4RA 5HPFA 3ESWB 3P5JA 4PKTA 3D4FA 4RM3A 1LDKB 2M0CA 3F19A 3HJKA 2KRFA 4I39A 4H30A 3PXPA 5FD5A 4WBGA 5EJCA 1HD8A 2R5ZB 3SH7A 2LNBA 1REPC 3NDEA 3OL3A 3T4JA 2W14A 1GT0C 1RRJA 1QNTA 5L07A 2Y4AA 1E3UA 5GHYA 1CGEA 2VC1A 1IDYA 3GLLA 4XN0A 3KEYA 2CWEA 5DKKA 4LK1F 3Q7VA 4HESA 4EM1A 5G4YA 1B3DA 5IYDJ 1WA9A 2RAEA 4WN5A 1ZTRA 4KDPA 4D7NA 4KZ8A 3SFZA 3ZQFA 4E4HA 1H8AC 1VETA 1G49A 5DD8A 2PRFA 1MKMA 2EQRA 3GTLJ 2BXZA 3C4PA 3GTGJ 1Y0NA 2M5WA 5EG0A 3IWQA 1P92A 3OWTA 5ICGA 3FDYA 2KIFA 3J7AO 1UWPX 3SZGA 5E2HA 4PFPA 1U3EM 4BJ6C 3DXJF 2OLVA 4HA8A 4DGWB 1B72B 4ZTJA 1BSGA 3ROUA 3O2XA 4M74A 1MSEC 3GTCA 2GNXA 4LG0B 4K91A 5FEGA 1X58A 3RQ4A 1XSXA 3ZRGA 4EUVA 5A92A 5DV5A 2EWWA 3NRVA 4PKWA 1YPRA 3WS5A 5E20A 5D1UA 1RI7A 5DS9A 5FQKA 3DPTA 4CTHA 1VI0A 3Q0VA 2I9VA 4ETZA 2IBDA 3I4PA 2B18A 2UWXA 2ZC3B 5AJGA 2PU2A 4ENJA 2OW0A 1YHQI 3FXJA 2DFEA 4BL0B 2LLKA 1JUPA 3D5LA 4RAYA 1OCZH 3EYIA 2QVOA 1VQ5I 2AO9A 5AQBA 5AVFA 2PMUA 1TNTA 3K3CA 5HZHA 3K1PA 1D5JA 5L3EA 5EDNA 2D01A 1W4MA 1WI3A 1KYZA 2ZXHA 3DBRB 2IGOA 3G1LA 4I99C 2QMIA 3RKXA 4DJ3A 1OLTA 3BTIA 4BUPA 2OZUA 1JWPA 2JC7A 2JTVA 3CWFA 2PJTA 4BD1A 5CZMA 4QTRA 4BXFA 3GYHX 4MEYF 5H20A 3OSFA 1U8BA 3CP8A 1D7EA 1Y0VA 4HX7A 5HS9A 4A93J 2K9CA 3HREA 1XD7A 2HYGD 3SS4A 2EV0A 4XLFA 4AUOA 2JUCA 2NS0A 2R0QC 3LO7A 4BHBA 3K1MA 3WTSC 5D5WB 4FUWA 1G2HA 4HV6A 3K2ZA 3G30A 3HUGA 1QJJA 3LA2A 3HC7A 2QYOA 4KICA 4PZJA 4H0EA 2O61A 4OOLA 4ANJA 2XHKA 1EH6A 5D5UB 2Q0OA 1UELB 3VP3A 1OS2A 4WLAA 4XRMA 5G4ZA 4JX6A 2P8TA 3LJZA 3HLEA 1BI2A 1V9ZA 3JRFA 3OHOA 1Y1WJ 2AS5F 1FZPB 4FX0A 4LIUA 1MH3A 3ZCOA 1DMTA 4BQAA 1AU7A 3HZJA 3TEDA 1BL0A 2O0YA 4CLCE 4X1MA 5LEKA 3S1MJ 4BE0A 2WYXA 2A6HF 3MWMA 3PNYA 3QOPA 1HKSA 3MKYB 4EJUA 3UPOA 1OO9A 4MHGA 4E7KA 1OMIA 3HM5A 1WGXA 4YIIA 3GZNB 2OZ6A 2VE8A 2VQGA 1FIAA 3WGIA 3FZVA 3UMDA 2JT5A 3TQNA 4UV9A 2GDNA 4B44A 3M3YJ 3OC2A 4JF5A 3OIQA 1WJFA 1D0XA 1ES2A 4DDYA 2IA1A 3O3KA 2INWA 3HCYA 4NKPA 3DLAA 4IHSA 3KYEA 3JRHA 4D7MA 3PBOA 1GSWA 5B5PA 1YIJI 1VZ0A 1R5GA 1PYVA 1KA8A 2FBIA 3QYFA 2HOEA 1T6SA 5LHGA 1O3QA 2FNAA 3M9AA 1GSVA 2GA2A 4PSWA 3TDUC 1TS7A 1S8NA 2VGLM 4WK8F 1T08B 2FA5A 2OAZA 4Q48A 1J09A 2V8FA 2Y2ZA 5CVVA 4LLLA 3WE3A 5HDSA 3FKIJ 2NVYJ 3K70D 4R6LA 5EVLA 4MN7A 2LMDA 4M6VA 2H27A 3HYIA 2OW9A 3K4MA 3EHYA 3ZMSA 4Q47A 2WY7Q 2I72A 2KPMA 5I12A 4HDVA 1XG1A 3BG6A 3DBHB 4I0BA 4XL9A 3FK7A 4YOFA 3DTKA 2AHQA 2O9CA 5HDCA 2Y0SA 2HVQA 4OIQF 3HRSA 3G34A 4CQHA 3SS3A 4E7HA 4IVNA 1OM8A 4RB2C 3B92A 2VXDA 2LR8A 4TV7A 2ZSIB 5FAQA 3IS2B 5JLXA 2BHYA 1WZ2A 1OPXA 1W8QA 2WWYA 2HDCA 1XFYA 4HSTA 3GTJJ 5HDDA 1I39A 1FOKA 4B4ZA 1PZOA 4CYDA 3DLLF 1AXBA 2H5SA 1RKTA 1W5CC 3F9KA 2KMUA 5M1AA 1XCVA 4R4RA 1VB6A 4KT5C 3S4XA 1VQOI 1DJBA 5DF9A 3P9IA 4GGGA 3QP6A 1F9NA 3T8TA 2XFTA 3NJAA 3RKWA 3I0TA 1BKCI 3UB8A 1KONA 4B3AA 3Q7VB 3QU6A 5H2FC 1NLZA 1ZG4A 1YSPA 4LV2A 3S3MA 3V39A 2KQRA 4PKSA 3CCYA 1F1ZA 2O03A 1KU7A 1F5TA 4I98B 2W3EA 5EE8A 3K4CA 1UWNX 3HLGA 4D60A 3A02A 3ISPA 1YS7A 1HDPA 2XB0X 2I8DA 1VQPI 2DT6A 3RZDJ 3OMYA 1KGSA 2RN7A 3KLNA 1FWZA 1LT0A 4HH3A 2H28A 4WEKA 1LFBA 1Z1DA 5BQTA 1ZGAA 4DE1A 2L7ZA 2PN6A 1Q2PA 5K5QA 3CLOA 3ZGAB 4FETA 3LFUA 5BPIA 4CZCA 1IAGA 4HNUA 4LK0F 4ESBA 2WAQN 5D1SA 4UB6C 3UE1A 2HVSA 3GTQJ 2JVGA 1Z21A 5F1GA 2NAZA 1H0MA 1TW3A 2XVCA 1T18A 1CIZA 5F1FA 1BYWA 2FQ4A 5EVIC 1XGSA 3LL7A 2AVXA 4XLEA 3KP2A 3GZ6A 3GO5A 5GAEJ 3ZR8X 4JF4A 5HDKA 1CXVA 3MFDA 3SHIA 4V2GA 3T4OA 5I4OA 1OYIA 1K4FA 3N4IA 2A68F 1IRFA 3VSKA 3EDPA 4HBLA 1FP1D 4PJMA 2ZQCA 2EROA 966CA 2CMNA 1TWHJ 2DYSH 4E3JA 4R3VA 1I27A 2M34A 3G5CA 2LY9A 5HWVA 4EBPA 5EEGA 1A5JA 5DM6F 1I5ZA 1EW0A 1XGMA 1T1CA 2J3WA 4WUJA 5HLGA 5BMZA 2NXNB 5JLWA 3VOLA 1BJAA 3ZMZA 1IKIA 1K83J 5GP9A 1AKHB 3MZ8A 1L0GA 4ME4A 2XV4S 2VKEA 2FUG2 3DFGA 5LGTA 4WX9A 3I4MJ 4B09A 2DRWA 3P01A 2G2UA 1A85A 1OCTC 5E1XA 3BG9A 3GFLA 4GYIA 2ZNYA 5FLXZ 4AIGA 2BY0A 5H6QA 1K7QA 1NLYA 2GIVA 4XM7A 1CF7A 4XM6A 3BR1A 4R3JA 3PAGA 3A3EA 3PBSA 1SDNA 3ZG5A 3KSGA 5J1UA 1J7KA 5FQQA 4ZDOA 5LHHA 2QF7A 1O3TA 5JYOA 1IOUA 1CGLA 1QO0D 2HKOA 2VQCA 2BXYA 4RAFA 1K25A 5IT5A 3HDBA 2L0RA 2O3FA 2NVXJ 1K79A 3U2RA 3GTOJ 2XUBA 4MIMA 5HS7A 2RNGA 2IS4A 2HGVA 3S15J 4M72A 2ZQ7A 4MBHA 2Y2QA 3ZQCA 1FC3A 1G6AA 2MH2A 2VT2A 1VQMI 2W84A 4S2NA 2H0YA 3TMOA 3OYKA 1T19A 2YKHA 3R7WB 4PKVA 5LHIA 1DP3A 2LFBA 2KRCA 1C8TA 3OY9A 4UQIM 1VF9A 3ZQGA 5FEFA 3OYBA 3L0VA 1IUYA 2ZFWA 2QWWA 1NWZA 5CEBA 3GMWA 3WV3A 2V9VA 2VJ4A 5U47A 3EPZA 4PCQA 2GLOA 4OOMA 4GQLA 4S2JA 4QPOA 1VQ7I 4S2IA 3V7SA 1K61A 1D5VA 1HFCA 1SMPA 1IRXA 3G6EI 3H92A 2CG4A 3ZQIA 3VP2A 5BOTA 4G6DA 3MCZA 2IWBA 4BXUA 5FDHA 3E4PA 3KRYA 5FLMJ 1L2SA 5F08A 4UHUA 5F83A 2XROA 5JFRA 1PWDA 5LBRA 2BW3B 3N8LA 2P0WA 2K40A 2X1DA 5FAOA 1ZLJA 2OUMA 3DEUA 1X1BA 2P5VA 3DKWA 3OCNA 2L9RA 3NCKA 1Z3JA 4EJVA 2VONA 2JNPA 1SVOA 3O6BB 1JAPA 1MMBA 2FMLA 4Q8IA 2N8RA 4Z1WA 3OIPA 4UB8C 4GFBA 4Z6YA 3F1OA 3C18A 1ZHHB 3G71I 2LDUA 1ODDA 1FBLA 1TWGJ 1YLJA 2ZMAA 4PKUA 1S7EA 1NG7A 3CZDA 1W7FA 2OTJI 4I38A 1BIAA 2V9AA 4E70A 2QENA 3GEZA 4C3HJ 4ZR5A 3VFZA 1D1AA 4XLHA 1NZOA 5M5XJ 1I5QA 3KPHA 4HYEA 1D8FA 3RSNA 1MBJA 2X85A 1MJBA 1BC7C 2VASA 4GD8A 1P7JA 3S2DJ 3ONQA 4X25A 4Y2FA 2F48A 2G0EA 4RVAA 5DVAA 3JRDA 1HKTA 3L1PA 2CW8A 3BZ6A 1PUFB 4R70A 1DY6A 5HDNA 2PR5A 2R92J 3FZCA 1XGNA 1RPWA 4LGWA 3JRCA 2VJJA 4JK1X 2WKHA 4R4SA 3NY4A 1EV7A 1CF0A 3H3UA 2CV1A 1KQ8A 4QPQA 4XRFA 5ILUA 3NULA 1HSJA 2FD5A 3BR2A 4FTHA 5B66C 6PAXA 3D3OA 4XUXA 5TBMB 1GE7A 3LUNA 4B4CA 5BOXA 5J4EA 1SLMA 3BCAA 5JMYA 3OOPA 2A07F 1IN8A 1QICA 2W0NA 3MZFA 3QAHA 5CGWA 5ED4A 1S6LA 5G18A 5K7HA 2G2WA 5B1AH 2OY4A 2KLOA 3DU6A 2Q9NA 1P9WA 2WO8A 4DNCA 2ESHA 2EZHA 2TDXA 4PMAA 5C5KA 2DW0A 4L0ZB 4RM2A 3OYIA 1ZXCA 3JSPA 5FRNA 1APLC 3IH2A 3C5AA 3LIBA 3BR6A 2W7NA 2EXBA 1TVIA 2JT6A 4KITB 3K6GA 2EA9A 3KP3A 4GYGA 1RUOA 1MDMB 2LRDA 3PYPA 5CHMA 2EX2A 3ZN0A 2EINH 1RUNA 2Y79A 1TD5A 3BQZA 2LY1A 1V55H 3QPHA 1OTBA 2O9AA 1Q1HA 4PJJA 4IPAA 2B63J 4RGRA 2OXUA 1VQQA 2NRAC 3I58A 4Y33A 4UQIS 1DQUA 2M7AA 4A3CJ 3A3FA 1TDLA 3IX3A 3HXLA 4B1RA 5E3LA 3BRMA 1ZARA 3CC7I 1DU0A 1JAOA 1X0OA 3GRJA 4O3MA 2JIHA 5DTKA 5HDGA 1YMXA 3MVPA 4X1EA 2WO9A 4HAMA 3SHFA 3FHNA 2QQ9A 2HOTA 5MC7A 2LREA 1Y4OA 1R22A 3PO3J 2EFPA 4WL9A 1DGWY 1OISA 4DJ2A 5GLDA 1YMSA 3FPWA 2FEZA 2R7OA 4XRSG 1K4EA 3ZFZA 1MDMA 5HL6A 2R3SA 3ICYA 3AGFA 4AYBN 2HU6A 3QU3A 3H3ZA 3SDBA 5EEHA 1O7EA 4JQGA 1QA6A 1HLVA 3PIOF 2OY2A 3IH4A 1VETB 1J2XA 5A2QK 1FMWA 4KYWA 2Y2LA 2HI3A 3GX4X 1IGNA 2R7XA 5HARA 4YIRX 1K38A 5CJ9A 2NOJB 2XF6A 4A69C 1YLFA 2DFHA 3ZXHA 1W5SA 4X55A 1Y1VJ 3O64A 1FSYA 4RX3A 3GXOA 1Q1VA 4MFDA 5EZGA 1R5ID 1UG2A 1XB4A 2CYYA 2DU9A 2P5KA 2HP6A 3C38A 3JCUC 4BBTA 1XFUA 4C6YA 1BJZA 3I5UA 5EEAA 1J59A 2JKTI 2CU7A 1BR1A 1G3TA 1ZG1A 3A3IA 1JANA 3BDDA 1K56A 3KYQA 4KQQA 1UCRA 1E25A 2OOLA 2DMWA 1G3YA 1XDSA 1XMAA 2BW3A 4LJZF 5ICEA 2JKTM 5KAIC 2DDYA 1W63Q 3IH9A 1MBKA 5JHUA 4JGPA 3OYCA 4Y5FA 3BECA 5F68A 4C3QA 4YINA 2XAGA 3BTJA 4DZJA 2V6EA 3EDHA 3LQ0A 830CA 2Z1DA 1Y56A 3CDIA 4G6QA 5F82A 5HWWA 4C2MJ 5CQEA 1MMSA 4KMFA 4NHJA 3S2HJ 3HKZA 4E3MA 4S05A 2VBYA 1DP9A 4PSXA 5IP9J 4HP9A 1H9GA 4OONA 4WZ5C 1YP1A 4N4OB 5CVUA 4HLXA 2VKHA 4EATA 3ZMVA 4MN5A 3WU2C 4OAZA 4YFKF 3LFVA 5FKOA 3K70C 4W1UA 3DCFA 4M9XA 4XMYA 4BE2A 2E2HJ 3VWBA 2FBKA 1Y8JA 3FXOA 1JNUA 456CA 5FKMA 4OPYA 1MY8A 2M45A 4FVLA 2JQ7A 2FH5A 3KYZA 1G28A 4OMZA 2PR6A 1K54A 3CI6A 3QP1A 1XSDA 4S2MA 1BW6A 2EFOA 3N6IA 2AXTC 4AIDA 3HHHA 3KZZA 2JHEA 3BWGA 5TBMA 5L3GA 4BLMA 3LR0A 1Z3XA 2XAUA 2QQ8A 1I3AA 3ABLH 5HNFA 3PJRA 4E7LA 2ZM2A 1SVLA 4QY5A 3LILA 1YITI 2K9MA 5FI2A 1WRJA 2XSSA 5HD3A 4M9SA 3VYUB 1MGTA 5IP6A 3I7IA 3KP7A 2M4KA 3K7NA 3QQAA 2IGKA 1WJAA 2P6TA 4XK4A 1RP5A 2Z2LB 3OZHA 5HAQA 1STZA 2VIXA 3R61A 3KETA 2LB9A 3BR5A 4Y0UA 1X4PA 3MZYA 2P7JA 3M6BA 2Q9MA 1QHHD 1MNMC 4NETA 4IQJA 1BLSA 2K2NA 3T4QA 5IU1A 1JI8A 1LDJA 4L9JA 2GAUA 2MABA 4A3BJ 1I1GA 1G68A 3GUDA 3TW7A 5FRMA 1K57A 1PWGA 3ITBA 1Z6TA 5HAPA 3CDLA 1MWRA 1RC9A 1LE8A 1LJ9A 4Q0HA 4DZPA 2LK2A 3I64A 1XS9A 5E43A 1Z67A 2G9WA 5B5EC 3IXGA 1OZ9A 4WELA 3E4OA 2ZJQF 4F7ZA 4KUKA 4LLNA 3NECA 4P6ZM 5DEQA 1OCCH 5KIZA 2DT5A 1PUEE 1YSQA 2D02A 2OJED 4ZBEA 2AYKA 1MXOA 3AG3H 1SLNA 2RJPA 1ZG5A 1S4BP 1XFXA 2R7DA 5F0CA 2EK5A 3F6OA 4IO9F 4M3KA 1J7NA 3F1AA 1P9QC 5K1YA 2JMWA 2V26A 3W8KA 2E34A 1W7PD 1LL9A 4BL2A 3AG2H 3G31A 3MXRA 3I71A 4KENB 1D1BA 1HSTA 4E3KA 2K86A 1S4SA 2IWCA 2ZC7A 1FT9A 1K78B 1BOAA 1VQ6I 3LUQA 3LCEA 2CUZA 5GADJ 3HUMA 2CUEA 3RXWA 2XEPA 3I56I 4DF6A 1GXDA 1XURA 1YAXA 4BGDA 2BZTA 1D0YA 1IEMA 1XKZA 4BBVA 4CYCA 1SFUA 3CPTA 5FKLA 3TDZC 2NVTJ 2JCHA 2YR2A 1JUSA 4LB6B 4P9UA 4PKYA 4DXBA 3DNGA 4WM9A 2MBFA 5ILSA 2OQRA 2KISA 3HRMA 4W97A 4CUGA 4BQOA 3BW6A 3FIWA 2L4MA 2Q2EA 3C2HA 3E3VA 1A31A 2KL4A 3B47A 3T12B 2QPJA 3C2BA 3LIAA 4U7BA 4ENNA 3TOIA 3B42A 3RTTA 5EM0A 5F64A 5E3NA 2XAHA 3ZVTA 2ESNA 2W25A 2OTLI 1UMQA 1TQMA 3UDXA 1SVMA 4PM5A 5D5XB 1XFZA 1H8YA 5E18F 1BN5A 4IOCF 2L0WA 3MJQA 4H8RA 5GLCA 4QJGA 4ILWD 2O9LA 3ZPLA 2FZ0A 3C2GA 2B7EA 2O8XA 4XQFA 3NARA 1YS6A 1E2XA 2XSDC 1FYKA 2ZJ9A 4GO1A 3V4GA 1G3WA 5EF6A 5EG0B 4HJ6A 4KFCA 4Y3IA 2X01A 1PDNC 2Y0MA 4XM3A 2L0KA 3DF8A 3SZPA 2LH9A 2PYRA 4PKYG 5GTHC 4D2OA 1MPLA 1I76A 1CI8A 1BI0A 2FOWA 3REOA 4LCLA 3G73A 2NUTC 1QIAA 4OIPF 4GHIA 4E6KG 3PR6A 3CCQI 1FBQA 1T56A 2DA7A 1FEXA 3OPRA 1AA7A 5DYMA 3F23A 1JT0A 1ASTA 1LPQA 4L19A 1VQLI 1FR6A 2V1DA 5TRDA 1R9TJ 2JKRI 2RDPA 2YU3A 3CF5F 3BQYA 5HSQA 3IF6B 3ITAA 3A03A 3ZQ7A 2ZXIA 1JIWP 4LLGF 1GHIA 3G4SI 2WADA 2A3UA 5EYRA 4KZ6A 3WS2A 3S16J 4GOGA 2Z99A 4L63A 2RVCA 2G7UA 3H3VK 3LI8A 3G1OA 2ZB9A 3FMSA 3SZTA 1ONGA 4HQAA 3CAXA 1OKRA 3MEXA 2YX4A 2OAP1 2BGCA 1JGSA 5HODA 3DTMA 2EH3A 4ZC3A 1R6RA 2NNNA 1G59A 3HHGA 5HNHA 1JKPC 2ZNZA 1U5TC 3IF5A 3IS2A 1MMDA 4YRVA 4GF1A 2PBDP 3UE0A 3C3WA 2UV0E 1BC8C 1SAUA 3K9TA 1ZAOA 5CGSA 5JYPA 2E2DA 3UE6A 4HZFA 4UUSB 2WKIA 5AQAA 1OPCA 1GLNA 1T95A 3K4LA 1WH5A 2Y6CA 3LSKA 5J1YA 1MZUA 4AVPA 1XFQA 4XOTA 1YW8A 4DE2A 4M6YA 3QP5A 4E3LA 2R7WA 1K54C 2KRHA 1T98A 5D6EA 4RMNA 1K56D 3UPPA 1G4KA 1K55A 3WS4A 1F5MA 2GWRA 4OH0A 2J8YA 4GB7A 3BJAA 3CCEI 2ISYA 3Q5FA 3N2VA 3S1YA 3DEEA 1KGGA 5EGOB 3DPEA 4DE3A 1JUMA 3E5QA 4S0HB 2FMYA 3VOYA 4G8XA 3TS4A 4O7DA 4B88A 2VEAA 2HQRA 4U0VA 4Y17A 4IOAF 1R4MB 4UVBA 4RGSA 1G12A 1OM7A 4M3EA 1JHHA 1Z7UA 4GR3A 1M40A 2XLNA 1UB9A 4LIVA 1WCMJ 1Y6IA 3P9KA 3H5RA 3M8JA 4OVDA 1KVMA 5ERIA 4LFUA 2X1CA 1CF7B 1KGFA 1XP4A 1ZGJA 1ON1A 2V1ZA 2QKPA 1WHUA 3BZKA 3OYMA 2DCFA 3HPHA 4K0WA 4QWOA 3S7PA 2QGUA 1HCRA 1FCMA 2JBFA 4KIBA 1LHYA 4EV0A 4RQ9A 1R1TA 2NVQJ 1DRMA 2V7FA 2F2EA 4BXXJ 2JVHA 9ANTA 2WKPA 4DBRA 2ZXWH 3CUQC 2K31A 3IXBA 1VTNC 3O86A 3ELKA 1NH3A 4BD0A 1QMFA 4MLLA 3BJ6A 3D9YA 2IPQX 2FE3A 4CCMA 4A0ZA 2MSYA 4PPRA 1D8MA 2VPLA 2EZKA 4LG3A 4C2UA 5CERA 4M6XA 1FM1A 4ZRRA 2W82A 2IWDA 3BTLA 2ERPA 2HZTA 2DA1A 2JK3A 3N97A 5FQJA 3PFIA 2A05A 4BHPA 4A3GJ 1UGUA 1OCOH 2H8WA 1A0KA 2OPTA 2DQRA 2E2IJ 2XPWA 4HOIA 2R7QA 1ZREA 4F52A 2XB5A 5E79C 3ZQQA 4E7JA 3SS5A 3GBGA 3ZGKA 2G7HA 2V9PA 2PBYA 2NS8A 4EEPA 3E0JB 1QRYA 2V4JC 1R1JA 2E8IA 4HRIA 5GPCA 3EUHC 1GDTA 4A3FJ 1VEUB 4ZYGA 3KECA 2OV7A 4HLYA 1LFPA 2HZDA 4Q0IA 1ETKA 1NG6A
chains in the Genus database with same CATH topology
3M1CA 3ZR8X 3HG9A 1CXVA 2W12A 2O3EA 3D5RC 4F3QA 3AYUA 2ERQA 4CH7A 3EUAA 4WZVA 2K3PA 1KUHA 4H4KC 1KUIA 5I4OA 3VSKA 4PJMA 966CA 2EROA 3SEZA 1ZVXA 3MMYB 3DPLC 4E7SA 1N77A 2A5WA 3F16A 4R3VA 3G5CA 2X3BA 3H9QA 4II3A 4L7AA 2VXZA 2DW1A 2DW2A 2OVZA 3KYLA 2PMZA 2DXIA 1UAAA 1OS9A 4A7BA 1QHGA 3LMCA 2FUG2 4DV8A 1A85A 2M4GA 2W00A 3S3OA 3E8RA 4AIGA 4FASD 1TZLA 4BEHB 1FMVA 2XS4A 2R4GA 3UVCA 4HNTA 1K7QA 3OYEA 4CCKA 4XOPA 1WJEA 1C7KA 4XM7A 2KP6A 2LOOA 2DJIA 4XM6A 1AF0A 3LSMA 2IGNA 1XUCA 4CA0A 5D3CA 1D1CA 3BC8A 3NWSA 3HDAP 4ZDOA 4XLAA 1CGLA 2HQAA 1W36D 2MLRA 3K4KA 2OZRA 3OS0A 2VQCA 4HG2A 4E7IA 3HDBA 2L0RA 4PFOA 3UNGC 2DDFA 2K9LA 2RNGA 2IS4A 3KWVC 4DPEA 3USNA 1UMSA 2YB9A 2L7KA 2OW1A 4PKVA 3TMOA 2MFZA 3OYKA 1GKCA 3HBUP 4ON1A 3L2VA 1AYKA 1YCMA 1KAPP 1DP3A 3EHXA 2KRCA 2Q2EB 1C8TA 4ZYAA 3OY9A 4PKQA 1JJ9A 3DU5A 3OYBA 3L0VA 2V1NA 3WV3A 4GR0A 2VJ4A 5TGTA 2AQEA 3EPZA 2R7UA 3F15A 4GQLA 3SEQA 2L5QA 3DL1A 3DWBA 4QPOA 4GR8A 2HNHA 3MA2A 1SMPA 1U0JA 4HEA2 1HFCA 2X6YA 1IRXA 2XC7A 4L6TA 3OYNA 5BOTA 1GO7P 5L7FA 2W1OA 2M0MA 3RPUD 2ELJA 3L2UA 3KRYA 1JH1A 3OR2C 1G8XA 1MNDA 3OYLA 1D7XA 1BR2A 1N75A 3OYDA 2BW3B 2P0WA 2X1DA 3W3CA 1PWQA 2KRJA 1R1IA 2OUMA 3Q2GA 4PKRA 1X1BA 3G2BA 2IS1A 1Z3JA 4H3XA 4WKEA 2VL8A 2JNPA 4J00A 1JAPA 2N8RA 1FLSA 1TT0A 1MMBA 4JPAA 3CMMA 3AKZA 3OIPA 1EAKA 2F4IA 4N4NB 3OYJA 2FV5A 2AIGP 1V5EA 1UEAA 2KHMA 4PJNA 1FBLA 2PJRB 4ZJZA 4PKUA 2FV9A 4PJLA 1NG7A 4KISA 4PK4A 5BOYA 4XORA 3S8PA 3HY7A 1XUDA 2CFOA 3HOSA 2R7RA 3AIGA 1JIZA 4ZR5A 2J0TA 1D1AA 3BCBA 3H9JA 4XLHA 4F92B 1D8FA 3RSNA 5KNLA 3V42A 2X85A 4CCOA 3L2WA 1MMRA 2VASA 3OYAA 2JUGA 4C30A 1IAEA 3ONQA 4BQQA 3TT4A 4XBHA 2ZSHB 1DTHA 2AQFA 3OR1C 2W13A 2X51A 2CW8A 3I3LA 1NG6A 1B8YA 3OOUA 1MNCA 3KMCA 2QPJA 1BM6A 3PNVA 1USNA 3AL0C 2VJJA 1N78A 3CJQB 5LABA 4ITVA 3VSLA 2CV1A 4QPQA 1CGFA 3L2QA 2WAQA 1HV5A 2CKIA 1GE7A 1UTZA 3LUNA 3RCOA 4DJAA 1SLMA 2WAEA 3BCAA 3LMMA 4CCNA 5JMYA 3VYSB 4ZTFA 1MNEA 4BACA 1QICA 3DTIA 4J01A 4BDZA 1QJIA 1R54A 2W0DA 2USNA 2Y6DA 3HPGA 1H71P 1SFKA 2OY4A 3OYFA 4KJZA 2KLOA 3DU6A 3EDGA 3KEJA 4PUSA 4QKZA 4KT6A 2WO8A 1OR7C 4MLOA 2DW0A 4RM2A 3OYIA 2Q1ZB 1ZXCA 4I35A 3LGPA 5FRNA 4Y3OA 1LKXA 3V96B 3HY9A 3MKWB 2W7NA 5KCMA 4OWRB 4GRIA 2JT6A 4KITB 3K6GA 5KHDA 2GOXB 4BQNA 2DOAA 2LRDA 4D1QA 1R55A 3NWTA 1E0EA 2LY1A 1BR4A 2CUJA 1G9KA 2X3CA 4R79A 4PJJA 3FKJA 1R1HA 2OXUA 4J4MA 2YIGA 3OYHA 4Y33A 2A8HA 3PSIA 1DQUA 2M7AA 3EWJA 2XF5A 2MD0A 3LSGA 4NC7A 3BA0A 1X1AA 2HU9A 3HXLA 1YP1A 1KUKA 3WV2A 4AU7A 1JAOA 3OS2A 3PL8A 4H82A 2JIHA 3VTGA 2E5ZA 2IGMA 3HOTA 1C3IA 1IACA 2WO9A 3DPFA 2XS3A 3FHNA 1Z7LA 2LREA 4NQWB 4BE1A 1QUAA 2O36A 5I43A 5FROA 4D9JA 2IXSA 2L9SA 4IZZA 1DGWY 3OS1A 2MC4A 1ZELA 2TCLA 3DSLA 3LKAA 2R7OA 3VI1A 2HU6A 4JA1A 4XONA 4IQ4A 4JQGA 4AVZA 1BKCE 3SDBA 1CAQA 1MMAA 2R7SA 1I1IP 3MKZA 1YOUA 3LQBA 2VQLA 4H1QA 2JA2A 1ZXVA 2OY2A 1DGRM 4HX3A 4ZDLA 2BVLA 1FMWA 4OAYA 2R7XA 3W2AA 3Q2HA 2VJIA 3LSHA 2NOJB 2XF6A 4JOMA 1MMQA 3VYRB 2QKMB 4CSWA 3ZXHA 2R7TA 3KEKA 1LVKA 1O0QA 1EB6A 1QIBA 3O64A 3RTSA 5CXAA 4II2A 3ZVSA 2IS6A 3TBIA 3TVCA 1GKDA 4EFSA 4BDYA 2CV0A 2XDVA 2KZVA 1CQRA 2VB6A 3CF2A 1XFUA 4FXYP 3A2KA 2OW2A 3N05A 2X6XA 3QODA 2WOAA 1BR1A 2VLAA 4NC8A 3LEAA 5D2BA 1JANA 2O5RA 3CZ6A 4JQFA 2YUFA 2BVMA 2XF7A 1BSWA 3EUKL 2Z16A 4WKIA 1A86A 2BW3A 2K2GA 1GO8P 3KMEA 2OXZA 4DD8A 2DDYA 3VYTB 1UMTA 1UTTA 3W2WA 1O0TA 4B43A 5CPRB 3OYCA 3OYGA 2V6EA 4BU2A 3LQ0A 3EDHA 4Q1LA 4XKWA 4IX7A 2Z1DA 1Y56A 2V9KA 1WJ5A 1ZP5A 3TL4X 3BLYA 4H49A 1MW7A 3IP4B 4RLQA 5CQEA 5LFAA 5HOOA 3IUOA 4ZDPA 4YELA 4FU4A 3LUMA 4P1WA 4XKBA 3P24A 3HKZA 3SHIA 2Z2DA 3DPUA 1K6YA 3L0TA 4PSXA 1GE5A 4N4OB 3I7GA 2VKHA 4EATA 2PJRA 2MZIA 3WV1A 4F93B 4OAZA 4BJ5C 3U1RA 2QKLB 3K70C 3VWBA 4XMYA 5B5OA 4BE2A 456CA 1Y8JA 3FBIB 4FVLA 3CESA 3DKXA 3W2VA 2RJQA 1BUDA 3HUGB 4I03A 4HSRA 1RMZA 3TSKA 3K4JA 4F55A 4HMAA 1X1DA 2W4SA 3P1VA 1BQOA 1K7GA 1CK7A 4DF9A 1Z3XA 2XAUA 4IJOA 5I2ZA 5HNFA 3PJRA 1MMGA 4E7LA 4XR6A 2V4BA 3LILA 3LK8A 2VJ5A 2K9MA 3I9V2 1KUFA 2X3AA 3VYUB 1BIWA 1BUVM 2SRTA 5CQGA 3I7IA 2M4KA 3K7NA 4CCLA 2IGKA 1WJAA 3FBNB 4C2TA 1S9HA 2VIXA 4JIJA 2VKDA 2ZFUA 1X4PA 1QHHD 1HA8A 4IQJA 1JKYA 3F17A 2MLSA 3CP2A 1OMJA 2D1OA 3LJTA 2KDOA 1JI8A 2MABA 2CH0A 1YQYA 1OM6A 5FRMA 3HB2P 3HYGA 4E7ZA 3NX7A 5HVQC 3E1SA 1AKLA 2L9NA 3DWLE 3ZUKA 2A6TA 2WBMA 4P5OA 1RM8A 1ERDA 4Y4RA 2BOLA 5JHFA 4PKTA 4RM3A 1LDKB 4IUWA 2AYKA 1WJBA 1SLNA 3F19A 3QOEA 2Z2SB 1S4BP 3A4CA 1I73A 1XFXA 2RJPA 4H30A 4H84A 5BPAA 2WY8Q 1J7NA 2WB1A 3F1AA 4AXQA 1P9QC 3OL3A 2V26A 2W14A 2E3XA 1CGEA 1SATA 3D5SC 2E1MB 3KHIA 4GWNA 3K4NA 4XN0A 3KEYA 1D1BA 4DOZA 1PWUA 1X19A 1PJRA 3PFYA 2MZEA 3UR3C 4XLCA 1Z3YA 4E4HA 2CUZA 2HVRA 1G49A 3G42A 3HL2A 1T0FC 3PUBA 2MZHA 3A1YA 1GXDA 1L6JA 1XURA 4BGDA 1D0YA 1BZSA 3GBOA 3OWTA 3FDYA 3SZGA 4PFPA 4BJ6C 4X0GA 1K7IA 4JP4A 4DGWB 3DNGA 3O2XA 4ZTJA 2CLTA 2LG4A 5I0LA 3PSFA 2DT7B 5D1TA 4DIQA 3RQ4A 3MD2A 3ZRGA 4BQOA 4CUGA 4IN9A 4XN3A 1WJCA 3C2HA 2CS3A 4PKWA 2KL4A 5D1UA 3RTTA 4U7BA 3DPTA 4XKVA 3RTRA 4CTHA 3LSIA 3H5AA 1XFVA 4BEHA 2CW7A 4GWMA 1SRPA 4XKCA 1XFZA 2OW0A 1YE9A 3DQVC 4BL0B 4CCJA 5LD2C 4BJTA 4ILWD 3D5LA 4WK7A 3C2GA 2CMPA 4FXQA 4XQFA 1HY7A 2WAFA 2XSJC 3F18A 3ZXSA 1EA3A 1D5JA 3K10A 3OL4A 2HDWA 4XM3A 2LH9A 4C9YA 2IS2A 1I76A 1ND1A 4AYKA 3LIRA 2ZXHA 3EDIA 2IGOA 3S3NA 1OLTA 1QIAA 4BUPA 1V5FA 3BG7A 4E6KG 3AL0B 1JK3A 2PJTA 5CZMA 2LC2A 4BXFA 1AA7A 3CP8A 1Y0VA 1ASTA 4H2EA 4L19A 2K9CA 4XLFA 4IKFA 3QYBA 4AUOA 1HTDA 2HPMA 1BQQM 2ZXIA 2R7VA 1JIWP 1KBCA 1Q3AA 2K5CA 2WADA 2UWMA 3IAS2 1QJJA 4L63A 1GE6A 3HC7A 4G0DA 4ANJA 3EDZA 2OVXA 1UELB 4NNJA 1OS2A 3CKIA 1YX3A 1D0ZA 1X4OA 1PWVA 3LJZA 4RLFA 1IAAA 4ZC3A 1R6RA 1G59A 4LITA 3OHOA 5HNHA 5D7WA 4LIUA 1DMTA 3ZCOA 2X7MA 1MMDA 4YRVA 4GF1A 3OHLA 1SAUA 4BE0A 2E2DA 3H35A 2VQHA 3PNYA 3MKYB 2LYCA 1OO9A 4E7KA 1GLNA 3AYKA 2DCEA 1T95A 3K4LA 2VQGA 2Y6CA 3LSKA 3SYTA 2JT5A 1MMNA 2F6CA 4XOTA 4B44A 3ELMA 5CUHA 3L2RA 2R7WA 2KRHA 1IABA 3OIQA 1WJFA 4RMNA 1G4KA 1D0XA 1IADA 2X1EA 3KX2A 1WFXA 3VDXA 3DLAA 3N2VA 1HOVA 1MMPA 3DEEA 3DPEA 1VZ0A 3TS4A 1PYVA 3QYFA 3H5NA 2X6WA 3IAM2 4HPQA 3LIKA 2L2OA 1WJDA 2F5VA 3DKYA 2JSPA 4PSWA 830CA 1ZS0A 1B3DA 1G12A 1OM7A 1Y93A 1J09A 5H8XA 2OC6A 1ROSA 4GR3A 1ZTQA 3K70D 2LBFA 2WA0A 3K4BA 1V5GA 4LIVA 1Y6IA 1W36C 5CKTA 3H5RA 3M8JA 4XNFA 2M7BA 2OW9A 2X1CA 3K7LA 3K4MA 4B47A 2I47A 3EHYA 2WY7Q 4XCTA 2KPMA 5I12A 3OYMA 1HFSA 3BG6A 3HPHA 4G9LA 4XL9A 3DTKA 3LJGA 2Y0SA 2HVQA 3S32A 4F91B 4U87A 4E7HA 2RQQA 3B92A 1OM8A 2VXDA 3CJRB 1JAQA 2ZSIB 1XFYA 1WNIA 2V7FA 3J7AY 4YEJA 1KUGA 3H9GA 4HSTA 2JVHA 4G6TB 4B3XA 3QYEA 4H76A 1UG0A 2JSDA 3U21A 3PNTA 1YX5A 2E1MC 3F9KA 4DBRA 2KMUA 3N2UA 4AYBA 4DBQA 2W15A 2OI0A 2E5NA 4CCMA 1D8MA 1PWWA 3HBVP 2LBFB 2VPLA 5L79A 4LG3A 1BKCI 1KONA 2M3AA 4C2UA 2E60A 2UUZA 4WF6A 1FM1A 4BS9A 2W82A 3S3MA 2ERPA 2GOMA 2KQRA 2UV1A 4B48A 4PKSA 2CV2A 1PWPA 3K4CA 2J83A 4A3WA 1ATLA 3B8ZA 2I8DA 2DT6A 3OMYA 2R7QA 4XM8A 5B5PA 2MYSA 4F52A 4E7JA 3ZQQA 3LE9A 3GBGA 1XFWA 3S93A 3ZGKA 1BOBA 1QU3A 1G05A 4FETA 3LFUA 2OXWA 4CZCA 1IAGA 1EUBA 4HNUA 1SU3A 3E0JB 2V4JC 4NUBA 1R1JA 2D1NA 3B2ZA 4HRIA 2HVSA 1BKCA 2POJA 2JVGA 5D1SA 2RREA 3EUHC 5I3MA 1Z21A 3DTEA 3H0DA 1CIZA 2OV7A 3KECA 5HLTA 1LFPA 2HZDA 3AFHA 3LL7A 2HPIA 1X1CA 4XLEA 4GUYA 2LY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTI A;  3DTK A;  3DTE A; 
#chains in the Genus database with same CATH topology
 4L9N A;  3M1C A;  4X6A J;  2VV8 A;  2ZMF A;  3D5R C;  3F8B A;  4F3Q A;  3AYU A;  4CH7 A;  1KUH A;  3F21 A;  4H4K C;  1D8J A;  4AIK A;  2HYF A;  2GJ3 A;  3MMY B;  3H7W B;  3P09 A;  1YQA A;  4RA2 A;  3F16 A;  3E0Y A;  1OYW A;  2LD5 A;  1B6A A;  4EET B;  1O3R A;  2X3B A;  3WS1 A;  4KZB A;  4FH2 A;  3ABK H;  2VXZ A;  3P98 A;  3SH9 A;  1J0R A;  1XTA A;  4NBQ A;  2DPD A;  1IEL A;  4ESF A;  4EW7 A;  5M19 A;  3MR0 A;  2DW2 A;  2DOF A;  1PUF A;  4XSX F;  2PMZ A;  3R0A A;  2R5Y B;  3VOE A;  3IX4 A;  5J3L A;  5LLQ A;  4QU3 A;  3UME A;  1QHG A;  2FX0 A;  5KSH A;  4UY8 I;  1UHS A;  1Q2Q A;  3LY4 A;  1EH8 A;  4DV8 A;  3WTT C;  3KFW X;  2JKG A;  1S0W A;  5BOH A;  3CUE C;  4IBX A;  4FAS D;  4BEH B;  3GFM A;  1FMV A;  5TR7 A;  2KIQ A;  1HY7 A;  2JA7 J;  2KP6 A;  4A2U A;  2LOO A;  3IQA A;  1Y0U A;  2DJI A;  4N9I A;  1U9N A;  1IV6 A;  1B8I B;  4G3V A;  3H36 A;  2IGN A;  1GXQ A;  2XGC A;  3ABT A;  3NEU A;  2Y2K A;  2Z2M B;  3VP0 A;  1XUC A;  3BC8 A;  1ZN2 A;  4I3J A;  5JVT A;  3T1Q B;  1PRQ A;  1W36 D;  5EVI B;  1TQP A;  3K4K A;  1TNS A;  1YOV B;  3OS0 A;  1TQI A;  2ZL1 A;  4PFO A;  2DDF A;  1W7P B;  4EQQ A;  2K9L A;  5FKN A;  4KZ9 A;  2D2W A;  4K2E A;  4DPE A;  1A6I A;  3E5X A;  5IYC J;  5F6A A;  2YB9 A;  1L3L A;  3GTM J;  2OW1 A;  2NS7 A;  3HOX J;  2Z3Y A;  4O5V A;  3NIA A;  3HBU P;  2ZKZ A;  1XJ3 A;  2V1B A;  2J3T D;  3RH8 B;  3D1N I;  3O5Y A;  1AYK A;  1I2W A;  5A8B A;  5IP7 J;  2Q2E B;  3WTW C;  4GKU A;  4PKQ A;  4HY8 A;  2MLG A;  4PGH A;  1JJ9 A;  4RAG A;  2OAQ 1;  2KIU A;  4NG2 A;  4CGZ A;  3WRT A;  1N4O A;  1OQY A;  3F8F A;  5TGT A;  1YLW A;  2ZCW A;  1OYY A;  1X1P A;  1LNW A;  4EUZ A;  3SEQ A;  5J8X A;  1W79 A;  1YLT A;  1TC3 C;  3JAM K;  1UZC A;  2BBY A;  3MAJ A;  3O87 A;  3ZNY A;  1U0J A;  5GHX A;  2X6Y A;  3CME I;  2XC7 A;  1EJ9 A;  4LEN A;  2COB A;  4IHW A;  3MKL A;  1IJW C;  2JA8 J;  4MMN A;  2W1O A;  2W15 A;  4F94 A;  2M0M A;  3RPU D;  3L2U A;  3B6C A;  5HWT A;  4PM8 A;  3WG7 H;  2CJJ A;  3PQJ A;  2ZMV A;  1YG2 A;  3MKF A;  1BR2 A;  3CCV I;  3M8E A;  3OYD A;  1KDS A;  1XJ6 A;  1LE8 B;  4ARZ B;  1TWF J;  2EZI A;  2R5Z A;  2PJP A;  3E6M A;  3G35 A;  3HRU A;  4S2L A;  3G2B A;  3IC7 A;  2HOA A;  2IS1 A;  1SMY F;  4IUH A;  4H3X A;  4J00 A;  4X69 A;  1TT0 A;  4BBU A;  3CMM A;  3AKZ A;  4A0Y A;  2YX7 A;  2F4I A;  3W6K B;  3OYJ A;  4KIF A;  2AIG P;  1V5E A;  3BFE A;  1UEA A;  2MA3 A;  2PMZ N;  4PJN A;  2PJR B;  4QLC U;  2R9W A;  4PJL A;  5HPI A;  3V8J A;  3HTS B;  4EJW A;  1A04 A;  1WQ2 A;  2X48 A;  3GF2 A;  4FT8 A;  2BV6 A;  1S5L C;  2XPU A;  3FMQ A;  4XOR A;  3TW6 A;  2CFO A;  1TW2 A;  2NNY A;  3HOS A;  1ZR4 A;  2R93 J;  1XUD A;  3CC2 I;  1TL8 A;  2F4O B;  3H9J A;  1FP2 A;  4F92 B;  3S7O A;  5ILV A;  5KNL A;  5CHU A;  1CGP A;  1PP8 F;  2WGW A;  5FQM A;  2JUG A;  3WE2 A;  2ZM0 A;  3IWI A;  3T4L A;  3BP8 A;  2WB1 N;  5J40 A;  4A3I J;  4JXG A;  1DTH A;  3TT4 A;  1O57 A;  3OR1 C;  4PGG A;  5IT9 Z;  1VM1 A;  1MNC A;  2Y9Y A;  3OOU A;  3WGH A;  3BFC A;  4BJP A;  1BM6 A;  4NC6 A;  3FV7 A;  1MWT A;  1ZG3 A;  2RGV A;  3CC4 I;  5HW3 A;  1GA9 A;  3HIF A;  3WTZ A;  2Y59 A;  3K0L A;  3L2Q A;  4IUK A;  1HV5 A;  2CKI A;  5M3F J;  4BQM A;  1ALQ A;  4CCN A;  5F04 A;  1R1V A;  2ZD8 A;  1JTX A;  3QP8 A;  1JTD A;  3KZI C;  3RKQ A;  3HLF A;  1OCR H;  2OWH A;  3HJE A;  4HV5 A;  1IC8 A;  4EJO A;  2WZZ A;  3HPG A;  4BY1 J;  1OTA A;  2DPU A;  3EQU A;  1R00 A;  1H71 P;  2Y6D A;  1I50 J;  3ZCZ A;  1BLH A;  3IXH A;  4Q0J A;  2GZW A;  1VFC A;  2IT0 A;  3GCM A;  3TOA A;  4EU0 A;  2CUF A;  5KK1 A;  1QGP A;  3E98 A;  3SFI A;  4R0Q A;  3HY9 A;  5DM7 F;  5E3O A;  2JE5 A;  2R9X A;  1VND A;  4L18 B;  4BQN A;  3T1B A;  2Y9Z A;  3MKE A;  3LST A;  2HV1 A;  4FSF A;  2E1C A;  1BR4 A;  2CUJ A;  2JPC A;  5K5R A;  4R79 A;  4A3E J;  4OU0 A;  1ZRC A;  4H2E A;  4J4M A;  4X56 A;  1AKH A;  1HF0 A;  3P9C A;  4HQM A;  2VA0 A;  2Z6D A;  1S7O A;  4HOB A;  1P4X A;  4I0A A;  2XF5 A;  2MD0 A;  3LSG A;  4NC7 A;  4UVA A;  4BBR J;  3J80 Z;  3LSR A;  3JRI A;  1GXP A;  2A5Y B;  1IYS A;  2LVS A;  1W0T A;  3QNC A;  2ZLY A;  4KQO A;  4WZ4 A;  2W3H A;  5CX7 A;  4OOI A;  4H82 A;  3IRR A;  2Z33 A;  4MTE A;  1KU2 A;  2E5Z A;  1YRN A;  3FK6 A;  1S4R A;  2IGM A;  3HOT A;  3ZG9 B;  1C3I A;  3DPF A;  3WU1 B;  1Y39 A;  2VBZ A;  3I55 I;  3WTY C;  1QUA A;  3HOW J;  2RV8 A;  5FRO A;  4WCG A;  2DTR A;  1J9M A;  2L9S A;  4IZZ A;  2PHY A;  3COA C;  2TCL A;  3DSL A;  4I76 A;  1NXY A;  3VI1 A;  3I59 A;  3KZY A;  3L2C A;  4XON A;  3ZG7 B;  5K7F A;  4IQ4 A;  3ZN1 A;  4AVZ A;  4DN0 A;  1BKC E;  3JVU A;  1MMA A;  2R7S A;  1YOU A;  2GQQ A;  2HXO A;  4P9F A;  1ZXV A;  1S72 I;  1DGR M;  4HX3 A;  1K6O A;  4RYE A;  5J1R A;  2BVL A;  2J9O A;  1PWQ A;  4R1G A;  3C8C A;  1UJ8 A;  2VJI A;  3LSH A;  3Q9V A;  5ICC A;  3CD6 I;  1BIB A;  1BA5 A;  2QSF X;  3KP6 A;  2EIJ H;  3HBL A;  3BLM A;  3SJM A;  2GIZ A;  2QKM B;  4YFX F;  1LVK A;  2LF7 A;  4PM6 A;  1EB6 A;  3CUQ A;  3RTS A;  5CXA A;  4II2 A;  3ZP5 A;  5L3D A;  2K4J A;  4EES A;  3L09 A;  5D4S A;  4N1X A;  3TVC A;  3P7N A;  2EFX A;  3F1P B;  4L5E A;  3NBL A;  2VB6 A;  3CF2 A;  4I6Z A;  2ZME C;  2ZME A;  3A2K A;  4EGZ A;  3I4N J;  1PNE A;  1Y54 A;  1N9O A;  4WEJ A;  2X6X A;  3B33 A;  3LYX A;  3BY6 A;  3PO2 J;  2PG4 A;  2HP9 A;  4KQD A;  2M1C A;  4DKI A;  3LEA A;  5B3S H;  2YUF A;  2XF7 A;  2QUF A;  5EZH A;  3ZG8 B;  1NRF A;  4EEU A;  5CRF A;  2Z16 A;  1IKG A;  3U2A A;  5FKK A;  4EWF A;  1IXC A;  5A93 A;  4WF2 A;  2Z5U A;  5DJU A;  3VYT B;  1O0T A;  4ABZ A;  5CPR B;  4B43 A;  1RGY A;  4UEY A;  2RNJ A;  3D0S A;  5FFZ A;  1H88 C;  3VFH A;  1QME A;  5CLS A;  4BU2 A;  4Q1L A;  4XKW A;  4IX7 A;  1ES5 A;  2OF7 A;  4H49 A;  1T1A A;  5DJT A;  3UB6 A;  2RC4 A;  1LUJ B;  4RS8 A;  3HBR A;  4BL3 A;  3IUO A;  1Z05 A;  4ZDP A;  1LEB A;  2P81 A;  4ZJ2 A;  4N1H A;  2M87 A;  2Z2D A;  3L0T A;  4HF0 A;  3CMY A;  2FQ3 A;  2HQ5 A;  2VGL S;  3FXK A;  3V3R A;  3PBN A;  1Y28 A;  4BMW A;  3V8L A;  3HVF A;  1EI5 A;  1HQC A;  5IT9 K;  4WWC A;  2M30 A;  2QJ7 A;  4U0T A;  1WVR A;  4KZA A;  2WV0 A;  3GEC A;  1ES3 A;  3TSK A;  3UE3 A;  1Z91 A;  3LSJ A;  2OV5 A;  1B59 A;  1TTY A;  1YW7 A;  2M1B A;  4LOC A;  4OQG A;  4F55 A;  3CQZ J;  4HMA A;  1T8I A;  4AD9 A;  4DF9 A;  2DMN A;  4ZZL A;  1U5T A;  1X3W B;  4LV3 A;  5D3C A;  4HI4 A;  2V4B A;  2QHK A;  3ZDJ A;  2GXA A;  1YKD A;  3I9V 2;  4XLP F;  2JKR M;  3RJP A;  2L1M A;  4O01 A;  2PBI A;  5BS6 A;  2QJ5 A;  4ARZ A;  4CDG A;  4KIG A;  5CQG A;  4OMY A;  1O07 A;  2UZK A;  2D45 A;  5ICF A;  4A0X A;  3HDD A;  2J7V A;  2WGV A;  3F1N A;  3W4Q A;  1S9H A;  2HYJ A;  2STT A;  1PW1 A;  1ACF A;  3QRF F;  3FC7 A;  3CUE A;  4JP0 A;  3PAE A;  4HX8 A;  4UAA A;  3GV9 A;  1HA8 A;  3DBL B;  4N9K A;  1SFO J;  2MLS A;  4K08 A;  2D1O A;  2KDO A;  4CLC D;  5A2Q Z;  1JWZ A;  3E2L A;  1MBF A;  1OTE A;  3IHB A;  1ERM A;  3HYG A;  3BLS A;  3RQI A;  4MGR A;  1FTZ A;  4OOY A;  3ZG0 A;  2PD8 A;  2DJN A;  1RET A;  3E1S A;  1AKL A;  3DWL E;  3HTU A;  3ZUK A;  4KZ4 A;  1BBY A;  4P5O A;  4I3I A;  1U78 A;  1R58 A;  2VK3 A;  1K0K A;  2ZC4 B;  2CQQ A;  4I7H A;  4A3J J;  4RB0 A;  1ZLK A;  1Z6R A;  2IW5 A;  1K6R A;  4ZYH A;  1BUE A;  1WJB A;  1CEF A;  2DA5 A;  3QOE A;  1I73 A;  4ZYE A;  4H84 A;  1NJ4 A;  5BPA A;  3ZMD A;  1ULY A;  3WGG A;  2WKE A;  2WY8 Q;  2ZOI A;  1WE4 A;  1W7P A;  2E8J A;  4AXQ A;  1XJ2 A;  5I5L A;  3CCR I;  1S3J A;  5L3F A;  1H89 C;  5FQ9 A;  1SAT A;  3D5S C;  3CUQ B;  4EM2 A;  4KNY A;  1A6Q A;  3K4N A;  1V4R A;  1MWS A;  2KOI A;  1PI5 A;  5GLA A;  1FBU A;  3MZD A;  4DOZ A;  3T0Y A;  1PWU A;  5FLX K;  3ZNT A;  3ZVW A;  1GVD A;  4R8H A;  3V8K A;  1R1U A;  1PJR A;  3JW4 A;  3PFY A;  1P4A A;  3KEO A;  4HNV A;  3IXD A;  5GL9 A;  1Z3Y A;  2XIG A;  4KUO A;  2KRJ A;  3E6D A;  1X2M A;  3PUB A;  2EX9 A;  2BYV E;  2BE5 F;  2VKV A;  1WYC A;  2MZH A;  1Z9C A;  1FCN A;  4EGY A;  1BZS A;  5CTN A;  2EWV A;  3I59 B;  1H3Q A;  3LR3 A;  2JRM A;  2GA1 A;  1RCJ A;  5AIP A;  5DDG A;  4GZB A;  1T38 A;  4JP4 A;  4AUX A;  4CXF A;  1FSH A;  1OCP A;  2LG4 A;  2X4H A;  4B8X A;  2CLT A;  2F5C A;  5I0L A;  3DEW A;  2R5Y A;  3PQK A;  2DT7 B;  1S67 L;  4DIQ A;  1W63 M;  3MD2 A;  4JBF A;  3HOU J;  1SKF A;  4IN9 A;  4XN3 A;  1WJC A;  3ZMT A;  2CS3 A;  3LQR A;  1I3Q J;  3J7Z I;  2EV6 A;  4XKV A;  3RTR A;  2PI0 A;  2MJ6 A;  3L9F A;  4JX5 A;  5C4X J;  1SFE A;  3HLC A;  4BEH A;  2CW7 A;  2ZQ9 A;  4GWM A;  3T4S A;  1SC7 A;  3DAV A;  2IA2 A;  4I09 A;  5L3B A;  5LD2 C;  1U9O A;  4CCJ A;  3BPX A;  4BJT A;  4YG2 F;  4WK7 A;  1ZKJ A;  2V0U A;  2Y2I A;  3F18 A;  2WAF A;  5LGN A;  4OLG A;  4LCM A;  3T1R A;  4GW9 A;  3ZXS A;  1EA3 A;  1JT6 A;  3K10 A;  3MXQ A;  4QIW N;  1FBS A;  2IS2 A;  5EVI A;  4HEF A;  1NK2 P;  4U7D A;  4AYK A;  1FIL A;  2C5W B;  3S3N A;  3A01 A;  1HBX G;  3KO6 A;  5AON A;  4DXC A;  4CZZ A;  2FBH A;  4G12 A;  1PWC A;  1YM1 A;  3QHY A;  1V5F A;  3BG7 A;  3AL0 B;  1VEU A;  1JK3 A;  1XC5 A;  3AGD A;  2LC2 A;  4UXN A;  1P2F A;  3W4O A;  1TS0 A;  2R78 A;  4S04 A;  4HH2 A;  4Y15 A;  2OLU A;  4ZAM A;  2ELH A;  1ZKG A;  5D6F A;  1MWU A;  3Q1F A;  3HGG A;  2B0L A;  1HTD A;  2DMQ A;  2EPF A;  1F98 A;  2B02 A;  3VFF A;  2PAV P;  1OTD A;  2PQ8 A;  2FXA A;  2V0W A;  1R36 A;  1PVE A;  2UWM A;  3T4K A;  5E8G A;  1GE6 A;  4G0D A;  5DUK A;  3J7Y J;  3EWK A;  5H8X A;  2OSU A;  1YLY A;  4NNJ A;  3CKI A;  1YX3 A;  3A01 B;  4AFI A;  1LSW A;  2DMU A;  3ISG A;  1L0O C;  1IAA A;  3K2A A;  5LEJ A;  2WGI A;  1R7J A;  4Z2Y A;  3NC8 A;  3QP4 A;  5D7W A;  5DUI A;  3LA3 A;  2X7M A;  4AIJ A;  2XAJ A;  1SD6 A;  4N0B A;  2HZ5 A;  5F5Y A;  3EOI A;  3U1K A;  3H35 A;  2VQH A;  4ETS A;  3HJI A;  5EFW A;  2LYC A;  1PFL A;  2DA6 A;  1XX2 A;  3KYC B;  1IXR C;  2ZBB A;  2A2L A;  3X2Q H;  3SYT A;  4FX4 A;  5HD5 A;  1DP6 A;  1MMN A;  4JGQ A;  1ZK8 A;  3CCU I;  1EF4 A;  2VT3 A;  5CUH A;  3L2R A;  1IAB A;  5CVJ A;  1NK3 P;  2V1X A;  3DW0 A;  1IAD A;  4IJA A;  4O8G A;  3VDX A;  3BY9 A;  3TSG A;  3JTH A;  1HOV A;  5F0F A;  3BFD A;  5K5O A;  3KE2 A;  4ZYD A;  3IAM 2;  5DTS A;  2L2O A;  2XRN A;  1WJD A;  2F5V A;  1ETO A;  3DKY A;  2JSP A;  2E2J J;  3TJZ C;  2QM3 A;  1JE8 A;  5GAG J;  1N25 A;  4WMC D;  4WYY A;  2WKQ A;  1ETW A;  2OC6 A;  3F0C A;  1ZTQ A;  2X02 A;  1IV8 A;  2LBF A;  2WA0 A;  3BZC A;  2ZJP F;  3LA7 A;  3FWL A;  4WMC A;  3RJU A;  4HBT A;  4DDS A;  3E5U A;  1W36 C;  3CJM A;  3ECO A;  2M7B A;  4EEF G;  2VJW A;  4B47 A;  2I47 A;  4BHC A;  1P97 A;  3IH3 A;  4JXV A;  4XCT A;  1SCW A;  1HFS A;  3JYI A;  4G9L A;  2HS5 A;  1S1Z A;  4LV1 A;  2OBP A;  3L00 A;  1XGJ A;  4KQR A;  3LID A;  1UFM A;  2ADU A;  2L9V A;  4FE7 A;  3ZMU A;  1YO5 C;  1GVJ A;  1K4S A;  1XCB A;  2MD5 A;  3FXR A;  2H09 A;  3CJR B;  1ERQ A;  1JJ8 C;  1HVB A;  3KSF A;  4XT2 B;  1JAQ A;  1WNI A;  2XGN A;  3H9G A;  4CYC B;  4G6T B;  3OOV A;  3QYE A;  4P0M A;  1UG0 A;  2JJ7 A;  5TIS C;  4XBF A;  1YX5 A;  2E1M C;  4UUS A;  3E6C C;  4L0Y B;  3HGY A;  5HAI A;  4RB1 A;  1YYV A;  4V19 K;  2XD5 A;  1J5Y A;  3N2U A;  4AYB A;  4DBQ A;  1JHF A;  5J4V A;  1AWC A;  2E5N A;  1RKW A;  3GR2 A;  4XSZ F;  3MQQ A;  4HIA A;  1PWW A;  2OI0 A;  2LBF B;  1A35 A;  2NUP C;  3HBV P;  5L79 A;  5CED A;  1A36 A;  2QBY A;  2UUZ A;  4WXH A;  3FYZ A;  2GOM A;  3CUO A;  2UV1 A;  3TP0 A;  1WYB A;  2CV2 A;  4A3W A;  2BTF P;  4CHU A;  2XAS A;  1ATL A;  3MN2 A;  3I54 A;  1Z6F A;  1ZG6 A;  3B8Z A;  1EH7 A;  4BY7 J;  2X6O A;  3BYD A;  1ZTU A;  3HB9 A;  3UB9 A;  4BYY A;  3WTX C;  4HX4 A;  1XSV A;  4MTD A;  2TRT A;  2HDU A;  2KDK A;  2KZG A;  2V2F F;  3MXS A;  1XFW A;  3LE9 A;  2VV7 A;  3S93 A;  1BOB A;  1HDD C;  1G05 A;  2OXW A;  4ZTK A;  5D4R A;  4P55 A;  1ZR2 A;  3W2Z A;  3M07 A;  1H9T A;  4NUB A;  4ENM A;  2D1N A;  4EFS A;  5CTM A;  1ONH A;  3F8M A;  2POJ A;  5FD6 A;  1V9Y A;  5TFQ A;  2YS9 A;  4L0L A;  4KZ3 A;  1IZ1 A;  1X2N A;  2KDZ A;  3LIC A;  5HLT A;  2ZC6 B;  4LD5 A;  2V6C A;  2HPI A;  1X1C A;  3DWZ A;  3K2N A;  4GUY A;  2K7L A;  2XFS A;  1IN4 A;  3GQZ A;  3LI9 A;  4H6J A;  2ECC A;  1YJN I;  2ERQ A;  3W6V A;  3G4P A;  1JVJ A;  4N9H A;  3PUF A;  4UVC A;  1ON2 A;  1P4W A;  3PIP F;  2B95 A;  3SEZ A;  4E7S A;  5FI6 A;  4KA4 A;  3UPN A;  1N77 A;  2A5W A;  3N7W A;  2RCX A;  3OPL A;  4L9F A;  2CQ7 A;  5IT3 A;  1OME A;  4DW6 A;  4ASN A;  2HJ9 C;  4GHI B;  3A3J A;  4P85 A;  3TP3 A;  3CLQ A;  4EER A;  2HKX A;  2OD5 A;  2P7C B;  2NYX A;  4EMS A;  2HDS A;  4L7A A;  3MQ0 A;  2OVZ A;  2PT7 A;  2HFH A;  2EB7 A;  4DYR A;  3OSG A;  2DXI A;  3KX0 X;  4GD6 A;  4MBK A;  1CK3 A;  4P87 A;  1TT5 B;  2M8G X;  3VE4 A;  3LMC A;  2E19 A;  1DJA A;  2A6E F;  5CVR A;  1N9N A;  1P9R A;  2CQN A;  2ACJ A;  3UY6 A;  3CPT B;  3RFB A;  1MBE A;  1YLP A;  2M4G A;  2W00 A;  2XGX A;  5M5Y J;  3E8R A;  2QQB A;  4Q5S F;  3L7W A;  4KUM A;  4G94 A;  1JJ6 C;  2XS4 A;  4CCK A;  1OJL A;  1WJE A;  3M2J A;  4GS9 B;  4IBR A;  1E3P A;  3OIO A;  4PAU A;  2M8E A;  4DRT A;  1AF0 A;  1MC0 A;  2VUM J;  3LSM A;  1R4N B;  2D1H A;  5FB2 A;  3ZOB A;  3UB7 A;  3KCC A;  3NWS A;  3HDA P;  2HDR A;  2HQA A;  2OA4 A;  4MEZ A;  2MLR A;  2LKS A;  4HG2 A;  4E7I A;  5LBQ A;  4LRZ E;  2D5V A;  2J5O A;  4NXE A;  4X6T A;  5DF7 A;  3UNG C;  2WC2 A;  5KAF C;  3BR0 A;  4E6X A;  4E3O A;  4EJT A;  4EQI A;  4V2F A;  4OPQ A;  1I2S A;  2L7F P;  3USN A;  1E3H A;  2H94 A;  2C6W B;  2DQL A;  1D06 A;  3B3X A;  1GKC A;  4ON1 A;  3GW2 A;  2DOD A;  5FSR A;  4IEJ A;  1K57 C;  3ERM A;  3EHX A;  4UUT A;  4ZYA A;  1ZYR F;  2ZQD A;  3MF0 A;  3DU5 A;  1PP7 U;  1TF1 A;  2LF8 A;  5J8F A;  2MH9 A;  4GR0 A;  4XT2 A;  4A12 A;  2K7S A;  4IF4 A;  3A0R A;  4E6W A;  4GR8 A;  1FOY A;  1IYP A;  1QVT A;  2DI3 A;  3MA2 A;  3S1Q J;  4L6T A;  2P9V B;  5HL1 A;  3PBT A;  1Z0X A;  2E3X A;  5EPH A;  3DWK A;  2ELJ A;  5GLB A;  4FTX A;  1JH1 A;  3OR2 C;  1O7F A;  5I94 A;  3OYL A;  3A0B C;  1CQA A;  3CMZ A;  1T2K A;  4FCF A;  4ZJ3 A;  3W3C A;  3MSH A;  1N9L A;  1JGG A;  1R1I A;  1KGE A;  5M5W J;  2B9S A;  2XRL A;  4S2O A;  3CG5 A;  5D3O A;  2Y2H A;  4XXR A;  1PIO A;  2JRT A;  4JPA A;  4RGX A;  1EAK A;  3C7V A;  1FOF A;  2CW0 F;  1LEA A;  2W24 A;  2EFQ A;  3AG4 H;  1E4D A;  2J9P A;  4E3I A;  5DCM A;  3S22 A;  4JXW A;  1G4D A;  5EGO A;  1XA1 A;  2EZL A;  3G1M A;  5FA7 A;  1YJ9 I;  2A24 A;  1RGZ A;  1E17 A;  3Q07 A;  3JRB A;  5EUA A;  3S8P A;  4JPM A;  3TE8 A;  5BNG A;  3MZH A;  3IBJ A;  3AIG A;  3KLO A;  1JIZ A;  2J0T A;  3BCB A;  5LGU A;  1IN6 A;  1FOW A;  3A0V A;  2ZJR F;  3V42 A;  1MMR A;  1IAE A;  3ASN H;  4BQQ A;  2JA6 J;  4XBH A;  1JKR C;  3U9G A;  2AQF A;  2W13 A;  4M3D A;  3KP4 A;  1B8Y A;  1MBG A;  3KMC A;  1IXS B;  1W5D A;  3NOP C;  3SDG A;  1H8Z A;  2DDB A;  1ITY A;  4KMU X;  1EWZ A;  3AL0 C;  1XMK A;  2XKP A;  2DA4 A;  1J75 A;  1SAN A;  3EUH A;  5LAB A;  4A3M J;  4ITV A;  3VP4 A;  3VSL A;  4C3J J;  1CGF A;  2WAQ A;  2OU2 A;  5JI6 A;  1GHM A;  4WKE A;  2I10 A;  4DJA A;  3LMM A;  4G7H F;  1S7A A;  2WZX A;  4RGU A;  2W1T A;  2QCO A;  1MNE A;  2DO7 A;  1FCO A;  4BWI A;  3DTI A;  3E7L A;  4J01 A;  2X0L A;  4BDZ A;  1IYQ A;  2PFB A;  1W1W E;  2CRG A;  3G3Z A;  3W6J B;  2K3F A;  4L9E A;  1R54 A;  2USN A;  2W0D A;  3KEJ A;  4KJZ A;  3BOQ A;  1LSV A;  1DP7 P;  2E7W A;  2LP0 A;  2MW8 A;  4KT6 A;  1XMX A;  3O2P E;  2ME6 A;  2Y48 A;  5E1Z B;  3EQL F;  5B1B H;  2V20 A;  3F1P A;  2Q1Z B;  4MQV A;  5J4Y A;  3D72 A;  2O99 A;  1MBH A;  4MN6 A;  4WF0 A;  1JTY A;  3V96 B;  1I6X A;  3LNQ A;  1NHA A;  3MKW B;  5KCM A;  4GRI A;  4QHC A;  3JTG A;  5J3W A;  3V67 A;  1X3U A;  4PJ0 C;  5CYV A;  3LAP A;  3BFF A;  2DOA A;  4ESP A;  4GLQ A;  3IH8 A;  4NEE D;  1S1Y A;  1R55 A;  4QB8 A;  1G9K A;  3W4P A;  4RBO A;  4LRY C;  3CIT A;  1OJG A;  3HL9 A;  3FKJ A;  4L5J A;  1IF1 A;  2HPB A;  1R1H A;  2X3C A;  5IS1 A;  3F8C A;  2CSO A;  2JKF A;  3UDF A;  3RTY A;  2KJB A;  5JVG F;  5K7Z A;  2WGW B;  3H82 A;  4ETX A;  2A8H A;  3EWJ A;  3WWX A;  3BM6 A;  1X1A A;  2HU9 A;  2DK5 A;  1KUK A;  3WV2 A;  3CJT B;  3B6A A;  4MQ9 F;  3RKY A;  4BH9 A;  3PL8 A;  3MFX A;  4A3L J;  4FOF A;  3EET A;  4KN4 X;  4MFE A;  3SQN A;  2EFU A;  2XD1 A;  5FLV A;  1IAC A;  3CO7 C;  2PDR A;  2XS3 A;  1JKQ C;  3ASO H;  4NQW B;  4BE1 A;  3T4T A;  4MBF A;  5I43 A;  1KQ9 A;  3BTC A;  2IXS A;  1ETQ A;  3BG5 A;  1BLC A;  2WTE A;  2COM A;  4L9T A;  5KZH A;  4A3K J;  2MC4 A;  2DOE A;  4KG6 A;  1ZEL A;  4ESJ A;  3ULF A;  3E97 A;  3A0S A;  1BM9 A;  3MQO A;  5F69 A;  4JA1 A;  3JRE A;  1I1I P;  1TWA J;  2DW4 A;  1Y93 A;  3LQB A;  5FAT A;  1T33 A;  5GTI C;  3MKZ A;  4Z9Q A;  2EWN A;  2JA2 A;  2NOG A;  2BY1 A;  1OT9 A;  2HWV A;  3C4O A;  5DFY A;  3F22 A;  4ZDL A;  3ERE D;  3R7W A;  3TKY A;  4UA7 A;  4KG2 A;  1M1E B;  2VLG A;  2XA7 M;  1FNN A;  4OAY A;  4GS9 A;  4X1L A;  2VBW A;  1LI9 A;  2R7Z J;  2XAF A;  1FYM A;  1NY0 A;  4UUV A;  3UVC A;  3VYR B;  4CSW A;  3KEK A;  3ZVS A;  1O0Q A;  1QIB A;  3Q81 A;  2A61 A;  4JYK A;  3TBI A;  2IS6 A;  3IT9 A;  3NI9 A;  3RYP A;  3HLD A;  1YFH A;  1GKD A;  4C3I J;  4S2P A;  5FJ8 J;  2KZV A;  5E1W A;  1CQR A;  4FXY P;  4NQW A;  1K4T A;  3IL2 A;  3FM5 A;  2Y2G A;  4OPR A;  4A5R A;  2OW2 A;  1UST A;  2FNP A;  4BNC A;  5CHJ A;  2W1R A;  1DPR A;  1HW2 A;  4B93 A;  4MCW A;  4NC8 A;  3V50 A;  1SKO A;  2O5R A;  2OCC H;  3CZ6 A;  4JQF A;  2KKO A;  4HDU A;  3BPV A;  4FH4 A;  2BVM A;  2Y2O A;  2GX5 A;  3E4Q A;  4U88 A;  2CC1 A;  4HQE A;  1A86 A;  2VBX A;  2K2G A;  2K02 A;  1ODV A;  1R23 A;  3E6B A;  1GO8 P;  2MLK A;  4FQG A;  4DD8 A;  3V7R A;  3FXM A;  3W2W A;  5E3M A;  5F0H A;  3NHQ A;  2FSW A;  2XAQ A;  2Z9O A;  4I5S A;  4MO7 A;  3OYG A;  1B9M A;  3V5M A;  4GCV A;  1SEU A;  2NVU B;  2PLY A;  1Y8Q B;  3SW1 A;  1WJ5 A;  4B4X A;  1MW7 A;  1U6G A;  4RLQ A;  1AOY A;  5LFA A;  4YEL A;  3S2W A;  3C7U A;  4HW0 A;  2DA2 A;  3P24 A;  5AIQ A;  2LSO A;  1IRZ A;  1IUF A;  1K6Y A;  3LIE A;  1UHM A;  3KYD B;  1TDG A;  2VKS A;  1YT4 A;  3WHC A;  5FI7 A;  1CJF A;  3H7W A;  3I7G A;  2MZI A;  3WV1 A;  4FCY A;  4BJ5 C;  3U1R A;  3NOT C;  4LV0 A;  1SD5 A;  2DAO A;  2W85 A;  2Y0S N;  4I01 A;  3JRG A;  1BT5 A;  1SKO B;  2N8G A;  3IHA A;  3FBI B;  1LVA A;  2A69 F;  4NXG A;  3AAF A;  3CES A;  3W2V A;  2RJQ A;  4I03 A;  3HUG B;  1YQS A;  2W1T B;  3VV4 A;  2ZME B;  4BEN A;  2JPB A;  1RMZ A;  3HKZ N;  2JSC A;  5E17 F;  3VMA A;  1AWI A;  1IDZ A;  1U8R A;  1IYO A;  4X68 A;  4NXF A;  4C75 A;  4PM9 A;  3UO9 A;  1MZB A;  1BQO A;  1K7G A;  1U2W A;  1GHC A;  1FSE A;  1MJ9 A;  2QZ6 A;  2Y91 A;  3WU0 A;  1CQT A;  3LY3 A;  5EVE A;  5I2Z A;  4XR6 A;  1ERO A;  3LK8 A;  3K3D A;  4MDZ A;  3F8N A;  3GVA A;  3MS6 A;  3C1D A;  1QPI A;  4XUZ A;  1B1B A;  1NZU A;  2O8K A;  4DMZ A;  1W5T A;  1BUV M;  2VI6 A;  3H0G J;  2SRT A;  1OFC X;  4CCL A;  3TG9 A;  4C2T A;  1G5U A;  5A90 A;  5D8L B;  2VZW A;  4AC0 A;  4JIJ A;  3SH8 A;  2VKD A;  2ZFU A;  5HS8 A;  2V1A A;  4YFM A;  1QBJ A;  3T50 A;  1QZY A;  2F5F A;  3CP2 A;  1TBX A;  4Y13 A;  5IOZ A;  1LLB A;  5GHZ A;  3F17 A;  2PU4 A;  3LJT A;  2HTJ A;  1BZA A;  1BI1 A;  2CH0 A;  1VQ9 I;  4B9O A;  1OM6 A;  4EQ1 A;  1YQY A;  1IO2 A;  1L0F A;  4EBN A;  4E7Z A;  2Q8K A;  2A24 B;  4G3W A;  3M4O J;  4L5I A;  2P4W A;  5HLI A;  2L9N A;  2C6Y A;  1HZO A;  2GXB A;  3AGE A;  3S7Q A;  2A6T A;  4WXD A;  1E3O C;  4EBL A;  2BOL A;  3ULQ B;  5JHF A;  1YTY A;  2K4B A;  3MZE A;  4MNU A;  4IUW A;  3FX3 A;  5GPA A;  4HBU A;  1ETX A;  4G7Z F;  2Z2S B;  1JKO C;  3A4C A;  5TGF A;  1B72 A;  2E71 A;  2M7U A;  1XFN A;  2BAS A;  4A3D J;  2WB1 A;  3BQ8 A;  1E3U D;  2L7M P;  4WXC A;  4PM7 A;  2CQK A;  4GWN A;  2E1M B;  1D3Y A;  2H0T A;  2QSG X;  2ZO4 A;  2W3G A;  3KHI A;  2X71 A;  1WWX A;  2EFN A;  2MG4 A;  1XPX A;  5K5B A;  2KLI A;  2L4R A;  5EOO A;  3IBR A;  4R3A A;  1X19 A;  5B5O A;  1FPQ A;  1W8Y A;  1RR8 C;  3B02 A;  1MBL A;  2MZE A;  3UR3 C;  4XLC A;  3BG3 A;  2HVR A;  3G42 A;  3IWF A;  3VOZ A;  3HL2 A;  3U4L P;  1T0F C;  1G3S A;  3Q82 A;  3LIK A;  3A1Y A;  2CGP A;  5EM1 A;  1L6J A;  3VE3 A;  4YIF A;  3QPT A;  1SZV A;  4QPR A;  3GBO A;  4IL6 C;  2BEO A;  4X0G A;  4R38 A;  1K7I A;  3FXU A;  4D5C A;  4GJ4 A;  1ORK A;  2WKR A;  4KZ5 A;  3PSF A;  5D1T A;  1KZH A;  3S14 J;  3RXX A;  4QWQ A;  3DP7 A;  3HLW A;  1F2K A;  1HLU P;  1VQK I;  2CFX A;  2VX8 A;  3F3X A;  2EX6 A;  2ZL1 B;  4RA7 A;  3ABU A;  3LSI A;  1YJW I;  2E35 A;  3H5A A;  4M3F A;  1BI3 A;  3A3D A;  1XFV A;  3N8R A;  1SRP A;  1KU9 A;  4M9Z A;  5GAH J;  4XKC A;  3FHZ A;  1ENH A;  2KX6 A;  3BY8 A;  3H82 B;  5E2E A;  1DP8 A;  1YE9 A;  3DQV C;  4M4X A;  4A6D A;  5DKL A;  2V79 A;  1PW8 A;  2QLZ A;  4GDF A;  2CMP A;  4G3K A;  4FXQ A;  1TLH B;  4MEX F;  2XSJ C;  2O6G E;  1OJ5 A;  2ZJ2 A;  3KSH A;  2O7O A;  4C9Y A;  3OL4 A;  2HDW A;  2GBY A;  1ND1 A;  3LIR A;  3EDI A;  4P6B A;  2EXA A;  1P7I A;  2VGJ A;  4K0X A;  2Y75 A;  2DFI A;  3ZYT A;  3U1D A;  2J3T C;  2IP2 A;  5D5V B;  4NB5 A;  1GSX A;  1F4K A;  4R3B A;  2FJ1 A;  5IY5 H;  2BLS A;  1IRG A;  4IKF A;  3NDG A;  3QYB A;  2HPM A;  1DU6 A;  1U60 A;  2QPN A;  3IWO A;  2R7V A;  2K9S A;  4IHQ A;  3QNB A;  2LB5 A;  1BQQ M;  4IHX A;  2L02 A;  2VOD A;  1XA7 A;  2K5C A;  3CMA I;  3HSF A;  1KBC A;  1Q3A A;  1HTZ A;  4JXS A;  3IAS 2;  4XLN F;  4LB5 A;  2DYR H;  4I2O A;  5DF8 A;  3EDZ A;  3FPV A;  4OPZ A;  2OVX A;  2ZXJ A;  1O7L A;  4CO8 A;  1D0Z A;  3BRO A;  1X4O A;  1K55 C;  1PWV A;  3IHU A;  4RLF A;  1M6K A;  2W57 A;  3ZQH A;  2KFD A;  2WUQ A;  5F1J A;  1HKQ A;  4LIT A;  5LRS A;  5FGM A;  3QPL A;  1F9I A;  4KG5 A;  1S66 L;  4M3G A;  3H9W A;  4OP5 A;  3T8R A;  4H6J B;  3GFI A;  1XGO A;  3OHL A;  4OP8 A;  4DYC A;  3JPU A;  2L4A A;  1IN5 A;  5FL3 A;  4ON0 A;  1FIP A;  2KJC A;  3A0H C;  3LWF A;  4LMY A;  4U0W A;  2DCE A;  4RB3 C;  4IHV A;  2V1U A;  4LLO B;  3AYK A;  2F6C A;  3ELM A;  4YNR A;  2QA4 I;  1FR1 A;  1YI2 I;  2JN6 A;  2Y2J A;  2X1E A;  3KX2 A;  1XX5 A;  1G6N A;  1WFX A;  3ABM H;  4R1H A;  2J5P A;  5IYB J;  2M9H A;  1ZRD A;  4F3L B;  3TO7 A;  2H1K A;  1MMP A;  5BPD A;  1VQ4 I;  1I1S A;  3GWZ A;  1K6S A;  2HXI A;  2W27 A;  1KE4 A;  4IJG A;  3H5N A;  2X6W A;  4HPQ A;  5C4J J;  4OIN F;  1LQ1 A;  3SOI A;  1X3Z B;  4KZ7 A;  1Z77 A;  4BBS J;  1ZS0 A;  5IHV A;  3N4M A;  4BAY A;  4OIO F;  2XH9 A;  4XRS A;  3K4B A;  1V5G A;  4IVK A;  4IVI A;  2LKP A;  1B8I A;  3DBA A;  2ZC2 A;  5CKT A;  3OCL A;  3K1N A;  4XNF A;  3F6V A;  3MFK A;  3GLX A;  3K7L A;  5F27 A;  2R7F A;  1MSF C;  2KIM A;  5KVR A;  3C2W A;  3QPS A;  4U0X A;  3I53 A;  3OV8 A;  5TJJ A;  2YKF A;  4IRH A;  3M2K A;  1ZQ3 P;  4S2N C;  5CXW A;  3LJG A;  2A3S A;  3F72 A;  1P0Z A;  3J81 Z;  2DK8 A;  3BR3 A;  3S32 A;  3PM1 A;  4F91 B;  1KE0 A;  2EV5 A;  2DDA A;  1FY7 A;  4U87 A;  4Q4Z F;  2RQQ A;  4QD4 A;  4A6E A;  3KP5 A;  3BQA A;  1GHP A;  1ROS A;  1NYM A;  3J7A Y;  4YEJ A;  2OWJ A;  2Y2P A;  1KUG A;  2HR3 A;  4B3X A;  4ID4 A;  4H76 A;  5AQ9 A;  2JSD A;  3U21 A;  1ESU A;  3PNT A;  2E36 A;  3HOY J;  3TO9 A;  1OT6 A;  4A5M A;  3RYR A;  3F1N B;  1EKE A;  2F5E A;  3ZQL A;  1J9I A;  3L9K A;  1XGI A;  3LR5 A;  2RQP A;  4F3L A;  2QSH X;  3TO6 A;  3GSG A;  3EGD C;  3IRQ A;  2YUS A;  1FTT A;  1L0E A;  2F5D A;  2M3A A;  3NOU C;  5DD4 A;  2JT1 A;  2E60 A;  1SDE A;  4WF6 A;  4BS9 A;  2HP5 A;  1FIK A;  4UA6 A;  4X53 A;  1QZE A;  3CTA A;  3WHB A;  4B48 A;  4EVI A;  1LL5 A;  3MBZ A;  1PWP A;  2J83 A;  2JN7 A;  1OR7 A;  1IG7 A;  1VHM A;  4NXB A;  4E3N A;  3LSP A;  3WG9 A;  2V8C A;  2VGK A;  2YSR A;  3VEP A;  2MYS A;  2Y69 H;  4ZZD A;  3V7C A;  2VOP A;  3FG8 A;  2Y8H A;  1V3F A;  3IF6 A;  3GTP J;  1QU3 A;  3CHW P;  3GME A;  1EUB A;  1XXM A;  4Y7P A;  2QEX I;  1SU3 A;  4M3B A;  1MKI A;  2XKO A;  2H8R A;  3B2Z A;  1RZ4 A;  1BKC A;  2RRE A;  2EX8 A;  4UA9 A;  1ZH5 A;  5I3M A;  4AWX B;  1JXS A;  3DTE A;  3H0D A;  3CCS I;  3O88 A;  4I3A A;  3PHY A;  2J80 A;  3R0J A;  3AFH A;  3TW8 A;  2HEO A;  2LKX A;  2LY2 A;  1RIO H;  1I6H J;  1NYY A;  4L9G A;  3HG9 A;  5DTD A;  2W12 A;  4R23 A;  4U3T A;  2O3E A;  3T5X A;  4FIS A;  4I02 A;  3JRA A;  3EUA A;  5E2G A;  2H1L A;  2K3P A;  4ZDX A;  1ZRF A;  1XJ4 A;  1KUI A;  2EIM H;  4WZV A;  3IX8 A;  5D8K B;  2PYP A;  4IXA A;  2Y2N A;  3DPL C;  3HSE A;  1ZVX A;  2XK1 A;  4CPK A;  1WI9 A;  4ZH4 F;  2PX9 A;  3HRT A;  1JWV A;  2HF6 A;  2E1N A;  1S29 A;  1TP4 A;  2TCT A;  1LI0 A;  3H9Q A;  3IWZ A;  3ECH A;  4FHT A;  4II3 A;  5EV0 A;  4E04 A;  2DW1 A;  1GCE A;  2EIL H;  1J3W A;  3KYL A;  1UAA A;  1OS9 A;  4LG0 A;  3CCL I;  4HF1 A;  3GZ5 A;  2I5U A;  1FOX A;  4LRX C;  4A7B A;  3CDH A;  5FDS A;  2FFY A;  1ETY A;  1KDW A;  4OIR F;  3WS0 A;  4RX2 A;  5DTT A;  5M18 A;  2L3D A;  3S3O A;  2OQG A;  1TZL A;  1KE3 A;  1V54 H;  1GV5 A;  1T0F A;  3VPR A;  3O3V A;  2R4G A;  5LRR A;  4HHD A;  2RKH A;  4HNT A;  2UXN A;  1LDD A;  4RDU A;  3OYE A;  1TS8 A;  4XOP A;  1C7K A;  4BKX A;  1G6O A;  1XN7 A;  1K78 A;  2STW A;  2IEK A;  1HW1 A;  3RDI A;  4CA0 A;  3UKG A;  3CO6 C;  1D1C A;  4KN7 X;  2DMP A;  1TVF A;  1FQG A;  4PDK A;  4IRG A;  4OQH A;  4XLA A;  2M2E A;  1DJC A;  2OZR A;  5L09 A;  1U5T B;  1CI9 A;  3OBF A;  3FKV A;  4JBA A;  4GNU A;  3F15 A;  2XF3 A;  1IW7 F;  3FWE A;  3R4K A;  3IKT A;  4Y0T A;  1GV2 A;  4EM0 B;  5J7E A;  5KMW A;  3KWV C;  3C30 A;  2WV1 A;  2ZC5 B;  4JF6 A;  5CVI A;  2L7K A;  1ES4 A;  1UMS A;  1ONV A;  1IAW A;  2MFZ A;  5JR3 A;  1ETV A;  1BTL A;  3BFG A;  3Q3S A;  2QWS A;  2ISZ A;  3L2V A;  1KU3 A;  3JVV A;  2JA5 J;  1VQ8 I;  3UDI A;  1KAP P;  3FF5 A;  1RNL A;  1R49 A;  1YCM A;  3BJN A;  1ACI A;  2MC3 A;  4GCZ A;  2V1N A;  1AHD P;  2ID6 A;  4JGO A;  1WKM A;  2AQE A;  5F6F A;  3VB2 A;  2R7U A;  4NK3 A;  2EA2 A;  2L5Q A;  3B73 A;  2PMH A;  4O0P A;  5CGX A;  2HNH A;  3M1E A;  3DL1 A;  3DWB A;  3OPH A;  2ME0 A;  3S1R J;  4HEA 2;  1GA0 A;  1D8K A;  1TS6 A;  3I7J A;  3OYN A;  1FYL A;  1GO7 P;  3EGX C;  2ECB A;  4HNB A;  5L7F A;  2ICW G;  5C3E J;  3S1N J;  2VE9 A;  4XM8 A;  2IRF G;  1G8X A;  1MND A;  1HOM A;  1HW5 A;  4JGR A;  2P7V B;  4A5N A;  1N9B A;  1D7X A;  1N75 A;  5J8C A;  1SMT A;  3O8H A;  3CJN A;  2RL3 A;  3Q2G A;  4PKR A;  2P6S A;  5HFO A;  1YRN B;  2VL8 A;  5L10 A;  3GFJ A;  5IPA A;  2VC0 A;  1FLS A;  3G2Y A;  4N4N B;  3M8F A;  3LIF A;  2FV5 A;  1NTC A;  2XPV A;  4CLC B;  4Y7N J;  2KHM A;  1O3S A;  2EBI A;  1DUX C;  2GZA A;  4N92 A;  4ZJZ A;  1SAX A;  2FF4 A;  2FV9 A;  4CIC A;  2L01 A;  4CJN A;  4KIS A;  3T1X A;  4PK4 A;  5FQI A;  1PZP A;  3HY7 A;  1K7A A;  1B4A A;  2EJR A;  2R7R A;  1MH4 A;  2FOK A;  3OLO A;  2PD7 A;  2QYB A;  4QSH A;  1FX7 A;  4XIC A;  5EOE A;  3FMR A;  4CCO A;  3L2W A;  3SXY A;  2HQN A;  3OYA A;  4C30 A;  2BY3 A;  2WK0 A;  2CO5 A;  2ZSH B;  1POG A;  1LFU P;  2GM4 A;  2W3D A;  2X51 A;  3I3L A;  3RI4 A;  4ENK A;  2CQX A;  4P6Z S;  2O9B A;  2XR0 A;  3TRC A;  4JLF A;  1SD4 A;  1Y8R B;  2YPR A;  3KEQ A;  2FU4 A;  3PNV A;  3Q0U A;  5M3M J;  3CCM I;  4QY6 A;  1USN A;  1N78 A;  3CJQ B;  1BUL A;  4EXO A;  3Q0W A;  2DLL A;  1UHW A;  4M73 A;  2DNS A;  1C3B A;  3LGO A;  2DMT A;  2QQA A;  2XGD A;  5C44 J;  4ZJ1 A;  3ZHH A;  2DBB A;  2XGE A;  2IA0 A;  5CEC A;  2L54 A;  2FRH A;  3RZO J;  3RCO A;  1UTZ A;  3VP1 A;  2WAE A;  3FIS A;  5AVE A;  1T39 A;  3HSR A;  3VYS B;  4ZTF A;  2ETH A;  2H10 A;  4BAC A;  2ZM8 A;  3FM3 A;  2JZY A;  3TGN A;  3WOD F;  2H6C A;  3Q9S A;  1S6R A;  1LL8 A;  3HLB A;  3HUN A;  2KT0 A;  3IF6 C;  3OPP A;  2Y31 A;  4JKT A;  4IHY A;  1SFK A;  2EIK H;  3OYF A;  3KSI A;  1IN7 A;  4LPZ A;  4II7 A;  1RR7 A;  4PUS A;  3EDG A;  4QKZ A;  3RPU A;  4CLC C;  1MJA A;  3UN7 A;  1QQI A;  1OR7 C;  4MLO A;  4AIH A;  2ZQ8 A;  2H6B A;  5FO5 A;  1DPU A;  4I35 A;  4NDL A;  4HF2 A;  4Y3O A;  1LKX A;  3H1C A;  1H5X A;  3LGP A;  2K8