3DTIA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
243
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSLTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords IRRE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
total genus 73
structure length 243
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtiA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtiA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtiA01
3DTEA 3DTIA 3DTKA
chains in the Genus database with same CATH superfamily
3M8EA 1OTEA 1FX7A 4DBQA 5HARA 3SW1A 2JBFA 5E18F 2VQHA 2NAZA 1VQNI 2F5VA 2X9DA 1MMSA 1K4EA 1HXDA 3GF2A 5FRMA 2EILH 5DCMA 1RGZA 3FV7A 3GBOA 3MKEA 4RB0A 1MPLA 3DPFA 3MZEA 2R5YA 4QJGA 1O57A 3ZHHA 4IJOA 4HYEA 1OS2A 1Z6FA 2YKFA 1D5VA 2JSCA 4XNFA 3D9YA 1DJBA 4EJOA 1VF9A 1Y0UA 2FQ3A 1FOWA 3LJGA 2KDZA 3FWEA 3LMCA 3FISA 1A6QA 4MHGA 1PYYA 4ON0A 3I58A 2F5CA 4EM1A 1ZG5A 2X85A 4NDLA 3UPNA 1IZ1A 2G9WA 2OTJI 1DRMA 2EPFA 2J3WA 1HSJA 1R00A 3OC2A 2XASA 3HJIA 3ZDJA 2OXZA 2M1BA 3F17A 1W63Q 4JA1A 3GMWA 3HDDA 4MO7A 3LGPA 4HV5A 2CMNA 2CS3A 3UN7A 1R1JA 4P9UA 1LI0A 2MABA 1TWAJ 3PHYA 4GD8A 1TWFJ 2IEKA 3WV1A 4XM7A 1MZBA 3DEWA 1R1IA 5E1XA 1FMWA 1ASTA 3TMOA 2VBYA 3PBSA 3T1RA 4BHCA 4JXGA 3OYHA 2O5RA 1BKCE 5K5QA 1H8MA 2ADUA 5L3DA 4QPQA 2WGVA 2HTSA 1V4RA 2ZJ9A 3F8BA 4Q0JA 5E17F 1V5GA 1XX2A 1YI2I 5F69A 1MBGA 4H8RA 4JQGA 1T1BA 4JOMA 2E2DA 1Z91A 4L6TA 1OCTC 2JKRM 3LSTA 3ZQ7A 4QPRA 2K40A 2DQLA 3W2ZA 3ECOA 1I27A 4HZFA 2BHZA 2EZIA 5GTIC 4YFXF 1AXBA 1ZXCA 2NVUB 4RB2C 4WZ5C 4A5MA 2GBYA 4IRIA 3EEAA 4CCKA 3PUFA 2Y55A 5BPIA 1XJ2A 2FEZA 4BEHB 1OMIA 3HY9A 4E7KA 3CUEA 2ME6A 1ETWA 4LLNA 3C2WA 5TFQA 2EV6A 2MZIA 1MBKA 4BDZA 4ESPA 4OMYA 2BW3A 1K7IA 4EERA 3M9AA 3TQNA 2KQRA 3CZDA 3HLDA 3S1QJ 4L63A 3E5QA 3GLXA 2ZXIA 4IHTA 2NOJB 4RGRA 3LQRA 3BW6A 2P08A 1F43A 1O07A 1ZYRF 1KE0A 1DP8A 2LF7A 4GCZA 4PAUA 4KZ7A 3LEZA 1L3LA 3WU0A 3O5YA 5J47A 3CMAI 1VQLI 1ZXVA 3CD6I 5HDDA 3U21A 1VQ7I 2ZBKA 1K56D 4KZ5A 2JVHA 3RQ4A 4B43A 1W5CC 2X3AA 3F1NB 3CF5F 2Y0SA 3CJQB 1MMRA 3LY3A 3W2WA 4IHQA 4NXBA 2I72A 1T2KA 4KUKA 5I94A 3OWTA 3LSIA 3NCKA 3LEAA 1H8AC 2ESHA 3OIPA 2H0TA 4CTHA 3PR6A 5IOYA 2RAEA 1L0GA 2XPWA 1F36A 2X7MA 2RCXA 4XKBA 1P9QC 4PM5A 4O6JA 3D0SA 5KIZA 4U0YA 2HZDA 2CLTA 4J00A 1LDJA 3KRYA 2C6YA 4AXQA 3EWKA 2DPDA 2VOPA 2HXOA 3MZ8A 4R3BA 1FM1A 3NARA 4KN7X 3BPVA 3C38A 3B42A 4KZBA 2YKHA 1P9RA 1W7FA 2L4MA 5FI2A 3HOUJ 1UG2A 3BR6A 4EM0B 2HDQA 4C75A 3I64A 1V54H 1QHHD 2W13A 5JYPA 2PU2A 2HDWA 1FOKA 4RGUA 1JI8A 3RTTA 2HOAA 2BY0A 3AL0C 4GR3A 3CCYA 5HLHA 2GA2A 3WRTA 4BU2A 3PYPA 1FQGA 2IXSA 3GO5A 2HDUA 1VM1A 4WN5A 3BWLA 2FBHA 1YMSA 4HA8A 3LKAA 3S8PA 4ZH4F 4FISA 1ZREA 3OYNA 4N4NB 3BY6A 2FD5A 2V1AA 4AUXA 3DPUA 2IGNA 1E2XA 3M1CA 3PO2J 1XGSA 1A85A 4UUVA 1I76A 1MWTA 4MNRA 4RA2A 2O3FA 2STTA 3BLMA 3QYBA 1G3SA 1UHMA 5BOHA 5KZHA 4L7AA 5IT5A 1PWUA 2ZCWA 1H8YA 2X4HA 4M3DA 5D5XB 5FKOA 3EDPA 2A3UA 1G28A 1K78B 3LA2A 1Z9CA 5FL3A 3ONQA 4Y7PA 2FXAA 3E7LA 4LOCA 3L2UA 2PYPA 1S72I 1IXRC 2NVTJ 3KP7A 1TNTA 1UZCA 2HDRA 1HV5A 3I7JA 3P9CA 2QJ5A 4PHTA 2BBYA 1FBLA 1JKYA 2ZMVA 3L2WA 4DV8A 1VQ9I 2IAIA 3JTHA 3OV8A 4AU7A 5EE8A 2WKRA 2VXZA 2O36A 3F22A 5AIQA 2DPUA 4HF0A 1YHQI 2KKOA 2OU2A 5HDNA 3I9V2 2ERPA 3CUOA 1LQ1A 3WWXA 2K9LA 5CLSA 3C2GA 3IXBA 2CJJA 1WJ5A 4F91B 4IO9F 2V1ZA 2W3HA 3WTSC 3KYDB 4IEJA 3H0DA 4WEJA 3H1CA 4H6JB 3IH3A 2XF3A 1I1IP 2K4BA 2YB9A 1D7XA 4FD8A 5IP6A 4DQ2A 1UG0A 1X4PA 4JF5A 3E0YA 2OAQ1 3USNA 3OYFA 1MSEC 5ERIA 2M45A 2L7MP 2OXWA 1Z3JA 4M3EA 3GTMJ 1AHDP 4S2KA 3O6BB 3I55I 3UMEA 3ZCOA 2CFOA 4E3MA 2FNPA 2OCCH 1ES5A 2UV0E 5M5XJ 1HOVA 2UV1A 1LEAA 1BIBA 5D7WA 5GADJ 2P5VA 3FIWA 1X0OA 4C30A 5FI7A 3CG5A 4YFMA 3E1SA 4LLGF 3GTKJ 5LHGA 2Z6DA 5D8KB 2JK3A 3M7GA 2KL4A 4ZYDA 3EQUA 5E2EA 3OZHA 3T4KA 1ENHA 1ZG1A 2NS8A 4ABZA 2G2WA 2XA7M 4FXQA 3KYQA 4QSHA 1ZRFA 3UDIA 2XQZA 4GXOA 1S6RA 4DJ3A 1UTTA 4GHIB 1D3YA 4JGRA 3MD2A 1XFNA 4GDFA 4S04A 4GD6A 4GLQA 1UHSA 2TDXA 5IT9K 2ZL1B 5CJ9A 5CEBA 3JRFA 4QWQA 1BQOA 4DJ2A 2VJIA 2L2OA 3T8RA 2PRFA 3BPXA 5A2QZ 1T1AA 4BQQA 1YLYA 3RPQA 1XA7A 3HOXJ 1LUJB 1D8KA 1ZARA 2NVXJ 1VNDA 4F94A 5AQBA 1H71P 3JVVA 2K02A 2J5PA 4OPQA 3J7ZI 3OYEA 1DP7P 4RYEA 1GKDA 2OC6A 2K86A 1P4AA 5FRNA 3ECHA 2FZ0A 3KMCA 1DU6A 1BW6A 3B8ZA 4G6DA 2LBFB 4KT5C 5ILUA 2E8IA 1SAUA 2QENA 1UGUA 1T6SA 2W1TB 4CLCB 3JTGA 4DZJA 3FXMA 5D6EA 2M7UA 1FP1D 3OYDA 5EEAA 2H94A 2KIFA 3UB7A 4IPAA 2MH2A 4HQEA 4IUHA 4UV8A 5CUHA 3MF0A 3LAJA 3IBJA 3UVCA 2XB0X 4XRFA 1T18A 2F5EA 3T1SA 3SDBA 2Q0OA 5DM7F 2MSYA 1PZOA 5D4SA 5M1AA 1SMTA 3KX2A 3ZPLA 1U8RA 4DDSA 2BVLA 1SVOA 4II7A 1QVUA 4H3XA 3KP4A 1MMBA 2H8WA 2PX9A 1D8JA 3F8NA 4JX5A 1IRGA 3BJ6A 1JJ8C 3IHBA 3HLCA 4LCLA 1J3WA 1G59A 2XF7A 1OYIA 5IHVA 5GPCA 3MA2A 1EV7A 2VX8A 4CHUA 3O8HA 2ZM8A 2M4KA 5GLAA 4I98B 1DMTA 1FCOA 2D1VA 5LBQA 4ZDXA 3OR1C 4KFCA 4I01A 3CMZA 5KNLA 3F1OB 3DBLB 3CCJI 2R9WA 4Y33A 1GDTA 5FA7A 3S32A 1AOYA 3HLBA 1V9ZA 3ZXSA 1YW9A 2DRWA 3WGIA 1EAKA 4NKPA 1XD7A 3BG7A 2QBYB 2IGOA 3E97A 2DXIA 2VLAA 3ZP5A 3RKWA 2P81A 2JA6J 3EDGA 2EB7A 2V6CA 3ISPA 3V8LA 3H92A 1SZVA 1ZGJA 4A3WA 2PBYA 3NWSA 1K38A 3M3YJ 5J8XA 3G73A 5EV0A 3V67A 5DKKA 1Z7LA 2QUFA 3V7RA 2P9VB 1LI9A 3TDZC 2V6EA 4JF6A 1Z6RA 5A91A 2NUPC 2GXGA 1T0FC 4IJGA 2Z5UA 2YIGA 4BJTA 4HDVA 1T8IA 1I1SA 3DSLA 4A5NA 1KYZA 3GTLJ 1T08B 4ILWD 3VP3A 1ORKA 2MFZA 4RMNA 4YWZA 4X6TA 1LB2A 3K0LA 6PAXA 2Y0SN 2Y79A 2QPJA 5CHUA 3LA7A 3G6OA 2ZJPF 1BLHA 2OCEA 3QP6A 3K9TA 1MY8A 5HNFA 1I3QJ 4A0XA 1ERQA 4HLYA 1GSWA 3RPUA 3G4SI 3HG9A 4Y52J 2LY9A 4C3IJ 2DDBA 4MCWA 1ZHFA 2QHKA 2USNA 2K2GA 5K7FA 2EZLA 1O7LA 2QYOA 3JREA 3HDBA 2J0TA 5C44J 2OLVA 2HJEA 2XFTA 4KG6A 4LG0B 4O5VA 4S2MA 2F48A 4AIKA 2X1CA 1XFWA 3MAJA 1SU3A 2HTJA 1CGFA 3MMHA 2R7UA 3A0SA 3A2KA 3KLOA 4ESJA 1IO2A 4DKIA 4BEHA 2K7LA 1JHFA 2CUJA 3AIGA 4MMNA 3R0AA 2MYSA 2W3FA 4EBLA 5HAIA 3B92A 4BE2A 1Z09A 3H82B 3NDEA 3RFBA 4OVDA 3HRTA 2B0LA 2I47A 3K7NA 3ERMA 5DDGA 2CW0F 4RDUA 3PAGA 2LG4A 2LMDA 1WQ2A 2MJ6A 2ZSIB 3G30A 2CKIA 4U0VA 2VOOA 2K7SA 3CO7C 5GLCA 5BOTA 4MBKA 1M1EB 1BC8C 2E34A 5M5YJ 4H2EA 2M5WA 1IOUA 4FOFA 3C2BA 1BOBA 3DL1A 4AC0A 4A3CJ 3SS4A 1YJWI 2K3FA 1DJAA 4NUBA 2WWYA 2X1EA 3BG3A 2KLOA 3NC8A 4DE2A 3F1NA 1YSQA 2W27A 3ZMSA 1R49A 2GX5A 1S7AA 4PKUA 2E60A 2PBIA 5TBMB 2PD7A 1BZAA 2WGIA 2RV8A 3B73A 5CXAA 3LSJA 1QIBA 1A86A 5F83A 4BD0A 4R6LA 3N8LA 2XPVA 1S5LC 2EXAA 1NZUA 5HOOA 5E3OA 2VGJA 2N8GA 1B3DA 5J1RA 3K1NA 2B7EA 3ZGAB 1IG7A 4U0TA 1WE4A 2OQGA 2EWVA 1OCRH 1IKIA 3E3VA 1NHAA 4E4HA 2M7AA 3EYIA 1C3BA 3CCLI 3T5XA 2NOGA 1IABA 2LOOA 3E2KA 2FMLA 2W85A 3VDXA 1N75A 4IHVA 4G6TB 3QYFA 1R5GA 2PU4A 1K54A 3ZQLA 2OQRA 5CQGA 3EQLF 2DODA 1YM1A 1IV6A 4EQIA 3MZHA 4QHCA 3WU2C 3A02A 1EH8A 3NOTC 2JMWA 3PUBA 1PNEA 1N77A 1FOFA 2ZXWH 4MBHA 2EFQA 3E8RA 1IXCA 5HDKA 1PDNC 4E04A 1D1CA 3H0GJ 1VQPI 1OJGA 3ITAA 1OZ9A 2X1DA 4GCVA 1DJCA 3KIOA 1EF4A 3U1DA 4PMAA 3DNGA 4BLMA 4FE7A 4N92A 3F3XA 4A3IJ 5EZGA 3VYTB 4OQHA 4E6XA 3KP6A 3ULFA 5E1ZB 3VFFA 2J80A 3BFDA 2H27A 3RSNA 4DE3A 2V0UA 4HJ4A 1UWPX 4I3JA 1PWGA 1JTYA 4EBNA 1ODVA 4ETSA 3A01B 2NVYJ 4GKUA 2KLIA 1TZLA 3T0YA 2PAVP 4E7HA 4YINA 3VEPA 1HQCA 1MJ9A 4M6VA 1R6RA 3LMMA 1F98A 2GXAA 2JT1A 3TE8A 4EQQA 1K78A 3SEZA 4JIJA 5IS1A 5B66C 3LIKA 2FJ1A 2FBKA 2FX0A 1DP9A 5G4ZA 2E1NA 4OINF 2L7KA 4G9LA 4BBRJ 4QPOA 1ZELA 4UY8I 1ZLKA 4HX8A 2IGKA 2R7WA 5E20A 2BY2A 1E3HA 1NYMA 1XUCA 5M3MJ 4XM8A 2VJ5A 4R4SA 1MBJA 5K1YA 2GLOA 3W2VA 3N05A 1ES4A 2KOIA 1YKDA 5F08A 2FMYA 3ZQCA 2HQAA 1BYWA 5J3LA 4HQAA 3VYSB 4I38A 2ECBA 3PXPA 5FLVA 5D1SA 2PI0A 4GB7A 3FXLA 2EX6A 4A3LJ 2NXNB 3S1MJ 1FILA 2HU6A 3CWFA 3P9KA 5K7ZA 1J09A 2Z9OA 3ZNTA 1IAEA 3BR0A 4HP9A 2VE9A 4P5OA 1UMQA 2WY8Q 1U0JA 4L18B 4NXFA 4XOPA 4H6JA 3OOPA 4A93J 4OWRB 2W14A 3OCNA 2JSDA 5HL1A 5J8FA 5TJJA 3W4OA 5E2HA 4EFSA 3EPZA 3Q9SA 5F1GA 1BOAA 2ZM2A 1XFYA 2ZMFA 3BZ6A 5IYBJ 1HC8A 1B6AA 1MMGA 5EF6A 2R78A 2ISZA 2HGCA 2ETHA 2GWRA 3ZMZA 5GHXA 1OJ5A 5J1YA 3GTGJ 2FF4A 3FC7A 2XV4S 1NRFA 2VGKA 5DTDA 2FFFB 4IQJA 1FTZA 2VQGA 3K4NA 1Y6IA 3C30A 2OAP1 2OBPA 830CA 3IWZA 4Y17A 1AKHB 4BD1A 2RNGA 5C4XJ 5J1UA 2DMPA 4XUXA 1HCRA 3OSGA 2IVMA 2BEOA 1VHMA 1HDDC 2Q9NA 4CLCD 3MKZA 2Y6DA 5FLXZ 2FU4A 4KMFA 4F52A 1G4KA 4WXHA 3MXRA 4KQQA 1PFLA 4DYRA 1PRQA 4MEXF 1U2WA 1YFHA 1UELB 3CF2A 4ESBA 5GPAA 3L7HA 5JYOA 4GHIA 3AL0B 4XLHA 1BR1A 1CF7A 1WI9A 5C3EJ 1ZTUA 2ZL1A 2FE3A 3HSFA 4UAAA 2DW1A 3GUDA 1ZRDA 3EDHA 2CWEA 1XKZA 3S15J 4XL9A 1XGOA 5J4YA 1OQYA 4XN3A 1W5TA 4I7HA 5CEDA 3P24A 5HD3A 2VT2A 3WU1B 1SFUA 3FPWA 2IWBA 3PBNA 3JAMK 3HL2A 1L2SA 3H36A 2ZC5B 1R4NB 3I7IA 4CO8A 2HGVA 4Q1LA 3WTVC 4JQFA 1FYKA 4M73A 1O7EA 3CJMA 2GIZA 3V7SA 1F1ZA 3DCFA 3EUHA 1ZGWA 1FBQA 2XSDC 3BTIA 2DU9A 3NRVA 3LFKA 1ONVA 4IOCF 2LBFA 3LR0A 3VP0A 2MLGA 2ZB9A 1P97A 4G94A 2IW5A 2W1TA 3JPUA 1IFQA 1SFKA 5HX9A 1UWNX 2L0RA 2JKFA 2E1OA 1CXVA 4WYYA 3LK8A 1NG7A 3CTAA 3K4MA 4B3XA 1EW0A 2M8GX 2VBWA 1X2MA 4D60A 3OLOA 2JUGA 1C3IA 5FD6A 4XKVA 3J81K 3BR2A 1OTDA 3VPRA 1PWDA 3DP7A 2HOTA 1P4WA 2LY2A 1S4RA 3TT4A 2DDAA 5I4OA 3BROA 1N9OA 3I5UA 2W15A 5FI6A 2FFYA 5CVRA 1WI3A 4ZYGA 4A6DA 2VODA 5F1RA 4MTDA 2KZVA 2LB9A 4KUOA 2Y2OA 2EFWA 3O8GA 4LV1A 1MNMC 2LDUA 3CLQA 1JTDA 1VETB 4XN0A 2R93J 1NG6A 1Y0VA 1R23A 4K0XA 5EJCA 4AIDA 3F1OA 2TCTA 5EEHA 2A07F 3T4TA 3GBGA 2P8TA 5EVID 4Q48A 3FXOA 1X3ZB 3BFGA 2WAFA 1X19A 4Q5SF 2PG4A 4M3FA 5FQKA 4BUPA 3VP4A 5DFYA 4AIHA 3Q7VB 4GZBA 3HUMA 2QBYA 2RJPA 4PM7A 4JX4A 2BLSA 1GV5A 1QMEA 2Y6CA 1IKGA 4MBFA 4ZJ1A 3LJZA 3BG9A 3QAHA 3GWZA 4R4RA 1S29A 2LH9A 1XFXA 2P9VA 1W79A 2LP0A 3MKLA 3L09A 3S3MA 3P01A 4IKFA 3BWGA 3OBFA 2Y2KA 3ZMDA 2W3GA 3F6OA 4F55A 4HIAA 2WY7Q 2DT6A 4EVIA 1UJ8A 5K5BA 1USTA 4QY6A 4PK4A 1CEFA 3MFXA 1T98A 1R1VA 3BLSA 1ZN2A 2M7VA 1MD0A 3PBTA 1HOMA 1CI9A 1K7GA 5A93A 3V4GA 3TS4A 1BQQM 4DNCA 1R54A 4IF4A 1WFXA 1ODDA 1K25A 3HBUP 3WRZA 4I0AA 1GHPA 5HS7A 1D5YA 1ONHA 1KQ9A 3OYAA 1YX5A 2X6XA 2DA4A 3ZQQA 3PTEA 4GYGA 3O2XA 2Z1DA 4MN6A 4NBQA 3LWFA 2XD1A 2DOFA 1YG2A 1YIOA 4LG0A 4P0MA 4O3MA 2QQ8A 1RMZA 4S0HB 3H3UA 1MKMA 4ETZA 3TOAA 2V2FF 4KQDA 2ZC7A 2HOSA 1JWVA 1XFQA 2HYFA 1MNEA 4DDYA 4UV9A 4PUSA 5D3OA 4HMAA 3PQJA 2TCLA 2W7NA 3U4LP 1NLZA 4I6ZA 4MNUA 4Y0TA 3VOEA 4BE1A 2EFUA 2ESNA 3HOVJ 3L9FA 2BGCA 1EJ9A 1GE7A 1MMPA 4JGQA 5HDSA 2IS1A 1DPRA 4G3KA 2J7VA 1YS6A 4HEA2 4H49A 5I0LA 4JBAA 4M6YA 1MDMB 1WCMJ 3OOUA 2ID6A 3FKWA 5TISC 3OYIA 4Y5FA 3T4QA 2CUEA 3HGGA 3BG5A 1Y8RB 2WKIA 3OPPA 4G6QA 3I4NJ 1NLYA 4AM3A 1FNNA 1PUEE 4Y0UA 2Y9YA 1XS9A 3F1AA 2XVCA 4I02A 3LYXA 3CZ6A 3MKFA 3HSRA 1YIJI 2VL8A 3PJRA 4OAYA 1LKXA 1T33A 1GHCA 1OYWA 2OW2A 2K27A 2E5ZA 1D7EA 1IDYA 1YRNB 5CGSA 2RQPA 3QWLA 2LD5A 3N4MA 1A31A 3LR3A 1OCOH 4BXFA 2XPUA 1JJ9A 2YX7A 2XF5A 3LIFA 2CQNA 4L5JA 2B02A 4XRSA 4M4XA 4WK7A 4U88A 3LR4A 1VQ4I 4YIRX 1R1UA 2G7UA 1PWPA 5FO5A 3DTMA 2ZNZA 2WAEA 1RP5A 4KMUX 4HHDA 3TJZC 1X3WB 2F6CA 1TWHJ 3FXJA 4UUSB 2BXYA 3SFIA 3UO9A 1WA9A 3CMYA 4QIWN 3KO6A 4KZ9A 1R7JA 5JLWA 3OIOA 3T50A 2V1DA 3H5AA 4PJJA 5HNHA 2QQAA 4XXRA 2QM3A 2AXLA 3CMEI 1AA7A 4XBFA 4BBTA 3DBHB 5ICCA 3M6HA 4CGZA 3G1OA 1HKTA 1GV2A 3UKGA 2RJQA 1W7PB 4D7MA 4RM2A 3IAM2 4B93A 4XOTA 1TS8A 1RKTA 2IWCA 2BVMA 1V55H 1XM5A 3RH8B 3DPTA 3BFEA 1WJFA 1S0WA 5KCMA 5JI6A 2HYJA 1ZG6A 2J3TC 2A5WA 4E6KG 3IRQA 1OT9A 4UB6C 5D3CA 4RX3A 3C1DA 1ES3A 4PKTA 3MEXA 3BECA 1YS7A 4LENA 3PM1A 4II3A 2KIQA 2MLSA 4IUWA 4C3HJ 3A01A 4UVBA 2OV5A 3KEQA 5EG0B 1W0TA 3ZCZA 1MKIA 2H1KA 1RM8A 4EW7A 2QKMB 2VQLA 2WOAA 3IBRA 2DJIA 4K91A 4G8XA 4YFNF 3CKIA 4N1XA 1SANA 1C0WA 3G35A 4I99C 1TD5A 1A0KA 3E6DA 3MFDA 3BT9A 4IHXA 1BLPA 2GXBA 3W4PA 5DCFA 3GSGA 4DD8A 4DXBA 2VKSA 5J8CA 3TL4X 1N9NA 3LSRA 2DA1A 2UZKA 1FIAA 2QWWA 3W6KB 4R3JA 1D1BA 2V79A 2IA2A 1JKPC 1SKOB 2KPMA 3G42A 1T56A 1XG1A 1K4SA 1JNUA 2DI3A 3W2AA 5D1TA 1OM6A 4RQ9A 2LF8A 4GO1A 3ZMUA 1X1DA 3TO7A 3S1NJ 2E1CA 2XFSA 4Z2YA 4K0WA 1G6OA 1UMSA 3Q2GA 2EX2A 1ON2A 2UWXA 2BHYA 1XSVA 2DA3A 2Y91A 1SMYF 4WZ4A 1I2SA 3HKZA 5FFXA 3ABLH 1RGYA 3S7PA 4PM8A 2VN2A 3PBOA 2Z3YA 1MNCA 3QODA 1HLVA 1R5ID 5L3CA 1ACIA 3QPSA 2WB1N 4ZTKA 3SJMA 3S7NA 4IRHA 2E71A 1YMXA 1D0ZA 1J2XA 1S66L 1PYVA 3SDGA 4LK0F 1V5FA 3H9WA 3BJNA 1KGFA 1ACFA 2AHQA 4CICA 2ZFWA 4XK4A 4EGZA 2XRLA 1G6NA 4AVZA 2ZM0A 1TS0A 1IJWC 2QKPA 4ENKA 1W5SA 3CDIA 4N9LA 3B47A 2PMZN 3REOA 5DJUA 1FP2A 2OW9A 2EV0A 5FD5A 1FYMA 2BYVE 3K3CA 1AKHA 1I5ZA 2XKOA 2KP6A 3RXWA 5M19A 3FK7A 1Z1DA 1Y8JA 1F5MA 2BASA 1ETOA 3EUAA 1OTAA 2VBXA 3MR0A 1VQ8I 4PKYG 3GTJJ 4ZTFA 2ACJA 3V42A 2PBDP 4D5FA 2WKQA 2EX9A 2JA8J 1XC5A 1J9MA 3T8TA 1JVJA 3M6BA 5HZHA 5JR3A 1G68A 3Q7ZA 2KFDA 2M7BA 2WADA 3KSFA 2GA1A 3F1PB 1E3UD 3OYKA 2JNPA 5J7EA 3PO3J 3E2LA 1TDGA 2Q8KA 1Z3YA 3HLFA 1GKCA 5HDCA 1YAXA 2MZHA 1EH7A 3DF8A 2ZMAA 1L0OC 1I3AA 4QU3A 3WGGA 2B5RA 4UXNA 2I9VA 1K6YA 5AQ7A 2B9SA 5JFRA 3QP1A 3CCQI 3FXUA 2E8JA 2XC7A 3GRJA 1MGTA 1KUIA 2HDSA 3T4SA 2Y2MA 1YSPA 4DGWB 2DW2A 2P7CB 4B44A 4B1RA 1NTCA 1FPQA 1VEUB 4CJNA 2OY2A 3R4KA 2HDDA 1SVMA 3HZJA 2PMHA 3BR1A 2H5SA 3ULQB 2VKDA 3HUGB 2M87A 1SFEA 3W6JB 4GQLA 3LO7A 4A3FJ 2IPQX 2MC3A 2VB6A 4OLGA 4JF4A 1HBXG 2QSFX 4X1LA 4D9JA 5C4JJ 4BL2A 1GT0C 4Q47A 2A68F 4B9OA 4BJ5C 4I35A 3HL9A 2EROA 3DV8A 3G3ZA 4M3KA 2CRGA 5LRSA 2FOKA 3W6VA 1IYSA 1HKSA 3E98A 1FIKA 1K55C 1R5HA 4PGGA 2INWA 4S2IA 1CJFA 4ZYHA 4BY7J 4HSRA 5FFZA 4DBRA 1B8IB 4R8HA 4WWCA 4OQGA 1G9KA 3B02A 2COMA 1U9NA 4A3BJ 2HV1A 1ZR2A 3GTCA 4HV6A 2JA5J 4IHYA 1WGXA 2WAQN 4CLCE 1USSA 1EUBA 4X68A 3MXSA 1T39A 3ELMA 3H3VK 3V39A 3UDXA 5HLTA 5JLXA 3K2NA 5IOZA 1IV8A 3MKWB 3MSHA 1WVRA 1UHWA 5E8IA 2YU9J 5IYDJ 2K31A 2J9OA 2QSHX 3T1XA 3X2QH 1JGGA 1WSUA 2EH3A 2OW0A 1VETA 1CQTA 2Q2EB 4KT6A 2Z2MB 2O03A 5L8MA 4L0ZB 4E70A 5HAPA 1TW2A 2PMUA 3T12B 3RYRA 1FSYA 1JGSA 3Q07A 3N2VA 3C5AA 1CQRA 2FV5A 3BQ8A 1QNTA 2CUFA 3SHFA 4Z6YA 3G2BA 1GA0A 4G3WA 1P7IA 1O3TA 4AYBN 3LCEA 2J9PA 3Q7VA 5DTTA 1Q1VA 1LFUP 1KU9A 2W00A 3DKYA 4S2PA 3DFGA 2XSSA 5DYMA 2LR8A 4PSWA 2KJCA 3HJEA 1MNDA 4LRXC 1K7AA 3I7GA 4EUVA 1Q2QA 3EGXC 5DEQA 2FV9A 4Y4RA 2AXTC 1G3YA 3CCSI 1U60A 3UDFA 4A7BA 5B5EC 1QPIA 4UEYA 5FQMA 4E6WA 2HVQA 1JTGA 1BI1A 4JP4A 1A04A 5F82A 2JPBA 2ZQCA 4NK3A 2L7FP 3IS2B 4OH0A 4X69A 5HODA 5HSQA 4P85A 5BMZA 5CXWA 4L0YB 5B5PA 4E7LA 2V4JC 1U5TC 2V8CA 5LGUA 1TWGJ 4L9VA 4CZZA 1I5QA 4WMCD 4UA7A 3TW7A 1DGWY 1V9YA 3CI6A 2DK8A 1J5YA 2C5WB 2DFIA 2CUZA 4WF0A 3DWKA 3LNQA 2DJNA 1KVMA 3RDIA 5DTKA 2GDNA 5JHFA 4MFDA 1ZH5A 1K57C 3C8CA 3H9QA 3ABMH 2ZMEC 3N8SA 3J7AO 1TF1A 1G2HA 4ZR5A 2KT0A 1SAXA 4JP0A 2DCEA 5DUIA 3BDDA 1O3RA 1E3PA 2PDRA 2QYBA 2IA1A 4O01A 1R4MB 4I39A 2XDMA 3HUOA 5ILVA 2IJLA 4AYKA 4MN5A 3RKQA 4G7ZF 3GFMA 1Z3XA 2V9AA 4WX9A 2I10A 3V8JA 3WV3A 4BKXA 3RKXA 1RNLA 4F93B 3QP4A 3KYEA 2X3CA 3O64A 1WPKA 1YT4A 3Q0UA 1S6LA 2HI3A 4UVCA 4HOBA 2FH5A 1MDMA 3HHHA 3DKWA 4R1GA 4S05A 2COBA 3MMYB 4A69C 3L00A 2ZC4B 2DA7A 1DUXC 2OVXA 4FCYA 4EEPA 4N9IA 1CIZA 3RJUA 3D5LA 4AWXB 1N78A 4UQIM 4WMCA 3CDLA 2Y75A 2VJJA 2AQEA 3I4MJ 2HJ9C 1JKQC 3RCOA 5KSHA 3EETA 1CF0A 1X1CA 3COAC 1BR4A 1YQYA 4HJ3A 4WCGA 3HHGA 3AGDA 3UE6A 1R1TA 2XHKA 4RGXA 3DEUA 1BZSA 1HFCA 3SH7A 4IX7A 3KEYA 3ERED 1N9LA 2IS6A 2GM4A 1PWQA 1D0YA 5F1FA 3F18A 4QKZA 5J6XA 3HY7A 1YRNA 3CC4I 2D01A 3BR5A 3MS6A 1OISA 4KN4X 4GNUA 1E3OC 4A0YA 4HY8A 5ICFA 2O0YA 4PJ0C 3D5RC 1C7KA 5TR7A 2VIXA 3MKYB 1DDNA 2ELJA 2ZLYA 4GFBA 4M74A 3ZG0A 2ZOHA 4ZTJA 1G5UA 3VE3A 4N4OB 1T19A 2HP5A 2L01A 4AFIA 4MFEA 5AQ9A 3VYRB 4LIVA 1MZUA 1ONGA 3F8FA 4XSZF 3OPHA 4EATA 5EOOA 3UE3A 4UUSA 2P5LC 2VLGA 1TT0A 4BS9A 2P7JA 3IF5A 2JHEA 1EB6A 2R7ZJ 2W48A 2G2UA 4M9XA 2A69F 4QLCU 2D1HA 4NB5A 2FUG2 1AWCA 1YYVA 3CCUI 3LI8A 4XR6A 1T0FA 2CQXA 1BKCA 2B18A 1FR6A 1K54C 2KZGA 5L07A 3BC8A 3MZFA 3P1VA 1JT6A 1W7PA 3BP8A 3HTUA 1HY7A 3IF6C 5FKNA 2J3TD 3NIAA 4DF6A 3V3RA 3LSMA 2K9MA 4EGYA 3HKZN 1BI3A 4E3KA 3BJOA 1OS9A 4HNUA 3RIRA 5H8XA 4PZJA 3ZMVA 3BLYA 4E7IA 3O87A 3LSPA 3L2QA 1U3EM 5HWVA 5AONA 4XLNF 3M8JA 5F0FA 3QYEA 4DYQA 4FH2A 2W0NA 4ZC3A 4WXDA 4EJVA 4E3NA 2ZC2A 4JGOA 3CCEI 4NC6A 2GAUA 4DE1A 5EG0A 3TSKA 4FTXA 5LFAA 1S8NA 3FX3A 3H9JA 1ZP5A 2OA4A 4PKWA 4G7OF 1REPC 2ICWG 2R7SA 1G3TA 4XICA 3BFCA 3P09A 4X53A 5FATA 3RTRA 1OKRA 4IVNA 2VJWA 2B63J 2DYRH 1LFPA 3DEEA 4E3IA 2OI0A 3J80Z 2R0QC 2O9CA 1X58A 5GHZA 3J80K 2Y48A 4W1UA 4A3MJ 2HZTA 1SKOA 4R79A 1Q3AA 1EWZA 2FSWA 2LKSA 2MG4A 5EYRA 2OD5A 3RYPA 2JJ7A 3FM5A 3K70D 1VQKI 3ZQHA 2W3EA 2QPNA 1IDZA 3NDGA 2Q9MA 1JIWP 1IN6A 4RLFA 4HF1A 2K9QA 1CGLA 1W8QA 4X25A 5D1UA 2ELHA 3E0JB 4EJWA 4V2FA 1ZQ3P 5D5UB 4PPRA 3IX4A 2RL3A 1LL5A 2P5KA 5GP9A 1STZA 4B48A 2PT7A 3F23A 2XK1A 5AVEA 4I3AA 4E7ZA 3LIRA 1KUHA 2JVGA 1OPXA 3Q9VA 4RA7A 2LK2A 1DGRM 1PWWA 4AIGA 3AGEA 2CGPA 5FEGA 4FE4A 1YPRA 3FMQA 1NK3P 4HBUA 2EK5A 3ZN0A 4GJ4A 3L1PA 3FZVA 3KHIA 1TP4A 2VBZA 4BJ6C 2ZJ2A 1IYPA 2JUCA 2AS5F 2PJRB 3P98A 4GGGA 3HPGA 1J7NA 3GYHX 1XCVA 3ZQ5A 2OZRA 3G6EI 3VP1A 3SXYA 1KU2A 3OOVA 1SD5A 2MLRA 1WJBA 2RNJA 2CYYA 2VZWA 5HLGA 4CZCA 3QQAA 1W63M 3TP0A 5CKTA 1JE8A 4EEFG 2DA5A 3HRSA 1X3UA 1V5EA 3FDYA 1Y28A 3VOZA 3IX8A 1GXDA 4KISA 5IY5H 1H9GA 3KZZA 4I3IA 3KWVC 1QPMA 1XJ3A 3F1PA 1XFUA 4A0ZA 3I54A 1WH5A 2EA9A 2NUTC 4S2NC 3FBIB 1FR1A 1FIPA 4JXSA 1ZGAA 3GLLA 4HAMA 4WXCA 4LLOB 1BR2A 4BBSJ 1B9MA 3KX0X 3TVCA 2G7HA 4XLCA 3TGNA 1KQ0A 2BZTA 3CC7I 2P74A 2DO7A 3EUKL 2WO9A 5G18A 4FH4A 4OQIA 2BV6A 2DCFA 1VEUA 3HRMA 2P4WA 2HOEA 2QLZA 3HUGA 1LJ9A 3EEHA 2V9PA 4ARZB 2VKVA 3Q5FA 2R5ZB 1RETA 3MZYA 2MLKA 1F9NA 1BULA 1TTYA 3WE2A 3F16A 5KHDA 2JA2A 3G4PA 5CTMA 1LT0A 1MBLA 3LUQA 3HB2P 2OUMA 4KENB 1FBSA 4BJPA 1ZLJA 1NXYA 3M07A 1D0XA 3BTJA 2VEAA 2F5DA 3Q81A 4M9SA 4KZ6A 1GCEA 2KHMA 2JE5A 1DPUA 3UNGC 3L0VA 1H5XA 4CLCC 4IBRA 5CZMA 5IP7J 3G32A 4JK1X 4CCNA 3DLLF 4R3VA 3F21A 3FF5A 2DK5A 2XAGA 1QU3A 1ETQA 4EWFA 2DOAA 3DPEA 2DFEA 2XKPA 1CF7B 3SOIA 1GSVA 1B8IA 1K6RA 5IYCJ 2L1MA 3K4KA 3U2RA 4BBUA 3MVPA 2V26A 2VT3A 4IVKA 1SD7A 1KDSA 4HBLA 3T1BA 1AKLA 1X4OA 1FOXA 2LRDA 1KQ8A 3LEQA 4H82A 5DJTA 2O99A 4OKPA 4M6XA 3N4IA 3HB9A 1RCJA 5A2QK 4ESFA 3TO6A 4JPAA 1FT9A 2MBFA 1FLSA 1P92A 3DKXA 4L5IA 1YLJA 1Z77A 3OS1A 4HH2A 2EXBA 5GAGJ 4RAYA 3KZIC 1ALQA 4HH3A 2Q2EA 1ES2A 3E4QA 2GZWA 4DPEA 2EA2A 2CV2A 4CH7A 1ITYA 1ETXA 4WELA 2XR0A 3A1YA 1KZHA 3AYKA 1UFMA 1ZK8A 4Y3OA 4ENNA 3GMEA 4BXUA 1B9NA 2M2EA 1Y1VJ 2Y2NA 3A0BC 2CC1A 3DBAA 5EGOB 2ZKZA 3RXXA 1SC7A 5GAHJ 3E6BA 3IXGA 3IWOA 4LG3A 3V5MA 9ANTA 5HS9A 3GTQJ 1OFCX 1KGEA 1W4MA 1LSWA 3CHWP 1IC8A 5CHMA 1UMTA 4GRIA 4KIBA 1GHIA 1XJ4A 1IYOA 2DW4A 1OJLA 1L0EA 3IKVA 2A3SA 3LJTA 1KA8A 2LKXA 3CJRB 5HDGA 3CPTB 1JAOA 3FZCA 4M9ZA 3HOWJ 1VQOI 2Y2ZA 2E2HJ 3EDZA 1TS6A 4KITB 3SZTA 3O3VA 5DFXA 2WYXA 2UWMA 5B1BH 1G6AA 3KE2A 2DQRA 1KBCA 4WEKA 1R9TJ 3S17J 1BT5A 3IS2A 5EVEA 4L9JA 2DLLA 4YOFA 4L9TA 5L3BA 3KLNA 3O88A 3GTPJ 3OR2C 1O3QA 3WE3A 4R38A 5DS9A 4HEFA 2P6TA 4XKCA 4KQRA 3RPUD 1SLMA 1XMAA 3ZNYA 4XRSG 4JBFA 2JA7J 1I50J 4NC7A 1D8MA 1NRJA 1ULYA 2RN7A 2X6WA 5D5VB 3IC7A 2C6WB 3HTSB 5DM6F 3R0JA 1TNSA 4AD9A 2ZO4A 2KRFA 1N4OA 5I5LA 4P55A 1QUAA 2LB5A 5EVIC 1TS7A 1E17A 1NZOA 5E3MA 1JJ6C 3WTXC 3FKVA 4WBGA 3K7LA 2L0KA 1ZRCA 3S7OA 4UQIS 2QKLB 3L2VA 1IADA 1HW2A 2HDCA 4UA9A 1QIAA 2JRTA 4XCTA 5JVTA 2JN6A 4WKIA 2ISYA 4BWIA 1KONA 4JGPA 4BENA 4JX6A 3N2UA 1WJCA 1OM8A 1P4XA 4ITVA 4G7HF 1JUSA 5F6FA 4PKSA 4S2OA 3A0RA 4OU0A 3H3ZA 2YPRA 2KRHA 2ZQAA 3SZGA 2OSUA 3TDUC 3U1KA 2YS9A 3LSGA 4IRGA 2CMPA 2QSGX 2E5NA 3P5JA 3HOSA 3WS1A 2LC2A 2V20A 1SFXA 4X1MA 4KG2A 1VFCA 4KYWA 4PKVA 1YCMA 4Y0OA 1UTZA 1YLPA 3FXRA 4UUTA 3FK6A 5A8BA 1Y54A 3KP3A 2W24A 1HKQA 1MIJA 4JXVA 2OW1A 4I0BA 2L02A 1B1BA 2M30A 3LR5A 2NVQJ 5FAOA 1BN5A 1RESA 4XRMA 4U3TA 2DMQA 2HWVA 3HUNA 4UA6A 2E36A 3HGYA 1W36D 2Z2SB 3IUOA 3UB8A 1A35A 3SYTA 3G1MA 1KE3A 2V1BA 2DT7B 2EINH 5IPAA 4XM3A 1MWRA 2HQRA 1ZG4A 2VPLA 5CGXA 5L09A 1ZKJA 4WM9A 4BL3A 2BTFP 2R4GA 4A3DJ 2X02A 1X2NA 3S2WA 3LL7A 4LITA 5H6RA 4P6ZS 4HQMA 4BQAA 3HLWA 1S1YA 3PFIA 5BNGA 3T1QB 2VUMJ 3C2HA 3P7NA 4HF2A 2XDVA 2EWNA 4PGHA 3QOEA 2XGDA 1XSXA 3K2AA 1PJRA 1CAQA 1H88C 1DQUA 5BQTA 2A6TA 5A90A 1SEUA 2QGUA 2FRHA 4U0XA 1YO5C 4RS8A 1WYCA 1O4XA 5JMYA 2OOLA 3PQKA 5D4RA 4C2UA 2XS3A 2MC4A 1SLNA 1Z21A 4G12A 2LTPA 3LGOA 2ID3A 3BOQA 2IP2A 5D2BA 1FTTA 4S2JA 4JXWA 3K3DA 2W1OA 1Y1WJ 5CHJA 2VK3A 5DTSA 2VV8A 1U5TB 3ICYA 1I6XA 4X56A 5GHYA 5CECA 4U7DA 4GDNA 3K4CA 5B3SH 4PSXA 3LIAA 5E3NA 1IW7F 4YIFA 3RZOJ 4FHTA 1OMEA 1F4KA 1A6IA 1HLUP 1UAAA 4Y15A 5HPFA 4GW9A 1CEGA 4L9EA 3K7AJ 2XLNA 2Z99A 2CO5A 2VJ4A 1IRXA 5FKKA 1Z7UA 2ZMEB 4TV7A 5CGWA 1CK7A 1I1GA 2FQ4A 2M4GA 3C3WA 3ELKA 4NEED 3ZVTA 2HEOA 4DMZA 2HP9A 3HXLA 2DAOA 3HM5A 2D5VA 2V9VA 2WA0A 4J19A 4D7NA 1MJBA 5F04A 3S16J 2CQKA 4A3KJ 1OTBA 5FQJA 1BI2A 1MMAA 4LPZA 1XDUA 1HSTA 4ZZLA 3L2CA 1P6RA 1L0DA 3M4OJ 4C6YA 3I0TA 3S3NA 4KJZA 5I12A 1OR7C 3E4OA 2PHYA 4KNYA 3UMDA 3GTOJ 1XJ6A 2EX8A 3TO9A 3DQVC 1HTZA 2XGXA 3PAEA 4L19A 2XGCA 3LI9A 4FSFA 4A3GJ 2ZOIA 2CW7A 2TRTA 2A6HF 1AU7A 3CESA 1NJ4A 2XAUA 3W8KA 3VFZA 4F3LB 3IX3A 3IKTA 1XP4A 3BY8A 1LEBA 1PIOA 5EECA 3FBNB 2CV0A 2JKGA 3FHZA 5M5WJ 3S1YA 1WHUA 1IAGA 4RX2A 2L4AA 1VI0A 3BR3A 2H10A 2CFXA 4UVAA 2H8RA 1O0TA 2KIMA 1H8ZA 5KMWA 3MQ0A 2ZXHA 3SH9A 4JLFA 5DF7A 2ZJRF 2M0CA 2WKPA 2QWSA 1LL9A 2AYKA 1IEMA 4K2EA 3HRUA 3ZG9B 2WV1A 3F72A 2PJRA 2JIHA 3N6IA 3HYGA 2Y30A 3LA3A 2VQCA 1R36A 2ERQA 2POJA 1JUPA 4OMZA 1JUMA 4N9HA 1JWPA 4QD4A 1YOUA 2YU3A 4NXGA 1USNA 2WC2A 5CVVA 3Q2HA 2IT0A 3JW4A 4BHPA 2GOXB 4Z1WA 3NEUA 1LSXA 4LRYC 1Y4OA 3CJNA 4GWMA 2XS4A 1PP8F 3IXDA 4IJAA 3VE4A 1FMVA 2QQBA 2WZXA 4ASNA 4OIRF 5HLIA 4BDYA 4WK8F 2L9VA 4LK1F 2LKPA 2JKRI 1RR7A 4LMYA 3Q0WA 3IF6B 1KYWA 3HLEA 4H1QA 3LIBA 5E43A 3WV2A 1PWVA 1SATA 2Z2LB 3HEFA 4LLLA 1YLWA 5KAFC 1OTIA 1K56A 5EM1A 2VV7A 5J40A 4XKWA 3VSKA 1J7KA 2KRCA 1D8FA 2JC7A 3GZ6A 3M2KA 1XDSA 3JRCA 3IRRA 1RRJA 4N1HA 3LUNA 2VASA 1CGEA 3KSGA 1SD4A 5F1JA 2O9LA 1YX3A 1B72B 3GX4X 2QJ7A 3C7JA 4ARZA 3DTEA 3OYMA 3LSHA 4CCMA 2R5ZA 4BE0A 1BKCI 2OXUA 1LSVA 1TBXA 3K1PA 2PQ8A 1F2KA 3TOBA 5KAIC 1CQAA 2XF6A 2AIGP 5K5RA 3C7UA 5FLXK 2Y2HA 3DU5A 1YTYA 5J4EA 1OYYA 1BL0A 2Y2QA 3NULA 3CUQC 1RZ4A 2F4MB 3AG1H 2LLKA 2CG4A 3RTYA 2K4JA 2A8HA 2ZC6B 5BOYA 3AAFA 3BM6A 1C8TA 3DBRB 4XT2B 1HFSA 3MQOA 3OMYA 2CU7A 3A3IA 1PI5A 1GLNA 5H2FC 3KFWX 4C3QA 3ZQGA 4PJNA 4IEDA 4XLAA 2GOMA 1PW8A 4A3JJ 2Y2GA 4H76A 1TDLA 4H30A 1R58A 2D1NA 1X1BA 1QJIA 1U9OA 5TGFA 1BM6A 1OO9A 3LE9A 1ZTQA 4B8XA 3E6CC 3BCBA 1YW8A 5F64A 5G4YA 2QA4I 4FVLA 2KDOA 4PJMA 4MQ9F 1IACA 4UNOA 3WHBA 1VQMI 2K5CA 4CA0A 3MXQA 1HDPA 3CC2I 2IRFG 2HKXA 2X51A 1MC0A 2O6GE 2VPRA 2VC1A 2O8KA 1YLZA 2UXNA 2EQRA 2MH9A 1TQMA 1IYQA 3OYJA 1S7EA 2W4SA 4OIPF 2OV7A 1AYKA 4M3BA 4XMYA 3A4CA 3ZGKA 2MD0A 3ZG5A 4XQFA 3BQZA 2K9CA 2A61A 5EGOA 2KRJA 1JAQA 3TW6A 3NHQA 3LIEA 2X48A 3PSFA 2WK0A 3HIFA 1K4TA 4FUWA 3CLOA 5KK1A 1DP3A 4GUYA 3VB2A 4RAGA 4LV3A 1BJAA 2WKHA 1XTAA 5LGTA 3MFKA 2Q1ZB 1IGNA 2KX6A 4RB3C 2VKHA 4AVPA 3CPTA 1U8BA 1R71A 5CVJA 3W4QA 4CCLA 3F9KA 3PL8A 2EIJH 1XFVA 3JRAA 1A5JA 4JYKA 5E2GA 2XAHA 4MN7A 4Z9QA 1QGPA 3JRDA 1TWCJ 2XH9A 1YJNI 3KP5A 5ICEA 2QQ9A 4BHBA 3QPLA 5AJGA 3GFIA 1BC7C 1YQAA 2W1RA 5AQAA 1Z05A 4Q8IA 3A03A 3CITA 2OWJA 5FDSA 2E2IJ 2RVCA 3WTZA 3I3LA 2HVSA 3P9IA 5IT9Z 3WHCA 3T4JA 1XUDA 2DTZA 3LFVA 3TBIA 3G2YA 5F6AA 3F19A 4ON1A 1WJAA 5DD8A 4XIDA 4CUGA 3HLGA 4YEJA 4WUJA 4FQGA 3HOTA 2DTRA 5EM0A 4E3LA 1KUFA 4P87A 4CDGA 1WYBA 4B4CA 2Y2JA 5I2ZA 1T95A 1QZZA 3D5SC 5DVAA 3QNCA 2L5QA 4ZJ3A 3NWTA 3DLAA 3MZDA 3BZCA 2L7ZA 4ME4A 1D1AA 4YELA 3NAUA 5DF8A 3UB9A 5L7FA 4QB8A 3MCZA 3WG7H 2JSPA 4II2A 4HESA 4KG5A 2CSOA 3ZRGA 1H0MA 3IV5A 4P9FA 2EBIA 4ZAMA 1KGGA 4MTEA 3GVAA 1ZG3A 1ZHHB 2PEXA 4OAZA 4GR8A 5BOXA 3KEOA 1TEMA 4O7DA 2EZHA 1BUEA 1OCPA 1K55A 1U6GA 1RR8C 1MWSA 3QP5A 4XORA 1IN5A 3S1RJ 2M8EA 3K4JA 2WKEA 5J3WA 2VONA 1GO8P 2RC4A 2ZJQF 2PR6A 1IAWA 1PUFB 2W0DA 2BXZA 1MSFC 1Y56A 3BZKA 1RKWA 3QRFF 1RIOH 2Y9ZA 2ECCA 1RI7A 1ZVXA 1MW7A 2Y31A 3GZ5A 2O7OA 3WS2A 2HZ5A 1XGMA 5F0CA 3F15A 1HD8A 4K08A 1K4FA 1DY6A 4BACA 3SS5A 5FAPA 1BA5A 3LOCA 1FZPB 3VOYA 3ZYTA 4PKYA 1K79A 2OAZA 1OCCH 5FAQA 2LREA 3GR2A 1JKRC 1PZPA 2Y2IA 2WUQA 4IHWA 2JQ7A 2AO9A 3H5NA 1H3QA 2XB5A 5GTHC 1ATLA 1XGJA 3VTGA 3NJAA 2XD5A 3HBLA 4KICA 4X55A 4HNTA 1PW1A 2L9NA 3V3SA 3CUEC 3FM3A 2CV1A 4DYCA 5FEFA 1B8YA 2Y4AA 2YX4A 3K2ZA 1OT6A 2JPCA 2A5YB 1HA8A 4B88A 4HDUA 2E7WA 1WZ2A 2HPBA 3CMMA 3ABKH 2WGWB 3IH4A 1POGA 2EFOA 3DAVA 1O7FA 3IP4B 4Y13A 2DMNA 2L9RA 4DF9A 5DF9A 5HL6A 4P1WA 1K7QA 4P96A 4PJLA 1A36A 2F4OB 4I2OA 5LGNA 1LL8A 5AIPA 3GFJA 5D5WB 4ZDOA 1J75A 4Q0HA 5DUKA 5L2FA 4PM9A 1YOVB 3KSHA 3B6CA 3I53A 2UXXA 4H0EA 5K5OA 3ZQFA 3D1NI 4GYIA 1U5TA 4A2UA 2OLUA 3GW2A 1JIZA 4F92B 3O86A 1WJEA 4OP5A 2CH0A 3C18A 3HSEA 4HSTA 2ZQ7A 2OJED 2D02A 4FCFA 4S2LA 4HPQA 4U7BA 1D06A 1ERDA 1BW5A 3RZDJ 4N9KA 3IHAA 3ESWB 1VQ5I 4R0QA 1K57A 4O8GA 2ZMEA 1WRJA 3T4LA 5EVIB 2MA3A 3QPTA 3NOPC 1LPQA 1OM7A 2B95A 1CK3A 4M71A 3H9GA 1LHYA 3WS4A 2X3BA 1NY0A 1KUKA 1GVJA 3MQQA 4X1EA 3MJQA 1FY7A 2R7DA 3AG2H 1KOUA 4HRIA 4DXCA 1W0UA 2XGEA 4PFOA 4WL9A 4NQWB 2R7QA 1JAPA 4G3VA 2XIGA 1Q2PA 4B47A 3V96B 2QZ6A 2XGNA 5BPAA 1QQIA 4L9FA 1XURA 2GQQA 4KZ8A 2FNAA 1M6KA 1IAAA 5FKLA 2A24B 3OY9A 2L54A 3JSPA 1P9WA 1PP7U 4LJZF 2PN6A 3E4PA 2IGMA 4F3LA 3SZPA 2YUSA 4OOIA 3FMRA 1VQQA 1T38A 1ZC2A 5HD5A 4ZJZA 2EA4A 5AVFA 2P6SA 2L4RA 1XA1A 2Y0MA 2GIVA 1SMPA 1MBFA 2EFPA 1S4SA 3AGFA 4DE0A 3QU6A 2HQNA 3NBLA 4PCQA 4U0WA 2LFBA 5EEGA 1LVKA 2IS2A 1S4BP 4NXEA 3M2JA 2V7FA 4GS9B 4WZ5A 1AF0A 1BM9A 1MXOA 2QEXI 1G05A 3H7WB 1QVTA 2XUBA 3UB6A 1BBYA 3BY9A 3O2PE 4EETB 2PYRA 1KAPP 4WLAA 1F9IA 1I39A 3ZQIA 3GEZA 4L9NA 1YJ9I 1T1CA 1APLC 3VP2A 1KUGA 5L79A 1ZKGA 2QVOA 5L3GA 4I09A 4YIIA 4KZ3A 1FEXA 4BAYA 4FETA 2XAJA 3JRHA 3S2HJ 3K70C 1G12A 5HS8A 1XAXA 4B4ZA 4KA4A 2ACGA 1VTNC 4IQ4A 2ZQ8A 3BTLA 3QOPA 2AQFA 2F5FA 1ESUA 1XX5A 2PFBA 2BOLA 1TVFA 1ZR4A 4NG2A 4YFKF 1S7OA 2XSJC 2P0WA 4WZVA 2DMTA 4UHTA 3IF6A 4EJTA 3MBZA 4WF2A 1XXMA 1NK2P 1SHVA 3FPVA 5GL9A 1FSWA 1WJDA 3KZYA 4PFPA 3FKJA 1W5DA 3ZFZA 4OONA 4RBOA 1UB9A 1XPXA 3LQ0A 1MBHA 2VE8A 3BFFA 2HR3A 3NOUC 3VSLA 4MQVA 3CCMI 2E1MC 4DN0A 2HVRA 1B59A 1X1PA 1S9HA 1MWUA 1ND1A 3HREA 4AUOA 3J7YJ 2LY1A 1B72A 3GECA 3U2AA 4IOAF 3BEBA 1TQIA 4EU0A 2HPMA 1EKEA 3R6SA 2Z2DA 4ID4A 5LEJA 4UB8C 2H28A 1ETVA 3QPHA 2I5UA 3R7WB 3GVBA 3DWBA 2ZNYA 5FB2A 3N7WA 1FOYA 4DJAA 5ICGA 2CQQA 2VGLM 4QWOA 3B33A 4A6EA 3S14J 4EEUA 2E3XA 2Y8HA 1BUVM 3ASNH 2XAQA 3EQVA 2O61A 4XT2A 4XLEA 3LQQA 5LRRA 5DKLA 5HWTA 4IBXA 1LDKB 1OPCA 4LCMA 5MC7A 4IUKA 1FYLA 1B4AA 4FASD 5FQ9A 2IBDA 2Z33A 4P6BA 2CQ7A 2Y2PA 2ZD8A 4I5SA 2M0MA 5HVQC 2H1LA 3VWBA 5JVGF 1JH1A 5HFOA 3HYIA 3S7QA 4CXFA 4O0PA 1G4DA 3W3CA 2D45A 1XGIA 3I59B 3KYLA 4XM6A 1H89C 2QZ8A 4OLDA 3SHIA 2DYSH 4XSXF 2OTLI 5CX7A 3NX7A 3S3OA 1TL8A 5EFWA 4XBHA 4LIUA 3SEQA 2Y59A 3LIDA 2KJBA 4WF6A 1BIAA 3DU6A 2O3EA 3TW8A 5KSCA 1O0QA 4MLOA 2K85A 3FKIJ 3NI9A 3ZG8B 3I4PA 3A3EA 1QICA 5E1WA 4HI4A 3WTYC 1LDDA 3ZVWA 3EHYA 2N8RA 1WH7A 4DZPA 5M3FJ 2JRMA 2ZQ9A 1QBJA 4CCOA 3SFZA 1P0ZA 3OS0A 1RUNA 1GE6A 2JTVA 4XONA 2W12A 3IWFA 5LABA 456CA 4IVIA 4B3AA 5H6QA 3IWQA 4ZRRA 3WS0A 5U47A 3LSKA 1GXQA 3WTTC 2XA7S 5GLDA 3JRIA 2BG1A 3N8RA 4EM2A 5IU1A 5EVLA 2LYCA 1HTDA 3VI1A 1WNIA 3VYUB 3JCUC 3KYCB 1LFBA 3K4BA 1HZOA 3S4XA 1QHGA 1TT5B 2KISA 2O9AA 3GXOA 3IXHA 1NH3A 1TC3C 2EFNA 4B4XA 1YE9A 2DFHA 4PKRA 1GSXA 4HP4A 5FQQA 4WKEA 2P04A 4E3OA 1I2WA 3DPLC 5F27A 5DD4A 1Y93A 3PBQA 2MW8A 1P2FA 4S2NA 2JN7A 3AYUA 1J0RA 5TGTA 5F68A 3ISGA 1IN4A 3ML6A 4BNCA 4YG2F 1K83J 3C7VA 4OOLA 3EWJA 3FXQA 5D8LB 5FROA 1JKOC 4Y3IA 1D1JA 5CTNA 1FC3A 2OWHA 2WTEA 3GV9A 3TKYA 3OHLA 4LRZE 2FA5A 4A3EJ 3JAMZ 1E4DA 4E7SA 4GWNA 2J83A 1ZAOA 4EV0A 3ZG7B 3TG9A 4NHJA 4HX7A 1I73A 4MEYF 3KMEA 2JT6A 4G9YA 2QF7A 3Q0VA 2EIKH 1J9IA 1Y0NA 3JYIA 2WB1A 2HF6A 2ZXJA 3OYLA 3UE1A 4L5EA 4MIMA 1EI5A 3D4FA 3N97A 966CA 2HKOA 1WWXA 1EA3A 1JK3A 3JVUA 3CP8A 2ME0A 2BY1A 3WODF 4HX3A 2X6OA 2K9SA 3CUQB 3OPRA 4M72A 2X01A 4R1HA 1OCZH 5HWWA 4XLFA 4CLCA 4HW0A 2PJTA 4HJ6A 4BQNA 4C9YA 1ESIA 3CCVI 3U1RA 1XGNA 2R7OA 1N9BA 1AWIA 3K6GA 1SRPA 4H4KC 3SS3A 3IT9A 4RAZA 2PMZA 3IH2A 3T4OA 1XCBA 4NETA 4BQMA 1K6SA 3Q1FA 3OL3A 2BY3A 1UCRA 4DOZA 1PUFA 3J81Z 3BYDA 1GXPA 1LE8B 4BBVA 4ZBEA 4EESA 1SCWA 5FSRA 2DMUA 2F2EA 3V50A 2F4IA 2JWTA 2W84A 3UE0A 4I03A 4CYCB 1QZYA 2W3DA 3H5RA 1G3WA 2R7XA 1G49A 2WO8A 1TW3A 1SVLA 3WGHA 3ABTA 2YSRA 3HOYJ 3VODA 4R23A 2XROA 2EZKA 2DT5A 2VI6A 2V1UA 2DA6A 2FBIA 2LNBA 1QMFA 3E5XA 1R55A 3G71I 3VV4A 3ZN1A 5LD2C 4YRVA 4MGRA 5HAQA 5I43A 4J4MA 5A92A 5HPIA 3A3FA 2NS7A 1HVBA 4B09A 1GA9A 2XRNA 3UPOA 2ELKA 4AIJA 1GE5A 3KEKA 1Z67A 2YR2A 3QP8A 2HNHA 2WGWA 4FX0A 1UEAA 3PIOF 1Q1HA 5B1AH 1XFZA 1MH4A 3JRBA 2KMUA 4RAFA 3CP2A 1YLTA 3RTSA 1F5TA 2GJ3A 5GAEJ 1PWCA 1W7PD 2ZC3B 2V4BA 5CQEA 1L6JA 3FG8A 4BYYA 2DN0A 2VKEA 3JRGA 1Z6TA 5B5OA 1KGSA 3FMSA 3UY6A 3I56I 2FOWA 4EUZA 2RREA 4EJUA 5F5YA 4YNRA 2UUZA 5FJ8J 4BL0B 2V1NA 4OIOF 3EOIA 5DCMB 2K3PA 1W36C 3NECA 3V7CA 3ZVSA 5H20A 3IHUA 4FTHA 4EQ1A 5DV5A 1BJZA 1I6HJ 4C2MJ 2JKTM 4IZZA 2V9KA 1QA6A 3QP2A 2R5YB 3GFLA 3L7WA 2WAQA 2GZAA 3ZXHA 2M3AA 3O3KA 2R9XA 5FKMA 2HS5A 5EVIA 2PD8A 1KU3A 4NNJA 4RB1A 3C4OA 2RGVA 4C2TA 2WV0A 1DTHA 5IP9J 3OYCA 3CJTB 3L2RA 4FU4A 3KSIA 1PVEA 4R3AA 3HJKA 1RUOA 2AVXA 3U9GA 1R22A 2JCHA 1P7JA 5EPHA 4A12A 4NQWA 4HLXA 4P6ZM 2RKHA 4ANJA 1QO0D 3BG6A 4RVAA 2V0WA 2A05A 2G0EA 3R60A 3OIQA 5LHIA 5CRFA 3BRMA 1VZ0A 4AYBA 3H82A 3UR3C 1KDWA 2P7VB 5CYVA 1CGPA 4CYDA 4KZAA 2A24A 2M9HA 3D3OA 3B3XA 3EYYA 3CAXA 5CPRB 2HU9A 4ZJ2A 4BY1J 4QY5A 1OMJA 3AKZA 1J59A 1BUDA 1SDEA 3SH8A 2HP6A 4BH9A 5GLBA 3DXJF 3D72A 1ROSA 3VOLA 4R70A 2A49A 2A6EF 1BSWA 3RQIA 5EZHA 3B6AA 2OF7A 1S67L 2OZ6A 3HC7A 1FLIA 1O3SA 3HCYA 1TQPA 3BCAA 1TLHB 4GS9A 2GNXA 4D2OA 1MH3A 2DFFA 4ZYEA 3M1EA 3H7WA 3QU3A 4LD5A 3AG4H 3G1LA 2ZSHB 3GCMA 3OSFA 5TBMA 3OYGA 4Q0IA 4RGSA 1Z0XA 1FSHA 2E35A 2IA0A 1FCNA 5LHHA 2DA2A 3ZOBA 4L9GA 1HW1A 1YQSA 3K69A 5JHUA 2NS0A 2OY4A 5L10A 4KIFA 3ABUA 4KUMA 1NYYA 1XB4A 1RPWA 1XSDA 3F8MA 2XAFA 5M18A 1IUYA 1K0KA 1BLSA 2BW3B 5FDHA 3IH8A 3PBRA 1K6OA 2OVZA 3KCCA 4FT8A 4MLLA 5E79C 2W82A 1EH6A 3CCRI 5K7HA 1GUUA 5ILSA 3A3JA 1JXSA 4D5CA 3RJPA 1QRYA 1JHHA 4EV4A 3ROUA 4DIQA 1HW5A 1QJJA 4IHSA 1XMKA 1GVDA 3GDIA 5CVUA 1BI0A 5IT3A 1ETYA 2JKTI 1FSEA 3IH9A 3NY4A 1W1WE 3ZR8X 2R7VA 5EDNA 3V8KA 3BTCA 2LSOA 3PNYA 1IRZA 3VFHA 4OP8A 1GO7P 3LQBA 3HPHA 2K2NA 2H0YA 4DW6A 5E2FA 3F8CA 2EV5A 3FWLA 1JTXA 1XMXA 3IQAA 1MMDA 2R3SA 4LV0A 2R7RA 3WS5A 4GR0A 4LV2A 1LVAA 3F0CA 4ZYAA 4BMWA 2VGLS 4D1QA 2I8DA 1SFOJ 1R1HA 2HPIA 2M1CA 2DMWA 4FXYP 2CW8A 5FLMJ 3KPHA 5L3EA 2DDYA 2MD5A 4G0DA 2OZUA 3L0TA 2BE5F 2EFXA 3UPPA 3DTKA 1IRFA 3UNWA 3GZNB 4E3JA 2STWA 4ZDLA 4OIQF 2H09A 4C3JJ 1K61A 1MBEA 5KVRA 3DW0A 1VB6A 3M8FA 4MDZA 1V3FA 3K4LA 2O9BA 2HXIA 2NYXA 3BJAA 3Q3SA 5I3MA 2YUFA 3QNBA 3R7WA 2JT5A 2X6YA 1E0EA 4DRTA 4ENMA 2PJPA 5C5KA 1W8YA 4OPRA 4E7JA 3R61A 4ENJA 4GF1A 3WG9A 3C4PA 4HNBA 4RM3A 2HYGD 4ZZDA 2W25A 4CSWA 3KETA 4GDBA 4PM6A 1OR7A 5E8GA 3TP3A 3CQZJ 3KP2A 4J01A 3OL4A 5LBRA 4X6AJ 1YP1A 1RC9A 3PSIA 4GOGA 1G8XA 3LAPA 2J5OA 2V1XA 4XUZA 2X71A 2R7FA 4D0PA 3LY4A 2DBBA 1DU0A 3ZUKA 2H6CA 1S3JA 1MMQA 4OOYA 1ETKA 3I59A 3G34A 2RQQA 3FYZA 1YW7A 1IN7A 3RKYA 2D1OA 1E25A 4LGWA 2ZFUA 3LUMA 5BPDA 4EMSA 4HOIA 3A0VA 3TEDA 5EUAA 1MJAA 4HG2A 1VQ6I 4V19K 3HVFA 4KZ4A 3ITBA 3TSGA 2QMIA 2MZEA 3EUHC 3HBRA 2M34A 4LB5A 1Y8QB 4L0LA 3EDIA 3QHYA 4CCJA 3A3DA 2O8XA 2LVSA 3S93A 2DW0A 3SQNA 2K9NA 2MGQA 4XLPF 3IL2A 1IUFA 3G2ZA 1KE4A 3B2ZA 4HX4A 4PDKA 3J7AY 2VC0A 4FX4A 4EBPA 4EXOA 2HFHA 2E2JJ 3G31A 3A0HC 5F0HA 3PIPF 2NNNA 5FASA 1LNWA 4IN9A 5L3FA 3WTUC 4F3QA 3HOZJ 1XN7A 3OYBA 5CVIA 2W57A 5FQIA 3GQZA 3IWIA 1XPBA 2KIUA 4KDPA 4QTRA 5FGMA 4V2GA 3OS2A 4RLQA 3KECA 3ASOH 4Q4ZF 4KIGA 1KVLA 1TVIA 3BQYA 3PFYA 1CI8A 3E5UA 1NWZA 1BIWA 3S2DJ 2X0LA 3AG3H 1M40A 3ZMTA 1IF1A 1WKMA 3KEJA 1L0FA 3HDAP 3JR9A 3RI4A 3G5CA 3NQOA 5HW3A 3EGDC 1ERMA 4HBTA 3K1MA 1SKFA 2J8YA 1YITI 4LFUA 1BTLA 4HNVA 2VA0A 1IELA 3LFUA 1DP6A 2DDFA 1QZEA 3E6MA 2E1MB 5D6FA 2R92J 1X1AA 4W97A 4NC8A 1YLFA 1U78A 3FHNA 4BQOA 4I76A 2JZYA 1ON1A 1GHMA 1LLBA 4IL6C 1SD6A 2WBMA 1D5JA 3I71A 1JT0A 1IXSB 1S1ZA 1JANA 5CERA 4ETXA 3MN2A 2E19A 3FXKA 2Y2LA 4OPZA 2OPTA 3IAS2 5LLQA 2ZQDA 4UHUA 4Y2FA 3CDHA 2QCOA 4JPMA 1PI4A 3BQAA 3CUQA 4OOMA 1FWZA 2R7TA 4Y7NJ 3PNTA 1N25A 5BS6A 4BGDA 4GN2A 4H84A 4F7ZA 1Y39A 4KQOA 1SDNA 3K10A 2L3DA 2V8FA 1ZTRA 4OPYA 5LEKA 3HBVP 2EWWA 3Q82A 4PKQA 1E3UA 4X0GA 2NRAC 4CPKA 2IS4A 3OHOA 2Z6CA 1LE8A 4U87A 2PR5A 1H9TA 3OCLA 1KU7A 1EROA 2VXDA 2H6BA 2IWDA 5E3LA 4A5RA 4CYCA 2Z16A 3L9KA 4ZDPA 2PLYA 2D2WA 3LICA 2A2LA 3S22A 1JWZA 3DWLE 4BXXJ 3MWMA 2L0WA 3TRCA 2Y69H 1MMNA 3DTIA 2DNSA 2VV6A 2XEPA 5ED4A 3BA0A 3H35A 3LILA 4MEZA 4LB6B 3OPLA 2ZBBA 5TRDA 2HQ5A 3CO6C 1FJLA 1BSGA 2EJRA 3F6VA 1HF0A 1BLCA 3DWZA 2EIMH 4OQ0A 5EOEA 3JSOA 3VMAA 2RDPA 1FBUA 2E7XA 4JKTA 2WZZA 2KDKA 3EHXA 3KYZA 4M3GA 1IN8A 3TOIA 3AFHA 2SRTA 2L9SA 4IXAA 1ZS0A 2DOEA 3UB5P 4CQHA 4N0BA 5J4VA 1OLTA 3PNVA 1FCMA 3WTWC 2NNYA
chains in the Genus database with same CATH topology
2RQQA 4NQWB 2R7QA 1QHHD 1SAUA 1JAPA 2CV0A 2W13A 2WAQA 3P24A 3WV3A 2PJRB 4B47A 3V96B 2HDWA 4F93B 3F1AA 4CCOA 4DBQA 2D1OA 2M3AA 2X3CA 3OS0A 3ZXHA 3HPGA 2ZFUA 1J7NA 3O64A 1GE6A 3LUMA 4XONA 1IAGA 2W12A 5BPAA 5LABA 3HL2A 1QUAA 456CA 3OYDA 1JI8A 3CZ6A 2OZRA 3RTTA 3I7IA 2M7BA 3LSKA 1XURA 2WADA 4NNJA 2VQHA 3AL0C 4GR3A 4HG2A 2VL8A 2F5VA 3PJRA 5CUHA 3OYKA 4OAYA 4E4HA 4Q1LA 1O0TA 3MMYB 1LKXA 1WJBA 4JQFA 4C2TA 2MLRA 2JNPA 4BU2A 5FRMA 1IAAA 2M7AA 3UVCA 3K7LA 2OVXA 2MZEA 2ZXHA 1Z3YA 3EUHC 2OW2A 1DTHA 2IXSA 1IABA 2LYCA 2LOOA 2QKLB 3OY9A 1GKCA 1HTDA 3L2VA 1CIZA 3I3LA 3VI1A 1IADA 4CZCA 1WNIA 3D5LA 2E5ZA 3OYCA 3SDBA 3VYUB 3L2RA 3GBOA 4FU4A 5CKTA 2MZHA 2IGMA 3S8PA 1QIAA 3LKAA 2HVSA 1N78A 3DPFA 3EDIA 3VDXA 4XCTA 3K4BA 1N75A 4CCJA 3KX2A 1XUDA 2AYKA 4WKIA 4G6TB 2LBFA 3QYFA 1QHGA 3S93A 1KONA 4BXFA 3OYNA 1V5EA 1K6YA 4ZJZA 2BVLA 2VJJA 4N4NB 1JJ9A 2PJRA 2DW0A 2AQEA 4ANJA 4IJOA 2JIHA 2XF5A 3BG6A 3FDYA 1OS2A 3N2UA 3TBIA 4H3XA 1GXDA 1WJCA 1OM8A 3HYGA 4KISA 4ITVA 1SFKA 1SMPA 5CQGA 2XC7A 4PKSA 3OIQA 4XNFA 3RCOA 3DPUA 1MMBA 1YE9A 4PKRA 2VQCA 3F19A 1X1CA 2IGNA 1WJAA 3M1CA 2ERQA 4ON1A 2POJA 4WK7A 1BR4A 4WKEA 1YQYA 1A85A 3KWVC 4CUGA 2KRHA 1VZ0A 4YEJA 1KUIA 3B2ZA 3LJGA 3SZGA 4AYBA 3HOTA 3UR3C 2FV9A 3J7AY 2L0RA 1G59A 3LSGA 3DPLC 1PWPA 4DGWB 1I76A 2DW2A 2XF7A 1XFUA 3LMCA 1LVKA 1YOUA 3PUBA 4B44A 1Y93A 2IS2A 1BZSA 1KUFA 1CXVA 2CMPA 2WAEA 1HFCA 2OY2A 2E5NA 4IX7A 3MA2A 3LK8A 3HOSA 3KEYA 1NG7A 3K4MA 1N77A 5I2ZA 2IS6A 3FBIB 1T95A 2LC2A 4B3XA 1S4BP 2X85A 1PWQA 3D5SC 1D0YA 2F6CA 2VKDA 3HUGB 2V7FA 1USNA 3AYUA 3E8RA 3F18A 4GQLA 2L5QA 4QKZA 3Q2HA 1AF0A 2M4KA 3NWTA 3QYBA 5TGTA 1D1CA 1DMTA 4IN9A 3HY7A 4PKVA 3DLAA 2VB6A 5CPRB 2JUGA 1C3IA 2GOXB 2HU9A 3OR1C 1YCMA 1G05A 1BR2A 2X1DA 1D1AA 4YELA 4D9JA 1UTZA 4F3QA 5L7FA 4XKVA 4L7AA 5KNLA 1OMJA 3OYBA 3TVCA 3AKZA 1BUDA 3EWJA 1PWUA 2JSPA 4II2A 3H5AA 4PJJA 4XLCA 3ZRGA 5HNHA 3DNGA 3D5RC 1C7KA 4BJ5C 5FROA 4GWMA 1KAPP 2OW1A 4Y33A 2VIXA 3VYTB 3MKYB 2OXZA 2XS4A 3ONQA 4I35A 2ELJA 3OS2A 2EROA 1ROSA 3F17A 4RLQA 4JA1A 1AA7A 3L2UA 3KECA 3S32A 4ZTJA 2LY2A 3TT4A 4GR8A 4OAZA 3RSNA 3EUKL 2WO9A 4N4OB 3ZXSA 3LGPA 3OHLA 5I4OA 1FMVA 1EAKA 2CS3A 1BSWA 2W15A 1KUGA 1R1JA 4E7SA 3BG7A 3PFYA 1HV5A 2RJQA 4GWNA 4BDYA 2IGOA 3VYRB 2J83A 2KZVA 3HC7A 4LIVA 4RM2A 1W36D 2DXIA 5L79A 3IAM2 2Z2SB 3IUOA 4XOTA 2VLAA 1FBLA 3BCAA 2MABA 4EATA 1BIWA 3SYTA 1JKYA 1I73A 4XM7A 2BVMA 4HSRA 1R1IA 4XORA 3EDGA 4DBRA 3L2WA 2JT6A 3KMEA 4DV8A 2DT7B 1TT0A 4H1QA 4XM3A 4BS9A 3DPTA 1FMWA 1ASTA 1TZLA 3KEJA 3HDAP 3K4JA 3TMOA 3WV2A 4A3WA 1EB6A 1PWVA 4E7HA 4XN0A 3NWSA 1SATA 1NG6A 4FETA 4AU7A 3G5CA 1Y0VA 2VPLA 2VXZA 1G9KA 2O36A 1GO8P 3K70C 1R6RA 1Z7LA 2ZSHB 3OYHA 3F16A 2O5RA 1WJFA 3LMMA 1BKCE 1G12A 5KHDA 4XKWA 5KCMA 2R4GA 3VSKA 2WB1A 2FUG2 3OYGA 3OYLA 2JA2A 2KRCA 2W0DA 3GBGA 4QPQA 1D8FA 1Y56A 3SEZA 2V6EA 3HB2P 4IQ4A 2A5WA 4JIJA 1EUBA 3LL7A 4LITA 966CA 2OUMA 1EA3A 1JK3A 4E6KG 3CP8A 2AQFA 1V5GA 1D0XA 3LIKA 5D3CA 1T0FC 3ELMA 4XR6A 2OY4A 3LFUA 1ZVXA 1MW7A 5HLTA 4BJTA 2YIGA 2WAFA 4PKTA 1X19A 4JQGA 2L7KA 2BOLA 4JOMA 2KHMA 3C2HA 2DDFA 2E2DA 1BKCA 3LUNA 4G9LA 2VASA 4L6TA 4II3A 3I9V2 3UNGC 3L0VA 2ERPA 4QPOA 2E1MB 3DSLA 2K9LA 1ZELA 1CGEA 3F15A 2XDVA 3C2GA 4BUPA 1X1AA 3MKWB 5CZMA 2MLSA 3BC8A 2IGKA 2R7WA 4XLFA 2RJPA 4CCNA 1WJ5A 2XSJC 3P1VA 2PJTA 3QOEA 4R3VA 4BQNA 4IUWA 1YX3A 4C9YA 4F91B 2P0WA 4NC8A 1HY7A 4WZVA 1QU3A 2DOAA 3DPEA 4BACA 3U1RA 3LSMA 1XUCA 3FHNA 2K9MA 2R7OA 4BQOA 4XM8A 2BW3B 2VJ5A 4ILWD 1PJRA 3K6GA 3H0DA 1CAQA 1SRPA 2OW0A 4H4KC 2OVZA 4EFSA 2MFZA 3DTEA 4RMNA 3OYMA 3LSHA 4CCMA 3K4KA 4BE0A 1BKCI 1OS9A 1RM8A 1DQUA 3W2VA 2PMZA 2V26A 2OXUA 1I1IP 2LREA 2Q2EB 2WBMA 2A6TA 3N05A 2QKMB 2YB9A 4HNUA 2W82A 1D5JA 1D7XA 1ZXCA 4KT6A 2VQLA 2WOAA 3LJZA 2QPJA 2DJIA 2LH9A 3OL3A 1JANA 2HQAA 1XFXA 1WJDA 4DOZA 5H8XA 4PFPA 3FKJA 3H5NA 1UG0A 3VYSB 2XF6A 4DIQA 1X4PA 1QJJA 3CKIA 3BLYA 4E7IA 3N2VA 2AIGP 1ATLA 1CQRA 4CCKA 3L2QA 3VTGA 2FV5A 1AKLA 1X4OA 3USNA 3IAS2 5HNFA 3OYFA 3LQ0A 2LRDA 5D1SA 4BEHB 5JMYA 4H82A 3DU5A 3HY9A 3G2BA 3VSLA 4HNTA 4E7KA 3M8JA 2L9NA 3QYEA 3S3MA 4C2UA 4IKFA 2XS3A 2E1MC 2MC4A 2OXWA 3HG9A 1Z3JA 2CV1A 2HVRA 3ZR8X 2R7VA 4ZC3A 1SLNA 2F4IA 4DD8A 4JPAA 1B8YA 1Z21A 1FLSA 1S9HA 3TL4X 1ND1A 2HU6A 4I03A 2R7TA 3DKXA 3PNYA 4F55A 4AUOA 2A8HA 5BOYA 2LY1A 2WY7Q 3ZCOA 1C8TA 1J09A 2CFOA 1HFSA 2DT6A 2W00A 3OMYA 3OS1A 1GO7P 1D1BA 3PNTA 1IAEA 1HA8A 2K2GA 2MZIA 2USNA 3LQBA 1GLNA 3DKYA 3HPHA 4BDZA 5D2BA 2BW3A 2KPMA 4P5OA 3H5RA 2HPMA 2WY8Q 1K7IA 1U0JA 2J0TA 3G42A 3HDBA 3TSKA 1G49A 5LFAA 2R7XA 4XOPA 4BGDA 4H84A 4PK4A 2W1OA 3CMMA 4PJNA 2WO8A 4XLAA 2Z2DA 1HOVA 2KQRA 2UV1A 3H9JA 4OWRB 1MMDA 2GOMA 1ZP5A 2W14A 3K10A 4PSWA 4PKWA 2R7RA 2JSDA 4L63A 4GR0A 4HX3A 2X1CA 3IP4B 4H76A 5D7WA 3W2AA 2R7SA 5D1TA 3HBVP 4DPEA 1XFWA 1OM6A 4ZYAA 1MNDA 1SU3A 2Y6CA 2D1NA 3EPZA 2CV2A 1CGFA 4CH7A 1K7GA 3DWBA 4D1QA 2I8DA 4H30A 4C30A 2ZXIA 4PKQA 1X1BA 4DF9A 2R7UA 3K4CA 1R55A 4P1WA 3A1YA 1X1DA 4PSXA 1K7QA 1QJIA 2HPIA 1R1HA 3RTRA 1XFYA 4X0GA 4FXYP 3A2KA 4DJAA 2CW8A 3I7GA 3TS4A 3AYKA 1BM6A 5LD2C 3E1SA 1BQQM 1OO9A 2IS4A 4PJLA 3OHOA 1R54A 4YRVA 4BEHA 1MMGA 2NOJB 1ZTQA 2DDYA 4U87A 4Y3OA 4Y4RA 3LE9A 4G0DA 5I43A 2VXDA 3BCBA 4J4MA 2CUJA 1UAAA 4A7BA 1WFXA 3AIGA 1LFPA 3DEEA 3L0TA 1UMSA 2MYSA 3HBUP 2E3XA 2OI0A 4ZDOA 3Q2GA 4FVLA 2KDOA 3DTKA 3B92A 2KL4A 4PJMA 1BUVM 2HVQA 1IACA 4BE2A 2Z16A 3OYAA 4JP4A 4ZDPA 1YX5A 2K5CA 4CA0A 2X6XA 4LG3A 1ZXVA 2I47A 2VJ4A 3ZQQA 3K7NA 3O2XA 2Z1DA 4R79A 1GE5A 3KEKA 1IRXA 2LG4A 4XLEA 4ZDLA 3U21A 1Q3AA 4IQJA 2X51A 3HKZA 2HNHA 1LDKB 2JVHA 2VQGA 3K4NA 3DWLE 3RQ4A 1Y6IA 1UMTA 3K70D 4E7LA 2V4JC 4GRIA 5B5PA 4B43A 1CK7A 1UEAA 4FASD 2ZSIB 1MNCA 2X3AA 3QODA 3K4LA 2Y0SA 3CJQB 2CKIA 3WV1A 1MMNA 1RMZA 3DTIA 1JIZA 1MMRA 1UTTA 1XFZA 2M4GA 830CA 5I3MA 2YUFA 3MD2A 3W2WA 2JT5A 3LJTA 3OYJA 2KMUA 5BOTA 2RNGA 4F92B 2X6YA 1JIWP 2W4SA 3CP2A 3HXLA 2OV7A 3CJRB 1WJEA 1AYKA 1DGWY 3OWTA 1E0EA 3LSIA 2WA0A 3LEAA 4XMYA 1JAOA 2CH0A 4RLFA 1MNEA 3A4CA 3RTSA 3ZGKA 2M0MA 5HVQC 3BA0A 3VWBA 1CGLA 4HSTA 4PUSA 4H2EA 3H35A 4HMAA 3EDZA 5D1UA 2MD0A 1JH1A 1D0ZA 4E7JA 3LILA 1BQOA 4KITB 3OIPA 2TCLA 4CTHA 1PYVA 2W7NA 1V5FA 2VJIA 2L2OA 2V4BA 5CQEA 4HPQA 2CUZA 3E0JB 4XQFA 3MKZA 2Y6DA 4GF1A 4BE1A 1BOBA 4U7BA 1L6JA 2UWMA 3W3CA 2K9CA 3DL1A 1MMAA 1JAQA 1ERDA 2KRJA 4F52A 1GE7A 1MMPA 1G4KA 3KYLA 4XM6A 5B5OA 2X7MA 5JHFA 1KBCA 2IS1A 4RM3A 4XKBA 4BQQA 1P9QC 3SHIA 4B48A 3PSFA 3H9QA 4AVZA 4NUBA 2X1EA 3S3NA 2RREA 3NX7A 4KJZA 5I12A 1OR7C 4HEA2 4H49A 2KLOA 4CSWA 3S3OA 4XBHA 5I0LA 4LIUA 2HZDA 3SEQA 1DP3A 2CLTA 4J00A 4GUYA 1UELB 3CF2A 4ZR5A 3KRYA 4FXQA 2UUZA 4E7ZA 3LIRA 4AXQA 1KUHA 2OW9A 3EHXA 3DQVC 1H71P 3OR2C 2JVGA 3OL4A 4J01A 4WF6A 1FM1A 3AL0B 3DU6A 3OOUA 4XLHA 2O3EA 1BR1A 2DCEA 4L19A 3OYIA 1OM7A 4BL0B 2V1NA 1O0QA 4MLOA 3AFHA 2SRTA 1DGRM 3H9GA 2Q1ZB 4XKCA 2L9SA 1YP1A 3RPUD 4PKUA 1SLMA 1ZS0A 2VKHA 3OYEA 2X3BA 2E60A 2K3PA 1PWWA 4AIGA 1GKDA 1KUKA 3PSIA 2CW7A 2KP6A 1W36C 1Y8JA 1QICA 5CXAA 3CESA 2DW1A 1G8XA 3ZVSA 4NC7A 4CCLA 1OLTA 3PNVA 2OC6A 1QIBA 2XAUA 1A86A 1D8MA 3EDHA 4AYKA 3EUAA 3F9KA 3PL8A 5FRNA 4XL9A 1Z3XA 2X6WA 4HRIA 1XFVA 3KMCA 3ZUKA 3B8ZA 3EHYA 5HOOA 4IZZA 2V9KA 4XN3A 4ZTFA 2N8RA 3FBNB 3V42A 1MMQA 2LBFB 3KHIA 4PFOA 1B3DA 4BJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTE A;  3DTI A;  3DTK A; 
#chains in the Genus database with same CATH topology
 3M8E A;  1OTE A;  1FX7 A;  4DBQ A;  5HAR A;  3SW1 A;  2JBF A;  5E18 F;  2VQH A;  2NAZ A;  1VQN I;  2F5V A;  2X9D A;  1MMS A;  1K4E A;  1HXD A;  3GF2 A;  5FRM A;  2EIL H;  5DCM A;  1RGZ A;  3FV7 A;  3GBO A;  3MKE A;  4RB0 A;  1MPL A;  3DPF A;  3MZE A;  2R5Y A;  4QJG A;  1O57 A;  3ZHH A;  4IJO A;  4HYE A;  1OS2 A;  1Z6F A;  2YKF A;  1D5V A;  2JSC A;  4XNF A;  3D9Y A;  1DJB A;  4EJO A;  1VF9 A;  1Y0U A;  2FQ3 A;  1FOW A;  3LJG A;  2KDZ A;  3FWE A;  3LMC A;  3FIS A;  1A6Q A;  4MHG A;  1PYY A;  4ON0 A;  3I58 A;  2F5C A;  4EM1 A;  1ZG5 A;  2X85 A;  4NDL A;  3UPN A;  1IZ1 A;  2G9W A;  2OTJ I;  1DRM A;  2EPF A;  2J3W A;  1HSJ A;  1R00 A;  3OC2 A;  2XAS A;  3HJI A;  3ZDJ A;  2OXZ A;  2M1B A;  3F17 A;  1W63 Q;  4JA1 A;  3GMW A;  3HDD A;  4MO7 A;  3LGP A;  4HV5 A;  2CMN A;  2CS3 A;  3UN7 A;  1R1J A;  4P9U A;  1LI0 A;  2MAB A;  1TWA J;  3PHY A;  4GD8 A;  1TWF J;  2IEK A;  3WV1 A;  4XM7 A;  1MZB A;  3DEW A;  1R1I A;  5E1X A;  1FMW A;  1AST A;  3TMO A;  2VBY A;  3PBS A;  3T1R A;  4BHC A;  4JXG A;  3OYH A;  2O5R A;  1BKC E;  5K5Q A;  1H8M A;  2ADU A;  5L3D A;  4QPQ A;  2WGV A;  2HTS A;  1V4R A;  2ZJ9 A;  3F8B A;  4Q0J A;  5E17 F;  1V5G A;  1XX2 A;  1YI2 I;  5F69 A;  1MBG A;  4H8R A;  4JQG A;  1T1B A;  4JOM A;  2E2D A;  1Z91 A;  4L6T A;  1OCT C;  2JKR M;  3LST A;  3ZQ7 A;  4QPR A;  2K40 A;  2DQL A;  3W2Z A;  3ECO A;  1I27 A;  4HZF A;  2BHZ A;  2EZI A;  5GTI C;  4YFX F;  1AXB A;  1ZXC A;  2NVU B;  4RB2 C;  4WZ5 C;  4A5M A;  2GBY A;  4IRI A;  3EEA A;  4CCK A;  3PUF A;  2Y55 A;  5BPI A;  1XJ2 A;  2FEZ A;  4BEH B;  1OMI A;  3HY9 A;  4E7K A;  3CUE A;  2ME6 A;  1ETW A;  4LLN A;  3C2W A;  5TFQ A;  2EV6 A;  2MZI A;  1MBK A;  4BDZ A;  4ESP A;  4OMY A;  2BW3 A;  1K7I A;  4EER A;  3M9A A;  3TQN A;  2KQR A;  3CZD A;  3HLD A;  3S1Q J;  4L63 A;  3E5Q A;  3GLX A;  2ZXI A;  4IHT A;  2NOJ B;  4RGR A;  3LQR A;  3BW6 A;  2P08 A;  1F43 A;  1O07 A;  1ZYR F;  1KE0 A;  1DP8 A;  2LF7 A;  4GCZ A;  4PAU A;  4KZ7 A;  3LEZ A;  1L3L A;  3WU0 A;  3O5Y A;  5J47 A;  3CMA I;  1VQL I;  1ZXV A;  3CD6 I;  5HDD A;  3U21 A;  1VQ7 I;  2ZBK A;  1K56 D;  4KZ5 A;  2JVH A;  3RQ4 A;  4B43 A;  1W5C C;  2X3A A;  3F1N B;  3CF5 F;  2Y0S A;  3CJQ B;  1MMR A;  3LY3 A;  3W2W A;  4IHQ A;  4NXB A;  2I72 A;  1T2K A;  4KUK A;  5I94 A;  3OWT A;  3LSI A;  3NCK A;  3LEA A;  1H8A C;  2ESH A;  3OIP A;  2H0T A;  4CTH A;  3PR6 A;  5IOY A;  2RAE A;  1L0G A;  2XPW A;  1F36 A;  2X7M A;  2RCX A;  4XKB A;  1P9Q C;  4PM5 A;  4O6J A;  3D0S A;  5KIZ A;  4U0Y A;  2HZD A;  2CLT A;  4J00 A;  1LDJ A;  3KRY A;  2C6Y A;  4AXQ A;  3EWK A;  2DPD A;  2VOP A;  2HXO A;  3MZ8 A;  4R3B A;  1FM1 A;  3NAR A;  4KN7 X;  3BPV A;  3C38 A;  3B42 A;  4KZB A;  2YKH A;  1P9R A;  1W7F A;  2L4M A;  5FI2 A;  3HOU J;  1UG2 A;  3BR6 A;  4EM0 B;  2HDQ A;  4C75 A;  3I64 A;  1V54 H;  1QHH D;  2W13 A;  5JYP A;  2PU2 A;  2HDW A;  1FOK A;  4RGU A;  1JI8 A;  3RTT A;  2HOA A;  2BY0 A;  3AL0 C;  4GR3 A;  3CCY A;  5HLH A;  2GA2 A;  3WRT A;  4BU2 A;  3PYP A;  1FQG A;  2IXS A;  3GO5 A;  2HDU A;  1VM1 A;  4WN5 A;  3BWL A;  2FBH A;  1YMS A;  4HA8 A;  3LKA A;  3S8P A;  4ZH4 F;  4FIS A;  1ZRE A;  3OYN A;  4N4N B;  3BY6 A;  2FD5 A;  2V1A A;  4AUX A;  3DPU A;  2IGN A;  1E2X A;  3M1C A;  3PO2 J;  1XGS A;  1A85 A;  4UUV A;  1I76 A;  1MWT A;  4MNR A;  4RA2 A;  2O3F A;  2STT A;  3BLM A;  3QYB A;  1G3S A;  1UHM A;  5BOH A;  5KZH A;  4L7A A;  5IT5 A;  1PWU A;  2ZCW A;  1H8Y A;  2X4H A;  4M3D A;  5D5X B;  5FKO A;  3EDP A;  2A3U A;  1G28 A;  1K78 B;  3LA2 A;  1Z9C A;  5FL3 A;  3ONQ A;  4Y7P A;  2FXA A;  3E7L A;  4LOC A;  3L2U A;  2PYP A;  1S72 I;  1IXR C;  2NVT J;  3KP7 A;  1TNT A;  1UZC A;  2HDR A;  1HV5 A;  3I7J A;  3P9C A;  2QJ5 A;  4PHT A;  2BBY A;  1FBL A;  1JKY A;  2ZMV A;  3L2W A;  4DV8 A;  1VQ9 I;  2IAI A;  3JTH A;  3OV8 A;  4AU7 A;  5EE8 A;  2WKR A;  2VXZ A;  2O36 A;  3F22 A;  5AIQ A;  2DPU A;  4HF0 A;  1YHQ I;  2KKO A;  2OU2 A;  5HDN A;  3I9V 2;  2ERP A;  3CUO A;  1LQ1 A;  3WWX A;  2K9L A;  5CLS A;  3C2G A;  3IXB A;  2CJJ A;  1WJ5 A;  4F91 B;  4IO9 F;  2V1Z A;  2W3H A;  3WTS C;  3KYD B;  4IEJ A;  3H0D A;  4WEJ A;  3H1C A;  4H6J B;  3IH3 A;  2XF3 A;  1I1I P;  2K4B A;  2YB9 A;  1D7X A;  4FD8 A;  5IP6 A;  4DQ2 A;  1UG0 A;  1X4P A;  4JF5 A;  3E0Y A;  2OAQ 1;  3USN A;  3OYF A;  1MSE C;  5ERI A;  2M45 A;  2L7M P;  2OXW A;  1Z3J A;  4M3E A;  3GTM J;  1AHD P;  4S2K A;  3O6B B;  3I55 I;  3UME A;  3ZCO A;  2CFO A;  4E3M A;  2FNP A;  2OCC H;  1ES5 A;  2UV0 E;  5M5X J;  1HOV A;  2UV1 A;  1LEA A;  1BIB A;  5D7W A;  5GAD J;  2P5V A;  3FIW A;  1X0O A;  4C30 A;  5FI7 A;  3CG5 A;  4YFM A;  3E1S A;  4LLG F;  3GTK J;  5LHG A;  2Z6D A;  5D8K B;  2JK3 A;  3M7G A;  2KL4 A;  4ZYD A;  3EQU A;  5E2E A;  3OZH A;  3T4K A;  1ENH A;  1ZG1 A;  2NS8 A;  4ABZ A;  2G2W A;  2XA7 M;  4FXQ A;  3KYQ A;  4QSH A;  1ZRF A;  3UDI A;  2XQZ A;  4GXO A;  1S6R A;  4DJ3 A;  1UTT A;  4GHI B;  1D3Y A;  4JGR A;  3MD2 A;  1XFN A;  4GDF A;  4S04 A;  4GD6 A;  4GLQ A;  1UHS A;  2TDX A;  5IT9 K;  2ZL1 B;  5CJ9 A;  5CEB A;  3JRF A;  4QWQ A;  1BQO A;  4DJ2 A;  2VJI A;  2L2O A;  3T8R A;  2PRF A;  3BPX A;  5A2Q Z;  1T1A A;  4BQQ A;  1YLY A;  3RPQ A;  1XA7 A;  3HOX J;  1LUJ B;  1D8K A;  1ZAR A;  2NVX J;  1VND A;  4F94 A;  5AQB A;  1H71 P;  3JVV A;  2K02 A;  2J5P A;  4OPQ A;  3J7Z I;  3OYE A;  1DP7 P;  4RYE A;  1GKD A;  2OC6 A;  2K86 A;  1P4A A;  5FRN A;  3ECH A;  2FZ0 A;  3KMC A;  1DU6 A;  1BW6 A;  3B8Z A;  4G6D A;  2LBF B;  4KT5 C;  5ILU A;  2E8I A;  1SAU A;  2QEN A;  1UGU A;  1T6S A;  2W1T B;  4CLC B;  3JTG A;  4DZJ A;  3FXM A;  5D6E A;  2M7U A;  1FP1 D;  3OYD A;  5EEA A;  2H94 A;  2KIF A;  3UB7 A;  4IPA A;  2MH2 A;  4HQE A;  4IUH A;  4UV8 A;  5CUH A;  3MF0 A;  3LAJ A;  3IBJ A;  3UVC A;  2XB0 X;  4XRF A;  1T18 A;  2F5E A;  3T1S A;  3SDB A;  2Q0O A;  5DM7 F;  2MSY A;  1PZO A;  5D4S A;  5M1A A;  1SMT A;  3KX2 A;  3ZPL A;  1U8R A;  4DDS A;  2BVL A;  1SVO A;  4II7 A;  1QVU A;  4H3X A;  3KP4 A;  1MMB A;  2H8W A;  2PX9 A;  1D8J A;  3F8N A;  4JX5 A;  1IRG A;  3BJ6 A;  1JJ8 C;  3IHB A;  3HLC A;  4LCL A;  1J3W A;  1G59 A;  2XF7 A;  1OYI A;  5IHV A;  5GPC A;  3MA2 A;  1EV7 A;  2VX8 A;  4CHU A;  3O8H A;  2ZM8 A;  2M4K A;  5GLA A;  4I98 B;  1DMT A;  1FCO A;  2D1V A;  5LBQ A;  4ZDX A;  3OR1 C;  4KFC A;  4I01 A;  3CMZ A;  5KNL A;  3F1O B;  3DBL B;  3CCJ I;  2R9W A;  4Y33 A;  1GDT A;  5FA7 A;  3S32 A;  1AOY A;  3HLB A;  1V9Z A;  3ZXS A;  1YW9 A;  2DRW A;  3WGI A;  1EAK A;  4NKP A;  1XD7 A;  3BG7 A;  2QBY B;  2IGO A;  3E97 A;  2DXI A;  2VLA A;  3ZP5 A;  3RKW A;  2P81 A;  2JA6 J;  3EDG A;  2EB7 A;  2V6C A;  3ISP A;  3V8L A;  3H92 A;  1SZV A;  1ZGJ A;  4A3W A;  2PBY A;  3NWS A;  1K38 A;  3M3Y J;  5J8X A;  3G73 A;  5EV0 A;  3V67 A;  5DKK A;  1Z7L A;  2QUF A;  3V7R A;  2P9V B;  1LI9 A;  3TDZ C;  2V6E A;  4JF6 A;  1Z6R A;  5A91 A;  2NUP C;  2GXG A;  1T0F C;  4IJG A;  2Z5U A;  2YIG A;  4BJT A;  4HDV A;  1T8I A;  1I1S A;  3DSL A;  4A5N A;  1KYZ A;  3GTL J;  1T08 B;  4ILW D;  3VP3 A;  1ORK A;  2MFZ A;  4RMN A;  4YWZ A;  4X6T A;  1LB2 A;  3K0L A;  6PAX A;  2Y0S N;  2Y79 A;  2QPJ A;  5CHU A;  3LA7 A;  3G6O A;  2ZJP F;  1BLH A;  2OCE A;  3QP6 A;  3K9T A;  1MY8 A;  5HNF A;  1I3Q J;  4A0X A;  1ERQ A;  4HLY A;  1GSW A;  3RPU A;  3G4S I;  3HG9 A;  4Y52 J;  2LY9 A;  4C3I J;  2DDB A;  4MCW A;  1ZHF A;  2QHK A;  2USN A;  2K2G A;  5K7F A;  2EZL A;  1O7L A;  2QYO A;  3JRE A;  3HDB A;  2J0T A;  5C44 J;  2OLV A;  2HJE A;  2XFT A;  4KG6 A;  4LG0 B;  4O5V A;  4S2M A;  2F48 A;  4AIK A;  2X1C A;  1XFW A;  3MAJ A;  1SU3 A;  2HTJ A;  1CGF A;  3MMH A;  2R7U A;  3A0S A;  3A2K A;  3KLO A;  4ESJ A;  1IO2 A;  4DKI A;  4BEH A;  2K7L A;  1JHF A;  2CUJ A;  3AIG A;  4MMN A;  3R0A A;  2MYS A;  2W3F A;  4EBL A;  5HAI A;  3B92 A;  4BE2 A;  1Z09 A;  3H82 B;  3NDE A;  3RFB A;  4OVD A;  3HRT A;  2B0L A;  2I47 A;  3K7N A;  3ERM A;  5DDG A;  2CW0 F;  4RDU A;  3PAG A;  2LG4 A;  2LMD A;  1WQ2 A;  2MJ6 A;  2ZSI B;  3G30 A;  2CKI A;  4U0V A;  2VOO A;  2K7S A;  3CO7 C;  5GLC A;  5BOT A;  4MBK A;  1M1E B;  1BC8 C;  2E34 A;  5M5Y J;  4H2E A;  2M5W A;  1IOU A;  4FOF A;  3C2B A;  1BOB A;  3DL1 A;  4AC0 A;  4A3C J;  3SS4 A;  1YJW I;  2K3F A;  1DJA A;  4NUB A;  2WWY A;  2X1E A;  3BG3 A;  2KLO A;  3NC8 A;  4DE2 A;  3F1N A;  1YSQ A;  2W27 A;  3ZMS A;  1R49 A;  2GX5 A;  1S7A A;  4PKU A;  2E60 A;  2PBI A;  5TBM B;  2PD7 A;  1BZA A;  2WGI A;  2RV8 A;  3B73 A;  5CXA A;  3LSJ A;  1QIB A;  1A86 A;  5F83 A;  4BD0 A;  4R6L A;  3N8L A;  2XPV A;  1S5L C;  2EXA A;  1NZU A;  5HOO A;  5E3O A;  2VGJ A;  2N8G A;  1B3D A;  5J1R A;  3K1N A;  2B7E A;  3ZGA B;  1IG7 A;  4U0T A;  1WE4 A;  2OQG A;  2EWV A;  1OCR H;  1IKI A;  3E3V A;  1NHA A;  4E4H A;  2M7A A;  3EYI A;  1C3B A;  3CCL I;  3T5X A;  2NOG A;  1IAB A;  2LOO A;  3E2K A;  2FML A;  2W85 A;  3VDX A;  1N75 A;  4IHV A;  4G6T B;  3QYF A;  1R5G A;  2PU4 A;  1K54 A;  3ZQL A;  2OQR A;  5CQG A;  3EQL F;  2DOD A;  1YM1 A;  1IV6 A;  4EQI A;  3MZH A;  4QHC A;  3WU2 C;  3A02 A;  1EH8 A;  3NOT C;  2JMW A;  3PUB A;  1PNE A;  1N77 A;  1FOF A;  2ZXW H;  4MBH A;  2EFQ A;  3E8R A;  1IXC A;  5HDK A;  1PDN C;  4E04 A;  1D1C A;  3H0G J;  1VQP I;  1OJG A;  3ITA A;  1OZ9 A;  2X1D A;  4GCV A;  1DJC A;  3KIO A;  1EF4 A;  3U1D A;  4PMA A;  3DNG A;  4BLM A;  4FE7 A;  4N92 A;  3F3X A;  4A3I J;  5EZG A;  3VYT B;  4OQH A;  4E6X A;  3KP6 A;  3ULF A;  5E1Z B;  3VFF A;  2J80 A;  3BFD A;  2H27 A;  3RSN A;  4DE3 A;  2V0U A;  4HJ4 A;  1UWP X;  4I3J A;  1PWG A;  1JTY A;  4EBN A;  1ODV A;  4ETS A;  3A01 B;  2NVY J;  4GKU A;  2KLI A;  1TZL A;  3T0Y A;  2PAV P;  4E7H A;  4YIN A;  3VEP A;  1HQC A;  1MJ9 A;  4M6V A;  1R6R A;  3LMM A;  1F98 A;  2GXA A;  2JT1 A;  3TE8 A;  4EQQ A;  1K78 A;  3SEZ A;  4JIJ A;  5IS1 A;  5B66 C;  3LIK A;  2FJ1 A;  2FBK A;  2FX0 A;  1DP9 A;  5G4Z A;  2E1N A;  4OIN F;  2L7K A;  4G9L A;  4BBR J;  4QPO A;  1ZEL A;  4UY8 I;  1ZLK A;  4HX8 A;  2IGK A;  2R7W A;  5E20 A;  2BY2 A;  1E3H A;  1NYM A;  1XUC A;  5M3M J;  4XM8 A;  2VJ5 A;  4R4S A;  1MBJ A;  5K1Y A;  2GLO A;  3W2V A;  3N05 A;  1ES4 A;  2KOI A;  1YKD A;  5F08 A;  2FMY A;  3ZQC A;  2HQA A;  1BYW A;  5J3L A;  4HQA A;  3VYS B;  4I38 A;  2ECB A;  3PXP A;  5FLV A;  5D1S A;  2PI0 A;  4GB7 A;  3FXL A;  2EX6 A;  4A3L J;  2NXN B;  3S1M J;  1FIL A;  2HU6 A;  3CWF A;  3P9K A;  5K7Z A;  1J09 A;  2Z9O A;  3ZNT A;  1IAE A;  3BR0 A;  4HP9 A;  2VE9 A;  4P5O A;  1UMQ A;  2WY8 Q;  1U0J A;  4L18 B;  4NXF A;  4XOP A;  4H6J A;  3OOP A;  4A93 J;  4OWR B;  2W14 A;  3OCN A;  2JSD A;  5HL1 A;  5J8F A;  5TJJ A;  3W4O A;  5E2H A;  4EFS A;  3EPZ A;  3Q9S A;  5F1G A;  1BOA A;  2ZM2 A;  1XFY A;  2ZMF A;  3BZ6 A;  5IYB J;  1HC8 A;  1B6A A;  1MMG A;  5EF6 A;  2R78 A;  2ISZ A;  2HGC A;  2ETH A;  2GWR A;  3ZMZ A;  5GHX A;  1OJ5 A;  5J1Y A;  3GTG J;  2FF4 A;  3FC7 A;  2XV4 S;  1NRF A;  2VGK A;  5DTD A;  2FFF B;  4IQJ A;  1FTZ A;  2VQG A;  3K4N A;  1Y6I A;  3C30 A;  2OAP 1;  2OBP A;  830C A;  3IWZ A;  4Y17 A;  1AKH B;  4BD1 A;  2RNG A;  5C4X J;  5J1U A;  2DMP A;  4XUX A;  1HCR A;  3OSG A;  2IVM A;  2BEO A;  1VHM A;  1HDD C;  2Q9N A;  4CLC D;  3MKZ A;  2Y6D A;  5FLX Z;  2FU4 A;  4KMF A;  4F52 A;  1G4K A;  4WXH A;  3MXR A;  4KQQ A;  1PFL A;  4DYR A;  1PRQ A;  4MEX F;  1U2W A;  1YFH A;  1UEL B;  3CF2 A;  4ESB A;  5GPA A;  3L7H A;  5JYO A;  4GHI A;  3AL0 B;  4XLH A;  1BR1 A;  1CF7 A;  1WI9 A;  5C3E J;  1ZTU A;  2ZL1 A;  2FE3 A;  3HSF A;  4UAA A;  2DW1 A;  3GUD A;  1ZRD A;  3EDH A;  2CWE A;  1XKZ A;  3S15 J;  4XL9 A;  1XGO A;  5J4Y A;  1OQY A;  4XN3 A;  1W5T A;  4I7H A;  5CED A;  3P24 A;  5HD3 A;  2VT2 A;  3WU1 B;  1SFU A;  3FPW A;  2IWB A;  3PBN A;  3JAM K;  3HL2 A;  1L2S A;  3H36 A;  2ZC5 B;  1R4N B;  3I7I A;  4CO8 A;  2HGV A;  4Q1L A;  3WTV C;  4JQF A;  1FYK A;  4M73 A;  1O7E A;  3CJM A;  2GIZ A;  3V7S A;  1F1Z A;  3DCF A;  3EUH A;  1ZGW A;  1FBQ A;  2XSD C;  3BTI A;  2DU9 A;  3NRV A;  3LFK A;  1ONV A;  4IOC F;  2LBF A;  3LR0 A;  3VP0 A;  2MLG A;  2ZB9 A;  1P97 A;  4G94 A;  2IW5 A;  2W1T A;  3JPU A;  1IFQ A;  1SFK A;  5HX9 A;  1UWN X;  2L0R A;  2JKF A;  2E1O A;  1CXV A;  4WYY A;  3LK8 A;  1NG7 A;  3CTA A;  3K4M A;  4B3X A;  1EW0 A;  2M8G X;  2VBW A;  1X2M A;  4D60 A;  3OLO A;  2JUG A;  1C3I A;  5FD6 A;  4XKV A;  3J81 K;  3BR2 A;  1OTD A;  3VPR A;  1PWD A;  3DP7 A;  2HOT A;  1P4W A;  2LY2 A;  1S4R A;  3TT4 A;  2DDA A;  5I4O A;  3BRO A;  1N9O A;  3I5U A;  2W15 A;  5FI6 A;  2FFY A;  5CVR A;  1WI3 A;  4ZYG A;  4A6D A;  2VOD A;  5F1R A;  4MTD A;  2KZV A;  2LB9 A;  4KUO A;  2Y2O A;  2EFW A;  3O8G A;  4LV1 A;  1MNM C;  2LDU A;  3CLQ A;  1JTD A;  1VET B;  4XN0 A;  2R93 J;  1NG6 A;  1Y0V A;  1R23 A;  4K0X A;  5EJC A;  4AID A;  3F1O A;  2TCT A;  5EEH A;  2A07 F;  3T4T A;  3GBG A;  2P8T A;  5EVI D;  4Q48 A;  3FXO A;  1X3Z B;  3BFG A;  2WAF A;  1X19 A;  4Q5S F;  2PG4 A;  4M3F A;  5FQK A;  4BUP A;  3VP4 A;  5DFY A;  4AIH A;  3Q7V B;  4GZB A;  3HUM A;  2QBY A;  2RJP A;  4PM7 A;  4JX4 A;  2BLS A;  1GV5 A;  1QME A;  2Y6C A;  1IKG A;  4MBF A;  4ZJ1 A;  3LJZ A;  3BG9 A;  3QAH A;  3GWZ A;  4R4R A;  1S29 A;  2LH9 A;  1XFX A;  2P9V A;  1W79 A;  2LP0 A;  3MKL A;  3L09 A;  3S3M A;  3P01 A;  4IKF A;  3BWG A;  3OBF A;  2Y2K A;  3ZMD A;  2W3G A;  3F6O A;  4F55 A;  4HIA A;  2WY7 Q;  2DT6 A;  4EVI A;  1UJ8 A;  5K5B A;  1UST A;  4QY6 A;  4PK4 A;  1CEF A;  3MFX A;  1T98 A;  1R1V A;  3BLS A;  1ZN2 A;  2M7V A;  1MD0 A;  3PBT A;  1HOM A;  1CI9 A;  1K7G A;  5A93 A;  3V4G A;  3TS4 A;  1BQQ M;  4DNC A;  1R54 A;  4IF4 A;  1WFX A;  1ODD A;  1K25 A;  3HBU P;  3WRZ A;  4I0A A;  1GHP A;  5HS7 A;  1D5Y A;  1ONH A;  1KQ9 A;  3OYA A;  1YX5 A;  2X6X A;  2DA4 A;  3ZQQ A;  3PTE A;  4GYG A;  3O2X A;  2Z1D A;  4MN6 A;  4NBQ A;  3LWF A;  2XD1 A;  2DOF A;  1YG2 A;  1YIO A;  4LG0 A;  4P0M A;  4O3M A;  2QQ8 A;  1RMZ A;  4S0H B;  3H3U A;  1MKM A;  4ETZ A;  3TOA A;  2V2F F;  4KQD A;  2ZC7 A;  2HOS A;  1JWV A;  1XFQ A;  2HYF A;  1MNE A;  4DDY A;  4UV9 A;  4PUS A;  5D3O A;  4HMA A;  3PQJ A;  2TCL A;  2W7N A;  3U4L P;  1NLZ A;  4I6Z A;  4MNU A;  4Y0T A;  3VOE A;  4BE1 A;  2EFU A;  2ESN A;  3HOV J;  3L9F A;  2BGC A;  1EJ9 A;  1GE7 A;  1MMP A;  4JGQ A;  5HDS A;  2IS1 A;  1DPR A;  4G3K A;  2J7V A;  1YS6 A;  4HEA 2;  4H49 A;  5I0L A;  4JBA A;  4M6Y A;  1MDM B;  1WCM J;  3OOU A;  2ID6 A;  3FKW A;  5TIS C;  3OYI A;  4Y5F A;  3T4Q A;  2CUE A;  3HGG A;  3BG5 A;  1Y8R B;  2WKI A;  3OPP A;  4G6Q A;  3I4N J;  1NLY A;  4AM3 A;  1FNN A;  1PUE E;  4Y0U A;  2Y9Y A;  1XS9 A;  3F1A A;  2XVC A;  4I02 A;  3LYX A;  3CZ6 A;  3MKF A;  3HSR A;  1YIJ I;  2VL8 A;  3PJR A;  4OAY A;  1LKX A;  1T33 A;  1GHC A;  1OYW A;  2OW2 A;  2K27 A;  2E5Z A;  1D7E A;  1IDY A;  1YRN B;  5CGS A;  2RQP A;  3QWL A;  2LD5 A;  3N4M A;  1A31 A;  3LR3 A;  1OCO H;  4BXF A;  2XPU A;  1JJ9 A;  2YX7 A;  2XF5 A;  3LIF A;  2CQN A;  4L5J A;  2B02 A;  4XRS A;  4M4X A;  4WK7 A;  4U88 A;  3LR4 A;  1VQ4 I;  4YIR X;  1R1U A;  2G7U A;  1PWP A;  5FO5 A;  3DTM A;  2ZNZ A;  2WAE A;  1RP5 A;  4KMU X;  4HHD A;  3TJZ C;  1X3W B;  2F6C A;  1TWH J;  3FXJ A;  4UUS B;  2BXY A;  3SFI A;  3UO9 A;  1WA9 A;  3CMY A;  4QIW N;  3KO6 A;  4KZ9 A;  1R7J A;  5JLW A;  3OIO A;  3T50 A;  2V1D A;  3H5A A;  4PJJ A;  5HNH A;  2QQA A;  4XXR A;  2QM3 A;  2AXL A;  3CME I;  1AA7 A;  4XBF A;  4BBT A;  3DBH B;  5ICC A;  3M6H A;  4CGZ A;  3G1O A;  1HKT A;  1GV2 A;  3UKG A;  2RJQ A;  1W7P B;  4D7M A;  4RM2 A;  3IAM 2;  4B93 A;  4XOT A;  1TS8 A;  1RKT A;  2IWC A;  2BVM A;  1V55 H;  1XM5 A;  3RH8 B;  3DPT A;  3BFE A;  1WJF A;  1S0W A;  5KCM A;  5JI6 A;  2HYJ A;  1ZG6 A;  2J3T C;  2A5W A;  4E6K G;  3IRQ A;  1OT9 A;  4UB6 C;  5D3C A;  4RX3 A;  3C1D A;  1ES3 A;  4PKT A;  3MEX A;  3BEC A;  1YS7 A;  4LEN A;  3PM1 A;  4II3 A;  2KIQ A;  2MLS A;  4IUW A;  4C3H J;  3A01 A;  4UVB A;  2OV5 A;  3KEQ A;  5EG0 B;  1W0T A;  3ZCZ A;  1MKI A;  2H1K A;  1RM8 A;  4EW7 A;  2QKM B;  2VQL A;  2WOA A;  3IBR A;  2DJI A;  4K91 A;  4G8X A;  4YFN F;  3CKI A;  4N1X A;  1SAN A;  1C0W A;  3G35 A;  4I99 C;  1TD5 A;  1A0K A;  3E6D A;  3MFD A;  3BT9 A;  4IHX A;  1BLP A;  2GXB A;  3W4P A;  5DCF A;  3GSG A;  4DD8 A;  4DXB A;  2VKS A;  5J8C A;  3TL4 X;  1N9N A;  3LSR A;  2DA1 A;  2UZK A;  1FIA A;  2QWW A;  3W6K B;  4R3J A;  1D1B A;  2V79 A;  2IA2 A;  1JKP C;  1SKO B;  2KPM A;  3G42 A;  1T56 A;  1XG1 A;  1K4S A;  1JNU A;  2DI3 A;  3W2A A;  5D1T A;  1OM6 A;  4RQ9 A;  2LF8 A;  4GO1 A;  3ZMU A;  1X1D A;  3TO7 A;  3S1N J;  2E1C A;  2XFS A;  4Z2Y A;  4K0W A;  1G6O A;  1UMS A;  3Q2G A;  2EX2 A;  1ON2 A;  2UWX A;  2BHY A;  1XSV A;  2DA3 A;  2Y91 A;  1SMY F;  4WZ4 A;  1I2S A;  3HKZ A;  5FFX A;  3ABL H;  1RGY A;  3S7P A;  4PM8 A;  2VN2 A;  3PBO A;  2Z3Y A;  1MNC A;  3QOD A;  1HLV A;  1R5I D;  5L3C A;  1ACI A;  3QPS A;  2WB1 N;  4ZTK A;  3SJM A;  3S7N A;  4IRH A;  2E71 A;  1YMX A;  1D0Z A;  1J2X A;  1S66 L;  1PYV A;  3SDG A;  4LK0 F;  1V5F A;  3H9W A;  3BJN A;  1KGF A;  1ACF A;  2AHQ A;  4CIC A;  2ZFW A;  4XK4 A;  4EGZ A;  2XRL A;  1G6N A;  4AVZ A;  2ZM0 A;  1TS0 A;  1IJW C;  2QKP A;  4ENK A;  1W5S A;  3CDI A;  4N9L A;  3B47 A;  2PMZ N;  3REO A;  5DJU A;  1FP2 A;  2OW9 A;  2EV0 A;  5FD5 A;  1FYM A;  2BYV E;  3K3C A;  1AKH A;  1I5Z A;  2XKO A;  2KP6 A;  3RXW A;  5M19 A;  3FK7 A;  1Z1D A;  1Y8J A;  1F5M A;  2BAS A;  1ETO A;  3EUA A;  1OTA A;  2VBX A;  3MR0 A;  1VQ8 I;  4PKY G;  3GTJ J;  4ZTF A;  2ACJ A;  3V42 A;  2PBD P;  4D5F A;  2WKQ A;  2EX9 A;  2JA8 J;  1XC5 A;  1J9M A;  3T8T A;  1JVJ A;  3M6B A;  5HZH A;  5JR3 A;  1G68 A;  3Q7Z A;  2KFD A;  2M7B A;  2WAD A;  3KSF A;  2GA1 A;  3F1P B;  1E3U D;  3OYK A;  2JNP A;  5J7E A;  3PO3 J;  3E2L A;  1TDG A;  2Q8K A;  1Z3Y A;  3HLF A;  1GKC A;  5HDC A;  1YAX A;  2MZH A;  1EH7 A;  3DF8 A;  2ZMA A;  1L0O C;  1I3A A;  4QU3 A;  3WGG A;  2B5R A;  4UXN A;  2I9V A;  1K6Y A;  5AQ7 A;  2B9S A;  5JFR A;  3QP1 A;  3CCQ I;  3FXU A;  2E8J A;  2XC7 A;  3GRJ A;  1MGT A;  1KUI A;  2HDS A;  3T4S A;  2Y2M A;  1YSP A;  4DGW B;  2DW2 A;  2P7C B;  4B44 A;  4B1R A;  1NTC A;  1FPQ A;  1VEU B;  4CJN A;  2OY2 A;  3R4K A;  2HDD A;  1SVM A;  3HZJ A;  2PMH A;  3BR1 A;  2H5S A;  3ULQ B;  2VKD A;  3HUG B;  2M87 A;  1SFE A;  3W6J B;  4GQL A;  3LO7 A;  4A3F J;  2IPQ X;  2MC3 A;  2VB6 A;  4OLG A;  4JF4 A;  1HBX G;  2QSF X;  4X1L A;  4D9J A;  5C4J J;  4BL2 A;  1GT0 C;  4Q47 A;  2A68 F;  4B9O A;  4BJ5 C;  4I35 A;  3HL9 A;  2ERO A;  3DV8 A;  3G3Z A;  4M3K A;  2CRG A;  5LRS A;  2FOK A;  3W6V A;  1IYS A;  1HKS A;  3E98 A;  1FIK A;  1K55 C;  1R5H A;  4PGG A;  2INW A;  4S2I A;  1CJF A;  4ZYH A;  4BY7 J;  4HSR A;  5FFZ A;  4DBR A;  1B8I B;  4R8H A;  4WWC A;  4OQG A;  1G9K A;  3B02 A;  2COM A;  1U9N A;  4A3B J;  2HV1 A;  1ZR2 A;  3GTC A;  4HV6 A;  2JA5 J;  4IHY A;  1WGX A;  2WAQ N;  4CLC E;  1USS A;  1EUB A;  4X68 A;  3MXS A;  1T39 A;  3ELM A;  3H3V K;  3V39 A;  3UDX A;  5HLT A;  5JLX A;  3K2N A;  5IOZ A;  1IV8 A;  3MKW B;  3MSH A;  1WVR A;  1UHW A;  5E8I A;  2YU9 J;  5IYD J;  2K31 A;  2J9O A;  2QSH X;  3T1X A;  3X2Q H;  1JGG A;  1WSU A;  2EH3 A;  2OW0 A;  1VET A;  1CQT A;  2Q2E B;  4KT6 A;  2Z2M B;  2O03 A;  5L8M A;  4L0Z B;  4E70 A;  5HAP A;  1TW2 A;  2PMU A;  3T12 B;  3RYR A;  1FSY A;  1JGS A;  3Q07 A;  3N2V A;  3C5A A;  1CQR A;  2FV5 A;  3BQ8 A;  1QNT A;  2CUF A;  3SHF A;  4Z6Y A;  3G2B A;  1GA0 A;  4G3W A;  1P7I A;  1O3T A;  4AYB N;  3LCE A;  2J9P A;  3Q7V A;  5DTT A;  1Q1V A;  1LFU P;  1KU9 A;  2W00 A;  3DKY A;  4S2P A;  3DFG A;  2XSS A;  5DYM A;  2LR8 A;  4PSW A;  2KJC A;  3HJE A;  1MND A;  4LRX C;  1K7A A;  3I7G A;  4EUV A;  1Q2Q A;  3EGX C;  5DEQ A;  2FV9 A;  4Y4R A;  2AXT C;  1G3Y A;  3CCS I;  1U60 A;  3UDF A;  4A7B A;  5B5E C;  1QPI A;  4UEY A;  5FQM A;  4E6W A;  2HVQ A;  1JTG A;  1BI1 A;  4JP4 A;  1A04 A;  5F82 A;  2JPB A;  2ZQC A;  4NK3 A;  2L7F P;  3IS2 B;  4OH0 A;  4X69 A;  5HOD A;  5HSQ A;  4P85 A;  5BMZ A;  5CXW A;  4L0Y B;  5B5P A;  4E7L A;  2V4J C;  1U5T C;  2V8C A;  5LGU A;  1TWG J;  4L9V A;  4CZZ A;  1I5Q A;  4WMC D;  4UA7 A;  3TW7 A;  1DGW Y;  1V9Y A;  3CI6 A;  2DK8 A;  1J5Y A;  2C5W B;  2DFI A;  2CUZ A;  4WF0 A;  3DWK A;  3LNQ A;  2DJN A;  1KVM A;  3RDI A;  5DTK A;  2GDN A;  5JHF A;  4MFD A;  1ZH5 A;  1K57 C;  3C8C A;  3H9Q A;  3ABM H;  2ZME C;  3N8S A;  3J7A O;  1TF1 A;  1G2H A;  4ZR5 A;  2KT0 A;  1SAX A;  4JP0 A;  2DCE A;  5DUI A;  3BDD A;  1O3R A;  1E3P A;  2PDR A;  2QYB A;  2IA1 A;  4O01 A;  1R4M B;  4I39 A;  2XDM A;  3HUO A;  5ILV A;  2IJL A;  4AYK A;  4MN5 A;  3RKQ A;  4G7Z F;  3GFM A;  1Z3X A;  2V9A A;  4WX9 A;  2I10 A;  3V8J A;  3WV3 A;  4BKX A;  3RKX A;  1RNL A;  4F93 B;  3QP4 A;  3KYE A;  2X3C A;  3O64 A;  1WPK A;  1YT4 A;  3Q0U A;  1S6L A;  2HI3 A;  4UVC A;  4HOB A;  2FH5 A;  1MDM A;  3HHH A;  3DKW A;  4R1G A;  4S05 A;  2COB A;  3MMY B;  4A69 C;  3L00 A;  2ZC4 B;  2DA7 A;  1DUX C;  2OVX A;  4FCY A;  4EEP A;  4N9I A;  1CIZ A;  3RJU A;  3D5L A;  4AWX B;  1N78 A;  4UQI M;  4WMC A;  3CDL A;  2Y75 A;  2VJJ A;  2AQE A;  3I4M J;  2HJ9 C;  1JKQ C;  3RCO A;  5KSH A;  3EET A;  1CF0 A;  1X1C A;  3COA C;  1BR4 A;  1YQY A;  4HJ3 A;  4WCG A;  3HHG A;  3AGD A;  3UE6 A;  1R1T A;  2XHK A;  4RGX A;  3DEU A;  1BZS A;  1HFC A;  3SH7 A;  4IX7 A;  3KEY A;  3ERE D;  1N9L A;  2IS6 A;  2GM4 A;  1PWQ A;  1D0Y A;  5F1F A;  3F18 A;  4QKZ A;  5J6X A;  3HY7 A;  1YRN A;  3CC4 I;  2D01 A;  3BR5 A;  3MS6 A;  1OIS A;  4KN4 X;  4GNU A;  1E3O C;  4A0Y A;  4HY8 A;  5ICF A;  2O0Y A;  4PJ0 C;  3D5R C;  1C7K A;  5TR7 A;  2VIX A;  3MKY B;  1DDN A;  2ELJ A;  2ZLY A;  4GFB A;  4M74 A;  3ZG0 A;  2ZOH A;  4ZTJ A;  1G5U A;  3VE3 A;  4N4O B;  1T19 A;  2HP5 A;  2L01 A;  4AFI A;  4MFE A;  5AQ9 A;  3VYR B;  4LIV A;  1MZU A;  1ONG A;  3F8F A;  4XSZ F;  3OPH A;  4EAT A;  5EOO A;  3UE3 A;  4UUS A;  2P5L C;  2VLG A;  1TT0 A;  4BS9 A;  2P7J A;  3IF5 A;  2JHE A;  1EB6 A;  2R7Z J;  2W48 A;  2G2U A;  4M9X A;  2A69 F;  4QLC U;  2D1H A;  4NB5 A;  2FUG 2;  1AWC A;  1YYV A;  3CCU I;  3LI8 A;  4XR6 A;  1T0F A;  2CQX A;  1BKC A;  2B18 A;  1FR6 A;  1K54 C;  2KZG A;  5L07 A;  3BC8 A;  3MZF A;  3P1V A;  1JT6 A;  1W7P A;  3BP8 A;  3HTU A;  1HY7 A;  3IF6 C;  5FKN A;  2J3T D;  3NIA A;  4DF6 A;  3V3R A;  3LSM A;  2K9M A;  4EGY A;  3HKZ N;  1BI3 A;  4E3K A;  3BJO A;  1OS9 A;  4HNU A;  3RIR A;  5H8X A;  4PZJ A;  3ZMV A;  3BLY A;  4E7I A;  3O87 A;  3LSP A;  3L2Q A;  1U3E M;  5HWV A;  5AON A;  4XLN F;  3M8J A;  5F0F A;  3QYE A;  4DYQ A;  4FH2 A;  2W0N A;  4ZC3 A;  4WXD A;  4EJV A;  4E3N A;  2ZC2 A;  4JGO A;  3CCE I;  4NC6 A;  2GAU A;  4DE1 A;  5EG0 A;  3TSK A;  4FTX A;  5LFA A;  1S8N A;  3FX3 A;  3H9J A;  1ZP5 A;  2OA4 A;  4PKW A;  4G7O F;  1REP C;  2ICW G;  2R7S A;  1G3T A;  4XIC A;  3BFC A;  3P09 A;  4X53 A;  5FAT A;  3RTR A;  1OKR A;  4IVN A;  2VJW A;  2B63 J;  2DYR H;  1LFP A;  3DEE A;  4E3I A;  2OI0 A;  3J80 Z;  2R0Q C;  2O9C A;  1X58 A;  5GHZ A;  3J80 K;  2Y48 A;  4W1U A;  4A3M J;  2HZT A;  1SKO A;  4R79 A;  1Q3A A;  1EWZ A;  2FSW A;  2LKS A;  2MG4 A;  5EYR A;  2OD5 A;  3RYP A;  2JJ7 A;  3FM5 A;  3K70 D;  1VQK I;  3ZQH A;  2W3E A;  2QPN A;  1IDZ A;  3NDG A;  2Q9M A;  1JIW P;  1IN6 A;  4RLF A;  4HF1 A;  2K9Q A;  1CGL A;  1W8Q A;  4X25 A;  5D1U A;  2ELH A;  3E0J B;  4EJW A;  4V2F A;  1ZQ3 P;  5D5U B;  4PPR A;  3IX4 A;  2RL3 A;  1LL5 A;  2P5K A;  5GP9 A;  1STZ A;  4B48 A;  2PT7 A;  3F23 A;  2XK1 A;  5AVE A;  4I3A A;  4E7Z A;  3LIR A;  1KUH A;  2JVG A;  1OPX A;  3Q9V A;  4RA7 A;  2LK2 A;  1DGR M;  1PWW A;  4AIG A;  3AGE A;  2CGP A;  5FEG A;  4FE4 A;  1YPR A;  3FMQ A;  1NK3 P;  4HBU A;  2EK5 A;  3ZN0 A;  4GJ4 A;  3L1P A;  3FZV A;  3KHI A;  1TP4 A;  2VBZ A;  4BJ6 C;  2ZJ2 A;  1IYP A;  2JUC A;  2AS5 F;  2PJR B;  3P98 A;  4GGG A;  3HPG A;  1J7N A;  3GYH X;  1XCV A;  3ZQ5 A;  2OZR A;  3G6E I;  3VP1 A;  3SXY A;  1KU2 A;  3OOV A;  1SD5 A;  2MLR A;  1WJB A;  2RNJ A;  2CYY A;  2VZW A;  5HLG A;  4CZC A;  3QQA A;  1W63 M;  3TP0 A;  5CKT A;  1JE8 A;  4EEF G;  2DA5 A;  3HRS A;  1X3U A;  1V5E A;  3FDY A;  1Y28 A;  3VOZ A;  3IX8 A;  1GXD A;  4KIS A;  5IY5 H;  1H9G A;  3KZZ A;  4I3I A;  3KWV C;  1QPM A;  1XJ3 A;  3F1P A;  1XFU A;  4A0Z A;  3I54 A;  1WH5 A;  2EA9 A;  2NUT C;  4S2N C;  3FBI B;  1FR1 A;  1FIP A;  4JXS A;  1ZGA A;  3GLL A;  4HAM A;  4WXC A;  4LLO B;  1BR2 A;  4BBS J;  1B9M A;  3KX0 X;  3TVC A;  2G7H A;  4XLC A;  3TGN A;  1KQ0 A;  2BZT A;  3CC7 I;  2P74 A;  2DO7 A;  3EUK L;  2WO9 A;  5G18 A;  4FH4 A;  4OQI A;  2BV6 A;  2DCF A;  1VEU A;  3HRM A;  2P4W A;  2HOE A;  2QLZ A;  3HUG A;  1LJ9 A;  3EEH A;  2V9P A;  4ARZ B;  2VKV A;  3Q5F A;  2R5Z B;  1RET A;  3MZY A;  2MLK A;  1F9N A;  1BUL A;  1TTY A;  3WE2 A;  3F16 A;  5KHD A;  2JA2 A;  3G4P A;  5CTM A;  1LT0 A;  1MBL A;  3LUQ A;  3HB2 P;  2OUM A;  4KEN B;  1FBS A;  4BJP A;  1ZLJ A;  1NXY A;  3M07 A;  1D0X A;  3BTJ A;  2VEA A;  2F5D A;  3Q81 A;  4M9S A;  4KZ6 A;  1GCE A;  2KHM A;  2JE5 A;  1DPU A;  3UNG C;  3L0V A;  1H5X A;  4CLC C;  4IBR A;  5CZM A;  5IP7 J;  3G32 A;  4JK1 X;  4CCN A;  3DLL F;  4R3V A;  3F21 A;  3FF5 A;  2DK5 A;  2XAG A;  1QU3 A;  1ETQ A;  4EWF A;  2DOA A;  3DPE A;  2DFE A;  2XKP A;  1CF7 B;  3SOI A;  1GSV A;  1B8I A;  1K6R A;  5IYC J;  2L1M A;  3K4K A;  3U2R A;  4BBU A;  3MVP A;  2V26 A;  2VT3 A;  4IVK A;  1SD7 A;  1KDS A;  4HBL A;  3T1B A;  1AKL A;  1X4O A;  1FOX A;  2LRD A;  1KQ8 A;  3LEQ A;  4H82 A;  5DJT A;  2O99 A;  4OKP A;  4M6X A;  3N4I A;  3HB9 A;  1RCJ A;  5A2Q K;  4ESF A;  3TO6 A;  4JPA A;  1FT9 A;  2MBF A;  1FLS A;  1P92 A;  3DKX A;  4L5I A;  1YLJ A;  1Z77 A;  3OS1 A;  4HH2 A;  2EXB A;  5GAG J;  4RAY A;  3KZI C;  1ALQ A;  4HH3 A;  2Q2E A;  1ES2 A;  3E4Q A;  2GZW A;  4DPE A;  2EA2 A;  2CV2 A;  4CH7 A;  1ITY A;  1ETX A;  4WEL A;  2XR0 A;  3A1Y A;  1KZH A;  3AYK A;  1UFM A;  1ZK8 A;  4Y3O A;  4ENN A;  3GME A;  4BXU A;  1B9N A;  2M2E A;  1Y1V J;  2Y2N A;  3A0B C;  2CC1 A;  3DBA A;  5EGO B;  2ZKZ A;  3RXX A;  1SC7 A;  5GAH J;  3E6B A;  3IXG A;  3IWO A;  4LG3 A;  3V5M A;  9ANT A;  5HS9 A;  3GTQ J;  1OFC X;  1KGE A;  1W4M A;  1LSW A;  3CHW P;  1IC8 A;  5CHM A;  1UMT A;  4GRI A;  4KIB A;  1GHI A;  1XJ4 A;  1IYO A;  2DW4 A;  1OJL A;  1L0E A;  3IKV A;  2A3S A;  3LJT A;  1KA8 A;  2LKX A;  3CJR B;  5HDG A;  3CPT B;  1JAO A;  3FZC A;  4M9Z A;  3HOW J;  1VQO I;  2Y2Z A;  2E2H J;  3EDZ A;  1TS6 A;  4KIT B;  3SZT A;  3O3V A;  5DFX A;  2WYX A;  2UWM A;  5B1B H;  1G6A A;  3KE2 A;  2DQR A;  1KBC A;  4WEK A;  1R9T J;  3S17 J;  1BT5 A;  3IS2 A;  5EVE A;  4L9J A;  2DLL A;  4YOF A;  4L9T A;  5L3B A;  3KLN A;  3O88 A;  3GTP J;  3OR2 C;  1O3Q A;  3WE3 A;  4R38 A;  5DS9 A;  4HEF A;  2P6T A;  4XKC A;  4KQR A;  3RPU D;  1SLM A;  1XMA A;  3ZNY A;  4XRS G;  4JBF A;  2JA7 J;  1I50 J;  4NC7 A;  1D8M A;  1NRJ A;  1ULY A;  2RN7 A;  2X6W A;  5D5V B;  3IC7 A;  2C6W B;  3HTS B;  5DM6 F;  3R0J A;  1TNS A;  4AD9 A;  2ZO4 A;  2KRF A;  1N4O A;  5I5L A;  4P55 A;  1QUA A;  2LB5 A;  5EVI C;  1TS7 A;  1E17 A;  1NZO A;  5E3M A;  1JJ6 C;  3WTX C;  3FKV A;  4WBG A;  3K7L A;  2L0K A;  1ZRC A;  3S7O A;  4UQI S;  2QKL B;  3L2V A;  1IAD A;  1HW2 A;  2HDC A;  4UA9 A;  1QIA A;  2JRT A;  4XCT A;  5JVT A;  2JN6 A;  4WKI A;  2ISY A;  4BWI A;  1KON A;  4JGP A;  4BEN A;  4JX6 A;  3N2U A;  1WJC A;  1OM8 A;  1P4X A;  4ITV A;  4G7H F;  1JUS A;  5F6F A;  4PKS A;  4S2O A;  3A0R A;  4OU0 A;  3H3Z A;  2YPR A;  2KRH A;  2ZQA A;  3SZG A;  2OSU A;  3TDU C;  3U1K A;  2YS9 A;  3LSG A;  4IRG A;  2CMP A;  2QSG X;  2E5N A;  3P5J A;  3HOS A;  3WS1 A;  2LC2 A;  2V20 A;  1SFX A;  4X1M A;  4KG2 A;  1VFC A;  4KYW A;  4PKV A;  1YCM A;  4Y0O A;  1UTZ A;  1YLP A;  3FXR A;  4UUT A;  3FK6 A;  5A8B A;  1Y54 A;  3KP3 A;  2W24 A;