3DTIA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
243
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSLTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRRE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 73
structure length 243
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtiA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtiA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtiA01
3DTEA 3DTIA 3DTKA
chains in the Genus database with same CATH superfamily
4OAZA 1SD5A 2W12A 4D1QA 1LEAA 1FWZA 3W2ZA 2OY4A 2CG4A 2XKPA 3V7RA 4UA9A 2ZBBA 3LIDA 3GWZA 2EZKA 1NJ4A 1XFUA 3HOUJ 966CA 3BC8A 1LLBA 5BOYA 1BIWA 5CHUA 3Q0WA 1ZREA 3VE3A 4Q48A 3Q7ZA 5MC7A 5CQGA 2W3EA 5GHYA 1PZPA 2ZBKA 4OPYA 3IXDA 3F19A 3O64A 2KIFA 2KIMA 4EV0A 1Y4OA 4HOBA 3G34A 4C6YA 3RPQA 4E70A 1E17A 5DF8A 2WZZA 2F5CA 4ANJA 2W3DA 2MLSA 3K3DA 2F6CA 2CQ7A 4L0YB 1LT0A 2CW0F 1KU9A 2PI0A 1ACIA 1WRJA 1EAKA 3T4SA 3DLLF 4QU3A 1ZTUA 3PBNA 2ZJRF 2L1MA 2PJPA 2QEXI 4E3LA 1QPIA 4GF1A 3DTIA 2KHMA 3N4MA 2J9PA 3JRGA 1T1AA 3IF6C 3KEOA 2OAQ1 4OP8A 2K40A 1QGPA 2ZXHA 3DEEA 2QYOA 1YG2A 3MZFA 3OOUA 4BU2A 1F5MA 3IL2A 1TC3C 2JTVA 3Q9VA 3CCMI 1KUFA 4WK7A 1TTYA 3GFMA 2STTA 1J7NA 1UHMA 4IOCF 2HQAA 2MLGA 3TJZC 2BVLA 1DU0A 1SVOA 2X3CA 3NULA 3CC2I 5F69A 1Z21A 3HUNA 5E1XA 4U3TA 3H0GJ 3LIAA 5GHZA 4U7DA 1XKZA 2FSWA 4PJMA 2V6EA 1LUJB 2X6XA 3DPEA 4ETSA 1DQUA 1DJAA 3TO9A 2AYKA 4EM2A 1FYKA 3MBZA 4BS9A 1TW3A 4E7SA 2W25A 3ONQA 3W2VA 4HX4A 3HJIA 1TS0A 2J5PA 1X4PA 5M5WJ 1KE3A 3CHWP 2PD7A 2OCCH 3I71A 3M7GA 3LJGA 4E3JA 5AQAA 2XGEA 1TZLA 4H84A 3UB5P 2M4GA 2DT7B 3ZP5A 4CLCA 5LGUA 2CV2A 3CJRB 4KZ6A 4D2OA 3V42A 4CCKA 5M3FJ 2VX8A 1LE8A 2YUFA 1BQQM 2KIUA 2NVQJ 2JE5A 3I7GA 1HFCA 2HOAA 5D2BA 2VOPA 4DDSA 3A03A 3H5AA 3R0JA 5D6EA 3BJAA 2H8RA 1IAAA 3LILA 1BUDA 5D5XB 2H6BA 3KZZA 3QYFA 3M2JA 4XONA 4QHCA 3LQRA 5E2GA 2STWA 2QENA 5JVGF 5LBQA 5CKTA 1I76A 1FOYA 5FAQA 2V9PA 1MBFA 1C0WA 2COMA 3UB7A 3QODA 3PUBA 3VE4A 3KYZA 2FBIA 1P7IA 1ZLJA 1IFQA 5E43A 4PKQA 3Q3SA 1S3JA 2JRMA 4C2TA 1RIOH 3G1LA 3EQVA 4B4XA 1H9TA 2M1BA 3V39A 1NTCA 3L2VA 4Z1WA 2A6TA 2OZUA 4M3DA 3WGIA 4L0LA 5TGFA 5D3CA 1SU3A 2A68F 4IXAA 2FNPA 5FJ8J 5AVEA 1K78A 4A93J 1T1CA 1JAOA 1SLMA 3MKEA 1K55C 3O8GA 2V1ZA 3PM1A 3HJKA 4RAYA 1Y0UA 4XUZA 2L0RA 3OC2A 3ZQ7A 1TDGA 3IH9A 5EOOA 4XQFA 4E3NA 1TS8A 4BHPA 1CAQA 1JXSA 1N75A 3R7WA 5IP6A 3H1CA 3TP3A 2KQRA 3PO3J 1HZOA 3P9IA 3I5UA 4H6JB 2FE3A 2L01A 3VTGA 3AAFA 3HBRA 2P9VB 2EB7A 1K54A 5CPRB 4FE4A 4II3A 3J7AY 2DMUA 1FR1A 4PUSA 2P5LC 2J83A 1O3RA 2PRFA 4R6LA 1WH5A 5F5YA 5J3LA 2KX6A 4KIBA 2CFOA 3FIWA 2DW2A 5BPAA 4RQ9A 4K0WA 3PO2J 3GF2A 3LNQA 1LKXA 4OMYA 1FZPB 3EGDC 3V4GA 3ZGKA 5D5VB 1DU6A 1V5FA 3MA2A 1ORKA 1APLC 4UY8I 4H1QA 3T8TA 2AO9A 1Y28A 2PJTA 1QVTA 3ZN0A 3ZNTA 1K6OA 1ZG5A 2KLIA 3I64A 1D8FA 4XK4A 2IWBA 1LQ1A 4RMNA 2BXYA 2EFUA 3FBIB 4XM7A 1E3HA 2VE9A 3CPTB 1SANA 2XLNA 3UN7A 2Q9NA 1OO9A 1CGEA 3LQ0A 1YT4A 4LJZF 4E7JA 1LHYA 1AWIA 1FILA 1ONGA 2Y6DA 5HLTA 2OV5A 2ZMEB 1B1BA 4WXDA 4F7ZA 3RH8B 4H8RA 2Y2HA 1I2SA 4MTDA 2JIHA 1SC7A 4Y33A 3TQNA 3S7PA 1K4EA 3NEUA 2EWVA 1I1SA 2K5CA 2XK1A 3Q81A 4R1GA 1MMNA 4LK0F 3GFJA 1EJ9A 4D0PA 2JKGA 3TSKA 1FSEA 4NB5A 2TDXA 3WTVC 4XICA 1W36C 2IAIA 2WWYA 2KDKA 1VQ5I 4H76A 5BMZA 3CCLI 2Y75A 4LLLA 4A0XA 4IHTA 1MBLA 3H9GA 3G6OA 2Z3YA 4G7ZF 3DWBA 2WKPA 3WS5A 3V50A 4FXYP 2ZL1B 2EBIA 2BHZA 3EUHC 1X1DA 1OJ5A 2WUQA 4FUWA 3ZHHA 2R7FA 4II7A 2DMTA 1FIPA 5J8CA 1HW2A 1G2HA 4OPQA 2DN0A 4JQFA 3B92A 1K6RA 5EF6A 1DUXC 1BULA 4GHIB 2VXZA 3DBRB 1G5UA 4MFDA 3UPPA 3V7SA 2JBFA 3KP2A 4ZTFA 1KGFA 2XGCA 4DJAA 4EW7A 2KT0A 4PKTA 4DN0A 3QP6A 1YOVB 2O6GE 4V2FA 2V1DA 3JSPA 3SS3A 4DW6A 2FD5A 3BOQA 3OR2C 4AIDA 2AQEA 1PNEA 4FX4A 3JTGA 5GAGJ 2DMWA 1EA3A 3J81Z 2WBMA 2Y0SA 5F1RA 4HBUA 3VMAA 2VBYA 3KP4A 5KMWA 3CCUI 2OQGA 3J80K 3OPPA 2QLZA 4YINA 5EVIB 5F6AA 2X6WA 4IRHA 1VF9A 2Y4AA 3TRCA 4A0ZA 3IWOA 3EQUA 3IXGA 1GUUA 3HG9A 2EXBA 3G3ZA 2F4IA 2HPMA 1OMEA 1HLUP 4EESA 5F1JA 4E3OA 3UMEA 1V55H 1VEUA 3I4PA 3BLSA 3CLOA 2VODA 2NS8A 3D72A 1RMZA 1XM5A 3LIKA 1I3QJ 4OPZA 2CQXA 2E60A 2LDUA 3R6SA 4R3BA 1RM8A 4CLCD 2M4KA 3Q2GA 1K79A 3DTMA 3BQYA 2ZM0A 5J8XA 4PFOA 4DJ2A 4QB8A 4MNRA 3ABKH 5K7ZA 1B9NA 1IAEA 1I27A 2PYPA 1TL8A 2VPLA 5E3LA 2WV0A 3RJPA 3C7UA 1R00A 4M6XA 3EEAA 3PIPF 1KONA 3DV8A 5DCMB 5CZMA 3T1XA 2VJWA 4IOAF 3GSGA 1MBGA 4KG6A 4MQVA 4BMWA 5CVJA 5FA7A 3E2LA 3AYUA 2HTSA 3VYRB 3CF2A 3C8CA 1E3UA 3F1NA 1SRPA 4DE3A 4LD5A 2P7JA 1QPMA 3T1SA 1FLSA 3LEZA 4LV3A 2HOEA 3LR5A 1O0QA 5E8GA 5BOXA 3GX4X 1HSJA 2Y2JA 3LMMA 1IUFA 1ZK8A 5TR7A 3H35A 4ARZA 2KJCA 5FROA 3WTWC 4HH3A 3LUNA 4XCTA 3N05A 3WS0A 1MJBA 5DF9A 3MR0A 1NH3A 4HNUA 4FHTA 2WGVA 1AF0A 1OYYA 5F82A 2F5FA 2CV0A 1ZXCA 3FM3A 1Z67A 3WGGA 3DBLB 3JPUA 1MMPA 1K7AA 5AQBA 4V19K 1BLHA 3GMEA 3T8RA 1FOXA 3GFLA 1FYMA 4OONA 4IHXA 3BLYA 3RSNA 3CUQC 1V54H 2GLOA 4UXNA 1FMVA 2KPMA 1FCOA 1ETKA 4HESA 3HUOA 3RQIA 3BROA 3AGEA 4O6JA 1S1YA 4KISA 1G3TA 2V1AA 1YHQI 5CYVA 2IXSA 3ZFZA 3JR9A 1FJLA 4IQJA 2Y48A 2O9BA 1I6HJ 2QGUA 2J8YA 2IVMA 2BW3B 1K83J 1XGIA 4QWQA 4KZ9A 2ZC6B 2RDPA 3NHQA 3V67A 2DQLA 4W97A 2PJRB 4AC0A 3CCSI 1MC0A 1ZRDA 3BEBA 1GHCA 4UHUA 2XDVA 4LRXC 2XF3A 4P1WA 2OV7A 2MC4A 4OKPA 2V9VA 3HXLA 3O8HA 1DP7P 3DPUA 4XKVA 3CC4I 3F1AA 4AD9A 4Y5FA 3ZQFA 5BQTA 3K2AA 1T18A 4L9FA 1WPKA 1HW5A 5CGSA 3OYFA 2OUMA 4A2UA 1KZHA 3HRMA 3U1DA 2DAOA 2ZC3B 4HQMA 3EWJA 4GQLA 2ZMVA 4Y2FA 3F18A 4JF5A 1BSGA 1PWPA 1YTYA 1HVBA 2E7WA 2O0YA 2XSSA 5EZHA 5U47A 2XS3A 3FKWA 3FDYA 1GE7A 2G0EA 4Q5SF 1HW1A 4A0YA 2INWA 5EVEA 1C3BA 4S2NC 3LE9A 2LRDA 1OT9A 4MGRA 3E5XA 1U8BA 2EX6A 4NXFA 2NUPC 456CA 4NXEA 2FQ3A 4PM6A 1AWCA 2QA4I 4GYGA 4OVDA 2B0LA 3S2HJ 5DFYA 3KMEA 1ON1A 3P9KA 4HBTA 4EJOA 1KGSA 4HOIA 2LB5A 1ETOA 4M3KA 1OTEA 3AG3H 4M73A 2A24A 5HZHA 3SS4A 4LPZA 4CZZA 3AIGA 3EUHA 1JK3A 2CUJA 2VLGA 3JVUA 4E6WA 5DTKA 4XORA 1PWGA 2R9WA 5HDNA 4L18B 4IRGA 3G5CA 2PAVP 3HTUA 3HBUP 3G32A 3V7CA 1HBXG 4JP4A 3AL0B 5LLQA 5B1AH 1QMEA 5LGTA 4JLFA 1O07A 3HUMA 2E71A 2K9MA 1CQAA 2DOEA 1IRZA 1SD6A 5F6FA 2LBFA 3LFUA 3MZ8A 3Q7VB 2VKEA 2ZQ7A 2E2HJ 4CGZA 1U5TA 3KSFA 1T2KA 3VSKA 1A31A 4UUSA 3GTCA 3IKTA 2JCHA 3FWLA 2OW1A 2KRJA 3LOCA 5FRMA 1WH7A 3SH7A 2R7QA 2OQRA 3VOZA 3MWMA 5IT5A 2ZXJA 2DOAA 4N9HA 1FP1D 1OJGA 3BY8A 2GIVA 6PAXA 4UQIM 4Y17A 1DRMA 2LLKA 4BHBA 1QMFA 2PHYA 2ME0A 3A1YA 1GLNA 3MSHA 1Z3JA 1S7EA 3EHXA 2V6CA 3ZNYA 4JF6A 2W0NA 2A69F 2VK3A 4BYYA 3FMRA 1AHDP 1JKOC 1N4OA 2Z16A 5EG0A 2YR2A 3U1KA 4KQOA 4FETA 5BPDA 2O36A 4NC6A 1PP7U 5K5OA 3O3VA 2EQRA 1FTTA 4BKXA 2WY8Q 3BYDA 3KEYA 5D1SA 1N9BA 1YLWA 3TS4A 1NLYA 3X2QH 3SJMA 4GXOA 4O01A 3LMCA 1I6XA 4M3EA 1FPQA 3HL2A 2W1TA 2HDDA 2XRNA 4ETZA 2CFXA 2YS9A 3HM5A 1KUHA 4MNUA 2Y55A 1W8YA 2I5UA 2DOFA 4N0BA 2NUTC 4XN3A 5I12A 1UMTA 4PM5A 1MBHA 1RI7A 1K57A 1P4WA 4NETA 2M30A 3EHYA 4IVIA 1V3FA 1U3EM 5FLVA 1JIZA 4JKTA 1MH4A 1P9QC 1FTZA 4CYCA 2PDRA 2YIGA 3KP7A 1JNUA 1FCNA 3SFIA 3VP2A 1E3PA 2JVGA 3PHYA 1GO7P 4HX3A 3DKXA 4JP0A 2AHQA 4GUYA 3L1PA 3ABMH 3CP2A 1S4BP 2HP9A 1XMAA 3H3ZA 4X1EA 3ERED 4S2MA 1EWZA 2YX4A 4B8XA 3HYGA 3VP1A 5B5PA 4ZZDA 1OTDA 1A0KA 1NZUA 3IX8A 4I39A 1V9ZA 3GTPJ 4LRZE 1M1EB 1GHMA 3BFDA 2J7VA 3TSGA 3BG7A 5L3GA 1T08B 2K9CA 2O61A 2FBHA 2JA6J 4DXBA 2XASA 1GSVA 1I2WA 2ZMAA 3HLEA 3E6MA 1MBJA 2JUGA 4X68A 3GDIA 3W6JB 4GS9A 3UVCA 5M19A 4BE2A 2VOOA 4KN7X 4YWZA 5M5YJ 3LUQA 3I4MJ 3OYKA 5EV0A 2KRCA 5FKLA 3JAMK 4XIDA 5GLAA 1K56A 4N1HA 2NVXJ 2HEOA 1IXRC 1WJFA 2DDFA 4CSWA 1MWSA 5D8KB 4HV6A 3GZNB 3WU1B 4DPEA 2K9LA 2OZ6A 1IGNA 2V2FF 5J1YA 2O8KA 3LA2A 2DLLA 4XOTA 1C8TA 3N97A 3HLBA 3G42A 3RPUA 3S1QJ 1H0MA 3WGHA 1T0FC 2XR0A 3SEZA 2VQLA 3ZRGA 3S1MJ 2VQHA 3FG8A 2M7AA 5HDCA 3OYHA 3BR5A 3HLDA 2E5ZA 2K2NA 3MXRA 3B8ZA 5FLXK 2DJIA 4QIWN 1XDSA 3UPOA 3UE0A 1GHIA 4EV4A 1G68A 5EM1A 2D1NA 5K7HA 2HYJA 4E7ZA 2DT6A 3BTCA 1CQTA 1XCBA 2GQQA 3Q5FA 3IT9A 3KE2A 4UV8A 4C75A 3HB2P 1KU3A 2ZJPF 3GRJA 3OZHA 4S2NA 3KHIA 1PWDA 3F6VA 3ZMDA 1N9OA 1W36D 2FQ4A 2GDNA 1R1IA 4JA1A 3C3WA 1JJ9A 5HS7A 1JWPA 4BBRJ 3SQNA 3F1PA 1VM1A 4HYEA 2YKHA 1LB2A 2Q8KA 4A3DJ 3T4QA 4I7HA 4N92A 1T8IA 1MKIA 2EFXA 3OIPA 4M74A 2IGMA 5EGOB 2JQ7A 4AIHA 1JTXA 1BC7C 5FEFA 1OM7A 3FISA 1IC8A 3LJZA 2VE8A 3PNVA 3SHFA 3W2WA 2PBYA 1MDMA 3S7NA 4ZAMA 3G35A 4S2OA 1W1WE 2Y79A 2OXUA 1J75A 3T1BA 2ZM8A 2EV6A 5DM7F 4D7MA 3HLCA 1JKQC 3Q2HA 4EJVA 1JHFA 3TMOA 4PMAA 1K6YA 2PYRA 2WKHA 3TW7A 1TWFJ 1U8RA 2CLTA 3M8EA 3Q0VA 3JSOA 3QYEA 4BACA 1RNLA 2POJA 1X1AA 1T39A 3MXSA 3ZR8X 4D9JA 5KZHA 2ZQDA 4FSFA 5KAIC 3F0CA 3KWVC 1KU7A 2H94A 1QBJA 2V8FA 3IWFA 4IVNA 4IRIA 4ENKA 2DNSA 3IRQA 2Y8HA 2KDZA 5DUIA 4P85A 3HTSB 3JRDA 1FQGA 5DYMA 1SFEA 1D8MA 1S5LC 1AKHA 4ZDPA 2X51A 2KOIA 3F17A 3FXRA 4XT2B 3P01A 4NNJA 4G6DA 3ZMTA 4FT8A 4OLGA 5K5QA 2R7ZJ 3C1DA 2VUMJ 3LICA 3H9QA 1KBCA 3FYZA 1PWCA 3LY4A 4G7OF 2VGJA 3SDGA 1PWVA 2X85A 1CF7A 2IGOA 1CXVA 1JJ6C 2G2UA 1JJ8C 1Z7UA 3PYPA 4RVAA 4HI4A 3PXPA 2CU7A 2CGPA 4M72A 1FT9A 1BIAA 3LJTA 3NOUC 4UVCA 1O57A 2ZO4A 2FU4A 5FQJA 4N4NB 5D3OA 1O7FA 3K70C 3TE8A 1XJ3A 3OYIA 3OWTA 3BJ6A 4OAYA 3DNGA 3I54A 4GWNA 4F3LA 1L0EA 3OSFA 3BY9A 4LCMA 1BR2A 3WTXC 2P7CB 4UVBA 5DKLA 2L7MP 1SMTA 3F1OA 2BVMA 3GLXA 2VPRA 1GXDA 2QSGX 1PRQA 4YNRA 2H1LA 2ZJQF 4CUGA 1CQRA 3RKXA 1YQSA 4WBGA 4HDVA 5GAEJ 2OW2A 4A3EJ 2DA2A 4C2UA 1XAXA 2EA9A 1YKDA 3Q1FA 3K2ZA 4DZJA 4D5CA 4OQIA 3LCEA 3K10A 3UDIA 3S4XA 3E6BA 4HX7A 3MKYB 1ES4A 5JYOA 4S04A 1J09A 4BLMA 2O9CA 4BDYA 3KX0X 4M6VA 1TS6A 3LA3A 3BR3A 2AXTC 1XJ4A 3LI9A 3WV1A 4Y3OA 1LSXA 4QWOA 2DW1A 1UGUA 2ZCWA 3FBNB 1RZ4A 4Y0TA 1CGLA 1F43A 1MMAA 3I0TA 3U4LP 4CO8A 1ZYRF 1BBYA 1S4RA 5E17F 4FCYA 3IAS2 1IN7A 2OVZA 4X56A 1GV2A 2PMZA 4R8HA 3H9WA 1K7IA 1YLJA 3T1QB 4DNCA 1Z1DA 4EEFG 3VP0A 2V9AA 4E7IA 1WJBA 2DT5A 4IPAA 1KYZA 2DPDA 2OU2A 3HSFA 1RUOA 3M6HA 3VI1A 2L7FP 4OIOF 5IOYA 3A0RA 1SVMA 4OH0A 3LSTA 1YPRA 5FQKA 5IP7J 2F4MB 2CQNA 2UWMA 3MVPA 2LKPA 3HOTA 2DDAA 1QA6A 5AJGA 4ID4A 3FPVA 3BR2A 4A3CJ 1U9OA 5L3CA 3T4LA 1MMBA 1R9TJ 3A01A 2Z2LB 3WTTC 5FATA 5J8FA 2Y9ZA 1RESA 1LI9A 3CCEI 4QPRA 4UHTA 4E4HA 1XX5A 4CCMA 2W14A 5E2HA 2PX9A 2O3FA 4Q0JA 2W0DA 2D1HA 3VP4A 4HSRA 5CHMA 3RPUD 2DW0A 5CECA 3W4OA 4U87A 3CI6A 1N78A 3CAXA 1T56A 3T50A 2MYSA 2B02A 4F94A 1YITI 4PSXA 1SMPA 4WCGA 4PCQA 3MKWB 2JNPA 4WF2A 5KSHA 3ZVSA 4JGPA 1Z0XA 4R4SA 2MZIA 3OYDA 3S32A 2GNXA 2H10A 4FOFA 3J7ZI 4UUVA 5F83A 1KVLA 2ERQA 3I7JA 1LE8B 2VQGA 4GR3A 4WEJA 2P08A 4QY5A 2HNHA 4GO1A 3LR4A 4ZJ2A 2W7NA 4C3JJ 4C30A 5HDGA 2VLAA 2HDQA 3K3CA 1MMSA 4Q0HA 1JUPA 4I6ZA 2GBYA 5E3MA 4NKPA 1YP1A 3C5AA 5KHDA 2VBXA 3M8FA 3IWZA 4RA2A 2HYGD 3OPLA 3GFIA 4GD8A 4JXVA 3HL9A 3D5SC 2Y9YA 2MH9A 2Y69H 1ZGWA 4IHWA 4W1UA 1VQ7I 2E1CA 2EX9A 1DP3A 2CH0A 1W7PA 1AOYA 1CK3A 3UDXA 2ZMEC 4RBOA 4AU7A 1VB6A 4KZ3A 5HS9A 4YRVA 1AXBA 4IKFA 3RYPA 4AIKA 4GOGA 2WKEA 4MO7A 3PIOF 1K78B 5A91A 1R7JA 1TVIA 5D1UA 3QPSA 3T4KA 4ENMA 2CC1A 2XGDA 2LY2A 3DU5A 3S3OA 4MEYF 4AUXA 3O2PE 3ZQLA 4P87A 2K7LA 3A0BC 3R7WB 1J2XA 5HAQA 2OD5A 1FBLA 1YW7A 5FD5A 4JGOA 4G6QA 5CERA 1MBEA 4PM9A 4I02A 4IEJA 1ZRFA 3K4JA 3E0YA 3M07A 1N9NA 2PMHA 5FQMA 3B6AA 2V26A 2B9SA 2M5WA 5F27A 3BTIA 1JWZA 1P9RA 3W2AA 4OLDA 3HOVJ 1ZR4A 4OIQF 2DPUA 1PI4A 3SEQA 1WFXA 1W79A 3WE2A 5IS1A 3OR1C 3MQ0A 1WCMJ 2XFSA 4XLEA 4LB6B 3ZOBA 2RJPA 4PFPA 4HAMA 3DLAA 4PKYA 2VJIA 4LV1A 2QSFX 3DBHB 1TVFA 1GXPA 5B5EC 2LK2A 3ERMA 4HSTA 1YSQA 2DA4A 4BJTA 5FLXZ 4X0GA 1H8MA 2ACJA 1YSPA 1KGEA 1R4NB 3MKFA 3MFKA 2EV0A 5D6FA 4BXUA 5HOOA 2BY1A 3L7HA 4Y3IA 3DP7A 1OTIA 4R3VA 4F52A 1RR7A 5HAIA 3RKQA 1BI2A 5EVIC 5ILSA 2X0LA 4HV5A 1F36A 1YW8A 1G3YA 3P1VA 3A0HC 2UUZA 1NZOA 1A35A 2XSDC 1D5JA 2YB9A 1R5HA 2BTFP 1JVJA 1L6JA 4A3KJ 1L0GA 3KEKA 2H6CA 3LEQA 1GA9A 1KYWA 1FM1A 3I9V2 2L02A 4CA0A 3ZG0A 5E1WA 4KT5C 1EF4A 2I72A 1QNTA 2USNA 4MTEA 2FH5A 3Q0UA 1J3WA 3GV9A 4N9LA 1USSA 3BZCA 2QPNA 4XM8A 4DIQA 3QNCA 1K4TA 3MD2A 3ZG7B 2YU3A 4H2EA 1ON2A 1JUSA 4I76A 2Q0OA 5FSRA 3CO7C 4IHVA 4OQHA 3V96B 5J4VA 3OHLA 1S67L 4RB0A 2E2DA 1Y56A 5CTNA 2M0MA 2XQZA 4DE1A 3FMSA 4HH2A 5I43A 3OPHA 2O3EA 2DU9A 2YU9J 1MZUA 2FMYA 2K02A 5M5XJ 4RA7A 4IO9F 5KCMA 1T1BA 3QYBA 4HW0A 2IGKA 1S7OA 1D1CA 2EWNA 2IW5A 3RDIA 1TWCJ 3PQKA 1C3IA 1R71A 3IH2A 4GN2A 3WHCA 3M1EA 1DMTA 1FBUA 1JE8A 2GIZA 3S22A 4G3KA 3MFDA 2KP6A 1YIOA 3QP2A 1UFMA 2ZOIA 5LHGA 2QM3A 4H4KC 4HBLA 4ON0A 2VEAA 1YLPA 2CRGA 5IY5H 2MD5A 2L4RA 4IHSA 2QQBA 3RI4A 3FX3A 4G8XA 4AYBN 1ZG3A 2IA1A 2DK5A 2GX5A 3LK8A 2WAQN 1BR4A 1IXSB 1RCJA 1FSYA 1HY7A 2CW8A 4A5RA 4ESJA 4EWFA 4NXBA 4A3BJ 5CVUA 2FA5A 5DFXA 1O3SA 2R92J 2QYBA 1ZR2A 2QPJA 4Y7NJ 3IXHA 5J4YA 1X3WB 4MHGA 1ES5A 2IWCA 4Q8IA 2CW7A 1OCTC 3A3DA 3G4PA 4KFCA 4OQ0A 2J3WA 2R7SA 5EECA 1ZHFA 1XGNA 2QQ9A 1KDSA 1H71P 1YJWI 1VQ6I 1HTDA 3HDBA 2IS6A 5CXAA 1FBSA 2VJ5A 1QHHD 2MH2A 3MN2A 4E7LA 3K4CA 2HZ5A 2K4JA 3QWLA 1Z09A 5DCFA 4Y7PA 4U7BA 1HQCA 1F98A 1WZ2A 5EEAA 2MJ6A 3UPNA 3GEZA 3ISGA 2N8GA 3HB9A 3A3FA 2XAFA 3ZMZA 1PYVA 1D8JA 4OU0A 4WKEA 2QWSA 3F72A 2LMDA 4WF6A 4EU0A 1XA1A 2GZAA 2FMLA 2F4OB 1ZTRA 4XR6A 4BQNA 4OPRA 2XB5A 3RKYA 4B4ZA 1L0DA 1SKOA 1ZVXA 4LLGF 3F1NB 4EGYA 1F9NA 2HVQA 1STZA 3ZQCA 4IZZA 3L09A 3OYBA 2V7FA 2V1BA 1KQ9A 2UWXA 1ZGAA 3EDGA 3LSKA 2A3UA 1ZH5A 1OQYA 5CEBA 4Y0OA 1YJ9I 1EUBA 5HVQC 4WZ5A 2JKRI 2V8CA 3S15J 1ZELA 4L63A 4OWRB 4KIGA 3SDBA 4A6EA 2BYVE 4ARZB 3ZN1A 2JA2A 3CQZJ 4DE2A 5EEHA 1BKCI 4NC8A 3KO6A 4EQIA 2EK5A 4B4CA 3BTLA 1MGTA 3ELMA 2X1CA 1P6RA 1K7QA 2F2EA 4LB5A 2GXGA 5E3NA 2HQRA 4C2MJ 2E7XA 2P5KA 3DU6A 4I3IA 3LR0A 2J5OA 3ZCOA 2ECCA 1YRNA 1J59A 1G6AA 1HCRA 3LQQA 5C3EJ 1IDZA 5ERIA 2FFYA 2RVCA 2BY3A 5FDHA 5F0FA 3IH8A 4FU4A 1J9IA 3S3MA 4EJUA 2HQ5A 3WU0A 3QOPA 1HA8A 3IS2A 4HP9A 1XFNA 3IX3A 2WGIA 1QJJA 3S17J 2ZLYA 3JCUC 3J81K 3ZQQA 2BY0A 1Z6RA 3IRRA 4HQEA 4DKIA 3PNYA 1ERMA 2R4GA 2W82A 3IWIA 4GHIA 3O88A 1U2WA 3WG9A 4IL6C 1OMJA 3BQAA 3AL0C 3PBTA 4MN5A 4B09A 4GNUA 3TBIA 2X6OA 4GZBA 3SZTA 1WKMA 2JT5A 5HDKA 5EZGA 2NVUB 2HP6A 1U6GA 4S2PA 2HYFA 3H7WA 3LSHA 3K70D 4PZJA 5GPAA 3WWXA 1OR7A 2OF7A 2M3AA 1S6RA 3UB9A 3S3NA 2EILH 1K38A 2MSYA 1WJCA 2W13A 3NDEA 2MC3A 2ID6A 2DTZA 3G71I 1EROA 3FHZA 1ZRCA 3E5UA 4HP4A 4FXQA 3QHYA 1ODVA 5G18A 1HKTA 3K7AJ 830CA 4YFXF 5GL9A 4R4RA 1VHMA 3CDIA 2E34A 2DMQA 2WOAA 1HOVA 3DTEA 2OY2A 2PG4A 3FMQA 3TEDA 1BA5A 2PLYA 1OYWA 2W15A 2SRTA 1X4OA 3IHAA 1HF0A 1BC8C 3UNGC 3WRZA 1O3QA 5A92A 1MMRA 1ESUA 3H3VK 2HDCA 2JZYA 5KNLA 4KQQA 2FX0A 2O7OA 2M45A 3TT4A 3SOIA 4UA7A 3HRSA 3CO6C 4ZYDA 2E8IA 2ID3A 2X71A 3JREA 1GXQA 4AM3A 3TP0A 1R4MB 4JXSA 1JTGA 2QWWA 3TDUC 1LSWA 1KQ8A 3C2BA 4E6KG 1SKFA 2A24B 2IT0A 1B59A 5IU1A 2EFNA 5CLSA 2F48A 1IJWC 2EFWA 1S1ZA 3IWQA 5FI2A 1R22A 1IRXA 2DQRA 5JLXA 4O8GA 5GLBA 1YX3A 5TGTA 4RAZA 4OIPF 4LRYC 2CUEA 4GDBA 4HJ6A 1RKWA 4A5MA 5DS9A 5L3FA 5FI6A 4MN6A 3F8BA 3E4OA 3L2CA 1ZTQA 1Y0NA 1SATA 2X48A 1LL9A 1KVMA 2MA3A 3AG2H 2LBFB 3ZG9B 5LHIA 1QIBA 1YQYA 4YFMA 1U5TB 1ITYA 3FV7A 1Q2QA 3R0AA 4YG2F 1TQMA 2Q1ZB 5B3SH 1VQ9I 3IHBA 1X58A 1XMXA 3JRCA 1QRYA 4KNYA 5I3MA 4NHJA 2K3PA 1D8KA 3PBQA 3NIAA 5F1GA 2R5YA 3ZXHA 4ZRRA 3ZVWA 1U0JA 3O3KA 1MNDA 1R5GA 4B3AA 5HWTA 3BPVA 3BZ6A 4G12A 2OAZA 4CDGA 4EBLA 2Y0MA 1HFSA 4XOPA 4ZJ1A 1D0XA 5EG0B 4AVZA 1TWAJ 4ABZA 1HXDA 2XH9A 4LITA 2ACGA 3VOLA 2W3HA 1PUEE 3G73A 3ECHA 4ZR5A 1XUDA 4WUJA 4EQ1A 3VOYA 2JSPA 1MMQA 4E7KA 2BW3A 1BLPA 3HGGA 3LSJA 3NOPC 2C6WB 4FD8A 2QF7A 1IAWA 2JKTM 4ZC3A 4R1HA 5JR3A 1UZCA 1XDUA 1ND1A 5B5OA 4KMUX 2L0WA 2XAJA 3JVVA 4XM3A 5FQ9A 2BY2A 3BG6A 1HV5A 3HSEA 3DPTA 5A2QZ 2ZB9A 3UE1A 1B6AA 1N9LA 3Q9SA 5K1YA 3REOA 4KZ8A 3L2WA 3RZDJ 3CWFA 4M3BA 1XA7A 3VWBA 3I55I 3N2VA 2DODA 4RS8A 3WHBA 1XCVA 3N4IA 2JA7J 1HLVA 3GBOA 4WN5A 3BG3A 3A02A 4ESBA 2XAGA 5FFZA 2OWHA 5H6QA 4L7AA 2K85A 4CCOA 1JGSA 2DDBA 4HF2A 1YIJI 2QVOA 4PJNA 3MS6A 3F16A 1ACFA 4EERA 2NOGA 2Y59A 1OKRA 2QKMB 1GCEA 3E4QA 4EGZA 4GD6A 3UNWA 2EROA 3CC7I 1LI0A 1OMIA 3DF8A 2P04A 2RKHA 4G7HF 1A86A 2NNYA 3V8JA 3EYIA 3C7VA 2Q9MA 3KSGA 3OS1A 3UE3A 2M8EA 2XROA 1BW5A 4PSWA 5GP9A 2VN2A 5E79C 1H3QA 3CMZA 3FZCA 3AG1H 1OLTA 2V4JC 3FXLA 2VKVA 3D0SA 2M7BA 5L07A 3H92A 4KIFA 3K4BA 1U60A 3F8FA 5E3OA 1EV7A 2VBZA 5B66C 2QZ8A 5C44J 5LFAA 3GTMJ 2A05A 3QP8A 2B63J 4OOIA 4GS9B 1K4SA 4RGUA 3K0LA 1BSWA 3WG7H 1KUIA 3TOAA 1OCOH 3NJAA 5DJTA 1HDDC 4KMFA 4LIVA 2HTJA 4X53A 2QMIA 3CMAI 3HY9A 2QKPA 1YLZA 1P9WA 1QIAA 2V1XA 3PUFA 2BV6A 2Y0SN 3FXOA 3WS4A 2JT6A 4MN7A 2P0WA 4UUTA 2HXOA 2VONA 4JK1X 3FKVA 4I5SA 2O99A 3DPFA 3GR2A 1W63Q 4R3JA 4HIAA 5TRDA 5KIZA 2VV6A 4RYEA 3KETA 1Z05A 1SEUA 1FBQA 4BBSJ 1TW2A 2XKOA 1BLSA 4MMNA 2ZC2A 2BASA 5EVID 2MFZA 5HL6A 4RLFA 1HDPA 3OYJA 3KPHA 4QLCU 1O7LA 4FQGA 2JT1A 1BR1A 3KLNA 1FMWA 2W3GA 4JGQA 4PAUA 1T38A 4DRTA 1ZKJA 4PKRA 3WRTA 3KSHA 2HZDA 4ZZLA 5FGMA 2DA7A 4IF4A 1BKCE 2LOOA 5M3MJ 1PW8A 4BQQA 3HSRA 1WVRA 5HD3A 1NG6A 4L9NA 1UELB 1UB9A 4B9OA 2HDRA 4HHDA 2N8RA 1JTDA 2FFFB 1CF0A 2Y30A 2Z6DA 3UE6A 2L2OA 2KDOA 3FXKA 4X1LA 2LD5A 2Y91A 5I5LA 3C7JA 5FDSA 3FWEA 1OFCX 3F1PB 4KZ7A 3KYQA 3HLFA 2OLUA 3F21A 1E3OC 1FSHA 4HJ3A 1IABA 1VFCA 1WJEA 3HVFA 2XAHA 1OJLA 4JOMA 2C6YA 1F4KA 5L09A 2UV0E 2VIXA 3TW6A 5JFRA 5D1TA 2MLRA 3HDAP 1ES2A 1S0WA 5ICGA 2O03A 2A49A 5L3DA 2P81A 1SD7A 4B88A 3IXBA 2G9WA 3IF6A 4RAGA 2O5RA 4LENA 2HZTA 2L0KA 2VQCA 4H30A 4ZJZA 2LY9A 4N9IA 2ZXWH 4AFIA 1J7KA 4WF0A 1QUAA 2YUSA 5I94A 2GZWA 2VASA 1GVJA 1HKQA 1D1AA 1UEAA 5HLHA 4HPQA 1I3AA 1WGXA 2P5VA 4RDUA 3L2RA 3NARA 3QQAA 5AIQA 2D1OA 3CD6I 3EQLF 2DO7A 2V1UA 4P6BA 1TQPA 3QRFF 3E3VA 2K9SA 5ICCA 5TBMA 4N1XA 4GDNA 1ZQ3P 3ABLH 5FQIA 4QY6A 1OCPA 1AKHB 1RGZA 1L3LA 4LFUA 4ESPA 3RXXA 2DXIA 1O0TA 3T4TA 1E2XA 1D7EA 5FFXA 3U9GA 5CHJA 2LYCA 1JGGA 1L2SA 5EEGA 1HSTA 1EH7A 4LG3A 5GADJ 1PWUA 3A3EA 4MDZA 2HKXA 4IUWA 4FH2A 1ULYA 1CF7B 4PJLA 3BWLA 5E20A 2EV5A 3EPZA 4JGRA 2VA0A 2RQPA 2MGQA 3VODA 3NAUA 2FZ0A 5IOZA 3D1NI 1S7AA 2D01A 4XMYA 1ZAOA 1F1ZA 1SZVA 2E8JA 1XSDA 4HX8A 4LLOB 3GMWA 3PL8A 4KYWA 5DD8A 1RKTA 1CEFA 1T95A 1YFHA 4G0DA 2HVSA 2IS1A 3I3LA 4F3LB 2JRTA 1B8IA 2LSOA 3NDGA 3JRHA 4F3QA 3CJTB 3F1OB 4I09A 2PFBA 2ZQAA 2PN6A 3TOIA 3FPWA 1R36A 3OOVA 4NG2A 4NQWA 2YSRA 2FF4A 5EPHA 5EUAA 4YIRX 3GCMA 4UVAA 5CGXA 3D9YA 1ROSA 3VOEA 1IOUA 2O9LA 1XGSA 1BL0A 5KAFC 2IS4A 1K61A 2WADA 4MFEA 4K2EA 1REPC 3F15A 3HPHA 4NK3A 3HC7A 2UZKA 4JIJA 2UV1A 5DTSA 1W5SA 1S8NA 1DGWY 1I5QA 2LY1A 1GV5A 4DD8A 1XX2A 1OZ9A 1Y6IA 4BBTA 3LSMA 4B93A 3F8MA 1RR8C 5J1UA 2HGVA 4BL2A 5FI7A 1BM9A 3JRBA 1K55A 1XGOA 1DP6A 4CHUA 4DGWB 2M9HA 3FK7A 4B48A 4Z6YA 1S29A 1LSVA 1YLFA 2WB1A 4EETB 1MMDA 3PBRA 4BEHA 3UKGA 1V9YA 1IYSA 3MZHA 1IG7A 3AGFA 5EVLA 1R49A 2CSOA 4FE7A 2ECBA 1PI5A 3UB8A 3S2DJ 3K1MA 1B9MA 2A5YB 3OS2A 3RTYA 1LFPA 5L7FA 3USNA 2DA5A 1XB4A 4BH9A 5J1RA 2ISZA 2MW8A 4A69C 1Z6TA 2LKSA 4O3MA 1UTZA 2QJ5A 2H8WA 1MWRA 1IAGA 2KZGA 2TCTA 3O2XA 3ESWB 3S14J 3E2KA 1K0KA 3A01B 2OJED 3PSIA 4ENNA 5LRRA 4EQQA 2X1DA 1WI3A 3VYUB 3OIOA 4EMSA 1YYVA 1O3TA 1JANA 3KYCB 1AKLA 3VFFA 1B72A 1UG0A 5IYBJ 3NOTC 3CJNA 1DDNA 2COBA 1FOFA 4PKUA 4HRIA 4AYBA 2M1CA 1T19A 1QHGA 2YX7A 4AXQA 3VYSB 3QOEA 3TGNA 2MD0A 3U1RA 1LNWA 3C4PA 3ZYTA 1Z91A 4G94A 3F3XA 4CCNA 2D02A 4V2GA 1K54C 3H3UA 4DZPA 1ZXVA 5CQEA 4NXGA 1XTAA 4Q0IA 2KLOA 2B95A 3TO7A 3PSFA 2LF8A 3QPLA 1UMSA 4Z2YA 3TO6A 1CK7A 5E2FA 1J9MA 1YX5A 2H5SA 2D45A 1KDWA 1LJ9A 3EUAA 1QJIA 2X7MA 1GVDA 3ZMSA 3DWZA 2PBIA 3ZMVA 3U21A 1JAQA 2H1KA 2XF6A 3HLWA 4FTXA 3V5MA 2BHYA 2HOSA 2K27A 1UG2A 1IADA 2F5VA 2AIGP 2VJJA 1XS9A 3LGPA 4A3JJ 2HU6A 1QZEA 3KP3A 3BCBA 2HU9A 1NRFA 4GGGA 3WV3A 3DL1A 3GTOJ 3GXOA 2DCFA 2ZSHB 2EJRA 3V3RA 4BGDA 1WNIA 5LGNA 3HUGA 3B47A 3IP4B 3UO9A 1VI0A 1QZYA 1MD0A 3U2AA 1ERQA 2ZJ9A 2XPWA 4ZTKA 2BBYA 2L3DA 1UJ8A 1W7PB 5CEDA 1IELA 1ONHA 3B42A 4HDUA 5BOHA 2E35A 4BE1A 1V5EA 2XS4A 5K7FA 5ED4A 3BPXA 1YO5C 4A3MJ 5F08A 4ZYEA 3WV2A 3LIEA 2J0TA 2PU4A 1D3YA 2XAQA 2W4SA 3OYAA 3QPTA 1XC5A 3KMCA 1MMGA 3BG5A 4KA4A 2MG4A 2XGXA 4RAFA 1PZOA 1IV8A 1VQ4I 2OTJI 3SZGA 5TFQA 1EKEA 2XA7S 1TLHB 4I3JA 3LUMA 1VETA 2W57A 3DKWA 2DW4A 1KGGA 4MBFA 4BE0A 5HX9A 2LFBA 4CZCA 1TWGJ 4L0ZB 1XG1A 1HC8A 2YKFA 3COAC 4A6DA 3MF0A 5EJCA 2RN7A 1SVLA 2V79A 2MABA 5J6XA 3GO5A 5I0LA 3JTHA 1R6RA 3G1OA 2G7UA 1SFOJ 5IT9Z 2W84A 3E97A 4A5NA 2R5ZA 4XKBA 2IWDA 5L3EA 3SH8A 1W5CC 3NECA 3E6DA 1H8AC 1GKCA 3E5QA 5GHXA 1JKYA 2K9NA 2KZVA 4DE0A 3BJNA 3E98A 3IBJA 1D0YA 4K91A 4BL3A 4HLYA 3FZVA 1Y1WJ 3K7LA 3DW0A 3LSPA 5E18F 4A3IJ 2NXNB 4XM6A 3FF5A 1OCRH 1QQIA 3OYMA 5FLMJ 1CGFA 1S6LA 2M7UA 1OCCH 5J7EA 4C9YA 2HPBA 4CXFA 3QU3A 2MZHA 2R7VA 2LTPA 3W8KA 5J3WA 3NX7A 3E6CC 3R60A 3I58A 2OVXA 3LIRA 1ONVA 3OHOA 4M3GA 4GB7A 3L0TA 1BM6A 3OYLA 3N7WA 4QPOA 1S9HA 3AG4H 2WO9A 2KIQA 4B47A 2Y2IA 2O9AA 4L19A 1BIBA 1GDTA 4E3KA 1SHVA 1I73A 5FQQA 1WJDA 2NS7A 2EIJH 3M6BA 3DCFA 4XLHA 4BD1A 1FC3A 2EFPA 3HYIA 3ICYA 3ITBA 2HJEA 2FJ1A 4P96A 3MZEA 3ZUKA 4WM9A 3CG5A 3KFWX 1BI3A 3ZQIA 1GE6A 5JVTA 4KENB 3GZ5A 2ZFUA 5LBRA 2HQNA 4L9JA 5HL1A 1PVEA 3ZDJA 1Q3AA 2ZJ2A 1LDKB 2Z1DA 1LVAA 3DTKA 2NAZA 4OP5A 2CQQA 2KMUA 1YAXA 4HNBA 2R7DA 1BN5A 1BI1A 1G12A 4XLPF 1V4RA 2EPFA 1L0OC 5B1BH 3TOBA 1HOMA 3K4LA 1R58A 4XBHA 1XFZA 1YCMA 3CUQA 1I1IP 2IS2A 4DQ2A 2R78A 4I38A 3BP8A 3CP8A 1KAPP 3U2RA 4E3MA 5KK1A 3M4OJ 1BZAA 1G49A 4KJZA 4YELA 1R23A 3BQZA 2OWJA 2CV1A 1BZSA 2D1VA 2IP2A 5GPCA 2DCEA 3ITAA 1P97A 4XRSG 4Q1LA 2OI0A 4IN9A 4XKCA 4BL0B 1Y0VA 5DDGA 1JI8A 1Z77A 3CF5F 3HBLA 3IBRA 1ZS0A 3NRVA 4HMAA 1Z9CA 1RETA 4RM3A 5HWWA 5HNHA 2E5NA 3ASOH 3GBGA 2Y2PA 5FAPA 1QICA 1VTNC 3CTAA 1R54A 5G4YA 1Z7LA 2NOJB 3OIQA 4X1MA 3F6OA 3GYHX 4CH7A 3GUDA 4EVIA 3CUEC 3N2UA 3G30A 4EM1A 2UXNA 2XRLA 3J7YJ 4DF6A 1R1TA 2VT3A 2A07F 4MLOA 3DWKA 2QQ8A 1A6QA 1XSXA 4RB2C 1UMQA 1UCRA 3UDFA 3M2KA 4PKYG 4O0PA 2VC1A 5CUHA 3T1RA 2I47A 3K7NA 2W48A 3K1NA 3WS2A 4KUOA 5CXWA 3DXJF 4DXCA 4RX3A 5DUKA 1FCMA 4XLAA 2WV1A 4G3WA 4LCLA 1LPQA 1W4MA 2NVYJ 2PR6A 1RC9A 3GTLJ 1SKOB 1ES3A 2XD5A 1OPCA 1XGJA 1A5JA 4XKWA 3DWLE 1BJAA 2Q2EA 1XFWA 1OT6A 4XNFA 2DBBA 2MZEA 5JHUA 3SZPA 5L2FA 3ZQ5A 5HW3A 4EUZA 3S2WA 2H0YA 4FX0A 4AYKA 1PJRA 3HOWJ 5H20A 1Y8RB 1IO2A 3DEWA 4IJAA 2HDWA 2FXAA 3GZ6A 1G6OA 1BTLA 1AYKA 2ZC4B 2ZKZA 2WGWA 4UEYA 4IUKA 5E2EA 3RTSA 3EDHA 1W5DA 4WXHA 4GR8A 1XD7A 2ZOHA 5DVAA 1YRNB 3BTJA 3PJRA 3A3JA 1ZGJA 3R61A 1SFKA 4L9EA 2FUG2 3JW4A 1WQ2A 5LEJA 4F93B 3OYNA 4PPRA 1WHUA 5HARA 2PMZN 4L5JA 3LAPA 3H82A 1XFXA 3ELKA 5F64A 4M3FA 1MWUA 5C4JJ 3H5RA 3KEQA 3QNBA 1DY6A 1ZARA 2C5WB 3V3SA 1X1CA 4U0VA 1PUFA 3GTQJ 3NCKA 4UV9A 2X9DA 5DKKA 2QBYA 3B73A 2WO8A 1I1GA 3IS2B 2KISA 2V4BA 5FB2A 3CESA 3BY6A 2E2IJ 4F55A 5IYCJ 2FV5A 4X25A 2M2EA 4L9VA 2R7WA 5IT3A 1XUCA 1IUYA 2QSHX 4JYKA 2KL4A 3I56I 3WS1A 2VL8A 3UY6A 4WZ4A 5JLWA 2LVSA 2QJ7A 2HF6A 1XJ6A 5D4RA 5HDDA 4Q4ZF 1IYPA 1P4AA 1CGPA 1BQOA 2Z99A 1NK2P 3H7WB 2Z33A 4WL9A 1WSUA 1U5TC 1HKSA 3L00A 1YS7A 1F2KA 3CITA 1AA7A 2VGLM 4MEZA 3ABTA 5D5WB 3IC7A 2DFHA 3TVCA 4I0BA 3LKAA 4QD4A 2K4BA 2ETHA 3M3YJ 2QHKA 3T4JA 1JHHA 4KQRA 2JPBA 1NY0A 4WZVA 4LG0A 1JAPA 1AU7A 1P2FA 2H09A 1K6SA 2GOXB 1W8QA 1G3SA 1VQ8I 2H28A 1EH6A 4F92B 1YOUA 4OMZA 3W6VA 4EEPA 1OTAA 4I0AA 1VNDA 1DTHA 2M87A 4EBNA 1X3UA 3LSGA 1Y1VJ 4KZBA 1U9NA 4D5FA 2Z9OA 1YS6A 4EM0B 3FXQA 2WKIA 3OLOA 5L8MA 3NBLA 4P9UA 4LV2A 1O4XA 1XFVA 4BUPA 4KZ4A 4A3LJ 5FKNA 4S05A 2A8HA 1RPWA 4DDYA 2VBWA 4J19A 1X19A 2HVRA 3I59A 1YMSA 1ZKGA 2VKHA 3CUOA 1DPRA 2B7EA 1TEMA 5HD5A 1LVKA 5HFOA 2OW9A 3HOZJ 1N77A 5JI6A 3FXMA 2FNAA 4MQ9F 2Y31A 3ZGAB 2ESNA 2ME6A 1JWVA 2XAUA 3K4NA 4D60A 2F5EA 4ZH4F 1FEXA 4IQ4A 4I03A 1RP5A 1K57C 2GOMA 4X6AJ 2HFHA 2K9QA 3AGDA 3UR3C 4DYQA 2JSCA 3TDZC 1IN4A 1PW1A 1POGA 3KLOA 4XLNF 2XDMA 1BKCA 2FEZA 4WLAA 1JH1A 3CCJI 4R70A 3P24A 3HOYJ 2GA2A 4OOYA 3DEUA 4NDLA 2JN7A 2FOWA 3PQJA 1A36A 4A3GJ 3MQOA 3BT9A 2P6SA 4U0TA 2E19A 4ENJA 5TISC 2R5YB 3MMHA 1NK3P 4PHTA 1MNEA 3RJUA 3B2ZA 1ODDA 1SCWA 1IXCA 1QO0D 2QZ6A 4GWMA 3NQOA 4JX6A 1T0FA 3W3CA 2ZQCA 4BDZA 4RGRA 3CUEA 3JYIA 2WYXA 5FD6A 4WEKA 1MZBA 1GA0A 2GJ3A 5L3BA 4CLCB 3G2ZA 1C7KA 4ZTJA 1T98A 1H88C 3VP3A 2DYRH 5EOEA 2CO5A 4ITVA 2R7OA 3HIFA 3BA0A 4XLFA 3GVBA 3FC7A 4WYYA 1CI9A 4P55A 1TF1A 3LA7A 1A04A 3BFFA 3QPHA 3P98A 3IAM2 1VQNI 9ANTA 1B8YA 3R4KA 3BWGA 3HOSA 4KQDA 3ZMUA 1P92A 3BFCA 3CDHA 3N6IA 2ELKA 4GRIA 3D5LA 2OTLI 5BS6A 4H82A 1VQOI 3MAJA 1YJNI 4LLNA 1XP4A 3ML6A 3KEJA 2CMPA 1Q1HA 2L54A 4PKWA 2Z2MB 4OOLA 3SXYA 1LDDA 1TP4A 3DFGA 1FIAA 5F1FA 2JA8J 3BR1A 4I99C 1FIKA 1DPUA 4OIRF 3OCNA 3ZQHA 5F68A 3C4OA 4UB6C 4KG5A 3HBVP 3OCLA 4YOFA 1UWPX 3LSIA 2ZM2A 2HOTA 4WELA 3GLLA 4PM8A 3OMYA 3ZPLA 4NUBA 3P7NA 4UNOA 4HZFA 1MJ9A 4GKUA 4G9YA 1OTBA 1IKIA 1P0ZA 2VGKA 3G2YA 5M18A 3OPRA 2TRTA 2K31A 4GR0A 2E1MB 1TT5B 4IHYA 1NHAA 2RREA 1OS9A 5TJJA 4WXCA 1W0UA 5J47A 4WX9A 1R1UA 2VKDA 2LH9A 1ENHA 2ZSIB 5FKKA 1TNSA 1R55A 2HKOA 1G05A 4UA6A 2VT2A 4H3XA 2CUZA 4L9GA 3KIOA 3WE3A 1GKDA 2PEXA 5HDSA 3CMEI 3W4PA 2EA4A 3V8KA 1D5VA 3G2BA 4JX4A 1NXYA 1ATLA 2OPTA 2KRFA 5H8XA 3RZOJ 4F91B 3OYGA 2OBPA 1G8XA 1XGMA 4RB1A 1ZLKA 2R0QC 1X1PA 1H8YA 1XSVA 2D5VA 5H6RA 4EJWA 2O8XA 3BFEA 1RRJA 1X1BA 1JTYA 4QJGA 2M7VA 3W6KB 2X3AA 2WZXA 1ZN2A 3IF5A 4OINF 1IKGA 2XFTA 3JRAA 1FNNA 3S1YA 4ETXA 3L9FA 2RJQA 3MZDA 1SAXA 3C30A 1MY8A 1T33A 1HD8A 5K5RA 1Z6FA 2RCXA 5AQ7A 2H0TA 3BCAA 2HR3A 5D5UB 2J3TC 1IDYA 1MJAA 2MLKA 1EB6A 4EUVA 2DK8A 1PFLA 2J80A 1ETXA 3HREA 1TT0A 1G3WA 5AONA 3KYLA 5D8LB 1JIWP 2WKQA 3BG9A 3BRMA 3CCRI 2OW0A 5A90A 3PNTA 3KX2A 2JSDA 4HNVA 3C38A 1G9KA 5CVRA 1TDLA 2XGNA 4JQGA 1JKPC 4KICA 1WE4A 5D7WA 3TKYA 4PGHA 2EIMH 3K4KA 4RX2A 4HA8A 4J4MA 2R93J 3VDXA 4M71A 4GFBA 5A2QK 2BE5F 2DA3A 3A2KA 2DI3A 2BGCA 2LB9A 1PWWA 3HOXJ 4EBPA 4PGGA 5JYPA 3SFZA 3PAEA 2JA5J 2A3SA 4IBXA 4YFKF 2L4MA 1YI2I 3GQZA 4CYDA 4R23A 2EFOA 1J0RA 3B02A 3OSGA 3B3XA 4P6ZM 2EZLA 1MBKA 1E3UD 2B5RA 2W1OA 3LSRA 4CTHA 4BD0A 2XHKA 2PR5A 4YFNF 1I50J 1KQ0A 3IF6B 1MKMA 1D06A 3RKWA 4YIFA 3S8PA 3HRUA 2QKLB 3HY7A 2P4WA 1DGRM 3LAJA 2VB6A 4LV0A 4M4XA 2V0UA 3O5YA 1TWHJ 5LABA 2Y2NA 3IUOA 3KP6A 2M0CA 3BR6A 4XRFA 5GLCA 4II2A 2BLSA 2ZD8A 2GM4A 1SD4A 1XFQA 1IW7F 3N8SA 5TBMB 3M1CA 4K0XA 2R7UA 4S2LA 1OISA 4HG2A 3ZVTA 4A12A 2W27A 4HEA2 1J5YA 4LIUA 4E7HA 2PD8A 3C2HA 3KECA 2E36A 2MBFA 4FH4A 4EXOA 2LP0A 4BJPA 4G3VA 4DJ3A 4BJ6C 1VEUB 3FKJA 3HRTA 2HP5A 2BEOA 2X01A 1D7XA 3NWTA 4BHCA 3J80Z 4H6JA 1FY7A 2P9VA 3V8LA 5E8IA 4JPMA 4P9FA 5EDNA 3S1RJ 4ILWD 4ASNA 4IVKA 1ETQA 2Y2GA 3KYDB 2LC2A 2VJ4A 4I3AA 4N9KA 2X6YA 4FCFA 2IPQX 4HLXA 1WYCA 2VC0A 1FLIA 3HZJA 4LMYA 2XUBA 3HKZN 2I9VA 1TD5A 5A93A 4BBUA 2L5QA 2L9VA 2WAFA 1S72I 2IEKA 3OS0A 1X2MA 1B8IB 3CJQB 2LG4A 2Z5UA 1YLYA 4DBQA 3CJMA 2JMWA 3K1PA 3IX4A 2WY7Q 3H0DA 3MXQA 2VGLS 4LK1F 4B44A 3K9TA 1W0TA 4BJ5C 1GSXA 2EFQA 3C18A 4IUHA 4ZJ3A 4NQWB 3CMMA 3RCOA 2GXAA 1FR6A 3GTKJ 2WA0A 4PKSA 2K7SA 2NS0A 2ERPA 5CVIA 4XSXF 4XN0A 4Y0UA 1MXOA 3ROUA 2ZMFA 2G7HA 3C2WA 5DJUA 1VZ0A 5E1ZB 4HQAA 5J4EA 5K5BA 3CPTA 1B4AA 4C3QA 4BXFA 3OL3A 2WAEA 2EX8A 5F0HA 1KE0A 1Q1VA 2W00A 4GDFA 4U0XA 5HODA 3LYXA 2ZMEA 2VV7A 5HS8A 2BG1A 4BY1J 2R7TA 1F9IA 5BOTA 5D4SA 2JVHA 3OV8A 3G31A 4O5VA 3WU2C 1XPBA 3ZG8B 3IH4A 3KYEA 3DAVA 2RC4A 5EYRA 1FYLA 5I2ZA 2LREA 3DBAA 5CGWA 1W63M 4JXWA 4BEHB 5HLGA 3RXWA 1PP8F 1EI5A 2XPUA 1MPLA 3CCQI 2P8TA 3QU6A 5CJ9A 3BR0A 1PYYA 4S2IA 2LR8A 2E3XA 5ICEA 2XC7A 1RGYA 1TNTA 2EWWA 3ULFA 2G2WA 1LFUP 3L7WA 2ZL1A 2Y6CA 1KE4A 3VSLA 1USTA 1IV6A 3E8RA 3MCZA 3G1MA 1Q2PA 1G4DA 4RGXA 4D7NA 1MSEC 5CVVA 2GWRA 3CDLA 4XUXA 4CLCE 1LDJA 4L5IA 2A6HF 4KN4X 2F5DA 1GHPA 3MEXA 1JUMA 2EXAA 5LRSA 1B72B 4M9XA 3S1NJ 1UHSA 2EH3A 3P09A 2ZXIA 5IP9J 4E04A 1BI0A 1QZZA 2V9KA 3AKZA 1KU2A 3UMDA 3DQVC 2XEPA 5GTIC 5KVRA 3EOIA 2CS3A 2WK0A 3CCYA 3QP1A 3MFXA 4E3IA 2ZNYA 1GSWA 3LGOA 1E0EA 5CRFA 4AVPA 2JK3A 1D1BA 2JJ7A 2ZC7A 5EVIA 1K25A 1FOWA 2CYYA 4I2OA 3HCYA 3LIFA 4J01A 2ZC5B 3S7QA 2HS5A 3H5NA 3WTZA 4H49A 2XD1A 4EFSA 4JX5A 3PBSA 3Q07A 4AIGA 3KZYA 1ZHHB 2W3FA 2I8DA 4U0WA 1ZC2A 4HNTA 3MJQA 5HAPA 2LKXA 1NWZA 4GJ4A 3CMYA 2RAEA 4BQOA 4R79A 4X55A 2IBDA 4IEDA 1USNA 4C3HJ 5JMYA 4GLQA 4UB8C 2L7ZA 1JKRC 3BLMA 3HUGB 3OOPA 2CQKA 5FKMA 4L9TA 1H8ZA 1F5TA 5HPFA 4YIIA 4IX7A 1TQIA 3GW2A 3FM5A 2CWEA 4B43A 2ZFWA 2EZHA 1MSFC 1MNCA 5GTHC 5DCMA 5IPAA 3RQ4A 2FRHA 1DP9A 1P4XA 1E4DA 2V20A 5DTDA 2DYSH 1YE9A 1D1JA 2Y2ZA 2KKOA 3O87A 5FKOA 3GTGJ 1OYIA 3LEAA 2KFDA 4BAYA 4BENA 2R3SA 2E1OA 2Y2MA 4JBAA 1YW9A 2ESHA 2XVCA 2JHEA 3IV5A 2BOLA 2DRWA 4JF4A 1VETB 1K7GA 4UAAA 4WK8F 4AUOA 4U0YA 1Y93A 2HV1A 1LL8A 1YM1A 2V1NA 2CKIA 4QSHA 4UUSB 3MKZA 2AXLA 3SYTA 1G6NA 5F04A 4EEUA 2OC6A 4S0HB 2HJ9C 3T4OA 2AQFA 4PDKA 3WTSC 1D5YA 2ADUA 3CZDA 2X1EA 2R5ZB 2ZQ8A 1BYWA 4JBFA 2IA2A 4JXGA 4OOMA 3GTJJ 2QUFA 2R9XA 1OPXA 3LFVA 4Y15A 3C2GA 2IA0A 1ZG1A 2FOKA 4PM7A 1ESIA 2BZTA 4I98B 4X69A 3S7OA 5DV5A 5J40A 1FP2A 4DOZA 1Y8JA 4IJOA 1X3ZB 3BDDA 2JKTI 4XSZF 5BPIA 1UAAA 3IKVA 3OYEA 1Y39A 4K08A 4QPQA 3J7AO 4JPAA 3PFYA 1ASTA 3E7LA 3IQAA 4KZAA 3HPGA 1K56D 2XV4S 1ERDA 1BUEA 5CTMA 1WI9A 2HWVA 5H2FC 4S2JA 2X4HA 4WMCA 2ZNZA 2E2JJ 3E0JB 4FASD 2J9OA 2PJRA 1W5TA 4B3XA 5C4XJ 2W1TB 5GAHJ 2Y2KA 4WKIA 1ETYA 3KP5A 5JHFA 4KITB 1Z3XA 2HPIA 3LR3A 1WJ5A 2EZIA 4BXXJ 3JRIA 4KUKA 5FO5A 3HEFA 1M6KA 2OOLA 4BBVA 4UQIS 3K2NA 2W24A 4NC7A 4BNCA 4E6XA 1WYBA 2R7RA 3EWKA 3VPRA 1H89C 3BM6A 1BJZA 1LFBA 1WWXA 1O7EA 4BY7J 1ZG4A 2YPRA 4CYCB 4HEFA 2I10A 2RGVA 3F23A 1IRGA 1ZG6A 3GVAA 4A3FJ 3JRFA 2NNNA 1FSWA 4ZBEA 2HXIA 3BQ8A 1X2NA 4KG2A 2ISYA 3NI9A 1I5ZA 4R38A 1YMXA 2PMUA 2NYXA 3K69A 4P5OA 1CEGA 5FAOA 2XA7M 3O6BB 4ZYHA 2OXWA 2H27A 1DJBA 3S93A 3B6CA 4XRMA 5LD2C 3T0YA 3FXJA 1H9GA 3CKIA 4L6TA 4GYIA 2EA2A 3LQBA 3HDDA 2IJLA 3HHGA 3BFGA 2K2GA 4P6ZS 3CUQB 1A85A 4DYCA 3D3OA 4IHQA 1D0ZA 3PBOA 1IYOA 3RYRA 3MKLA 3ULQB 4TV7A 4Z9QA 3MMYB 4WZ5C 2JWTA 3QAHA 1SFXA 1HTZA 4Y13A 1NLZA 1XPXA 2OA4A 3EDZA 1ETWA 2OLVA 2FBKA 4OQGA 4C3IJ 4CQHA 1MIJA 4KZ5A 1GE5A 3WTUC 1FOKA 1CJFA 4GW9A 3UB6A 3NWSA 4RGSA 1BT5A 2OSUA 1Z3YA 1W7FA 4XRSA 2DA6A 2JPCA 1XFYA 2PU2A 4J00A 3TG9A 4IJGA 1BUVM 4PK4A 3VFZA 2DFEA 2IRFG 2JC7A 2DMNA 3BJOA 3HJEA 5AQ9A 3IHUA 2JKFA 3VFHA 1YQAA 4R3AA 2DFFA 4DF9A 5IT9K 1V5GA 1RUNA 2NVTJ 3G6EI 4FISA 3EETA 4I01A 1NG7A 4Y4RA 3JAMZ 3Q7VA 5IYDJ 2K3FA 4AIJA 2TCLA 3ASNH 3FK6A 3EYYA 2ICWG 2J3TD 2XF5A 3D4FA 1B3DA 3RFBA 4DYRA 4DMZA 2XB0X 3AFHA 4CJNA 4A3WA 1TBXA 3HHHA 1Y54A 2VXDA 1WJAA 1VQMI 3TW8A 2RNJA 1H5XA 5A8BA 2RNGA 1QU3A 2VKSA 1XURA 3GECA 2ELJA 4Q47A 3NY4A 3O86A 2W1RA 3EEHA 4DV8A 1GT0C 3N8RA 2HGCA 2P6TA 2EIKH 2HI3A 4CICA 1SLNA 2CJJA 3KRYA 4L5EA 4AWXB 4CCLA 2Q2EB 1OR7C 3ZQGA 5ILVA 2VV8A 4MCWA 2VI6A 4QTRA 3P9CA 1PIOA 4RLQA 3L2QA 4KUMA 1R1VA 3SW1A 3TL4X 4FVLA 1OM6A 1NYYA 2ELHA 1JT0A 4IBRA 2P74A 2B18A 4RB3C 2A2LA 2PBDP 3LI8A 4HJ4A 1QVUA 5DEQA 5HNFA 4CPKA 1BLCA 5F0CA 4Y52J 1MDMB 3QP5A 5M1AA 4HF1A 4NBQA 1A6IA 1N25A 2Z6CA 3FHNA 5KSCA 2NRAC 2WGWB 3SS5A 2QQAA 2XPVA 2AVXA 3ECOA 1BOBA 3DKYA 4ME4A 4PKVA 1BW6A 2L9RA 2LF7A 3T12B 2DA1A 4EJTA 1VQQA 4ZDXA 1IEMA 2PQ8A 2ZQ9A 3VYTB 5LHHA 5EE8A 1SDNA 4WWCA 3DPLC 2K86A 1BOAA 4MEXF 3PR6A 2WB1N 4KT6A 3H82B 4QKZA 3CLQA 3M8JA 2CMNA 4HF0A 1PUFB 2OZRA 5L79A 4ZDLA 3RTTA 2QBYB 1XN7A 1U78A 3LIBA 5L10A 3KZIC 3W4QA 3FXUA 1S4SA 3LL7A 4PJJA 4XL9A 2RL3A 5FRNA 3SHIA 2E1NA 1X0OA 2Y2OA 1XJ2A 1XXMA 3I4NJ 5CX7A 3BW6A 5GLDA 1VQPI 5FASA 2CUFA 4GCZA 2PT7A 2L9SA 2X02A 5BNGA 3L0VA 5FEGA 1M40A 2DMPA 1JT6A 5LEKA 3VV4A 3BECA 2GXBA 2WKRA 5ILUA 3L2UA 1SMYF 1T6SA 3F8NA 5HPIA 2M34A 4MBHA 5DTTA 1SDEA 1EH8A 1G4KA 5HLIA 3HLGA 1MWTA 3G4SI 3MZYA 2DJNA 2P7VB 4WMCD 1YLTA 3ZCZA 3LY3A 4B1RA 2A5WA 2XSJC 5FL3A 1K4FA 2KJBA 1CI8A 5DF7A 1MNMC 4LG0B 3LO7A 5C5KA 4YEJA 5AVFA 4O7DA 2DTRA 1E25A 2OXZA 1UTTA 5ICFA 4G6TB 1MW7A 4GCVA 1KA8A 3SH9A 3OYCA 1G28A 3OBFA 2L9NA 2Z2SB 3FKIJ 4A7BA 3A0VA 3NC8A 3RIRA 2Y2LA 2L7KA 4S2KA 2DFIA 2X3BA 2BXZA 4CLCC 2RQQA 2D2WA 1GO8P 3F22A 5I4OA 1SFUA 1EW0A 1DJCA 3PTEA 4MIMA 3A3IA 2W85A 1IRFA 1OS2A 2A6EF 1KUKA 3QP4A 3I59B 2FV9A 1LL5A 3E1SA 3E4PA 2V0WA 3EDIA 1ZP5A 1FX7A 2HDUA 3EDPA 1L0FA 3ABUA 1UHWA 3OY9A 1IN8A 3T5XA 2KRHA 1WA9A 4XLCA 3F8CA 3A4CA 4M9ZA 4N4OB 4BQMA 5EFWA 3Q82A 1IN6A 4G9LA 2IGNA 4ESFA 2OAP1 1PDNC 1G59A 4U88A 3K4MA 2EINH 4R0QA 3EGXC 4RM2A 1IZ1A 3M9AA 5EGOA 4BWIA 1KOUA 2HDSA 1PWQA 2DDYA 1W7PD 1NYMA 3S16J 2RV8A 3HGYA 3IH3A 2UXXA 1IF1A 3KSIA 4LOCA 2QCOA 1ALQA 1ETVA 4ZYAA 3N8LA 4X6TA 5EM0A 3K6GA 3WTYC 1MH3A 2L4AA 2OCEA 2JN6A 4DBRA 3MQQA 3RTRA 1S66L 2WC2A 4ZDOA 1R1HA 2M8GX 3VB2A 2JKRM 3AYKA 4EATA 3OL4A 1DP8A 5G4ZA 1R1JA 2A61A 3LFKA 3I7IA 2AS5F 1IN5A 5DD4A 2XF7A 2WTEA 3LWFA 3BZKA 3DSLA 2E1MC 1IYQA 4ZYGA 2WAQA 5DM6F 2EX2A 1XMKA 3I53A 4M9SA 3CZ6A 5HSQA 4M6YA 4MLLA 1I39A 2Z2DA 2JUCA 1VQLI 1UWNX 4P0MA 1Y8QB 3PFIA 4LGWA 3EUKL 4XBFA 3H36A 1CIZA 2GA1A 5AIPA 3CCVI 2R7XA 4XT2A 3VEPA 3H9JA 2Y2QA 1SAUA 1OCZH 2XIGA 5IHVA 5HWVA 3ISPA 1OM8A 3KCCA 4KDPA 1IACA 1KUGA 1NRJA 3WODF 1VQKI 4FTHA 2GAUA 3L9KA 4PJ0C 1LEBA 4NEED 3D5RC 3ZXSA 1R5ID 4CCJA 3HKZA 1TS7A 4ON1A 3P5JA 2VZWA 1P7JA 4I35A 4BQAA 3F9KA 4HY8A 4MBKA 2LNBA 3A0SA 4XXRA 3PAGA 4H0EA 3B33A 3ZG5A
chains in the Genus database with same CATH topology
2Z16A 2W00A 1R55A 1X1AA 3PFYA 2X1DA 4KT6A 4OAZA 5KHDA 1FLSA 1ASTA 1NG6A 1GE6A 1G05A 2W12A 3ZR8X 5CPRB 4D9JA 4D1QA 2QPJA 4H3XA 4QKZA 2ZFUA 3HPGA 3VYUB 4II3A 4FETA 1UELB 2CUZA 3J7AY 2R7TA 1ERDA 2OY4A 1JANA 4PUSA 1GKDA 2CW7A 1O0QA 3M8JA 4WZVA 1AKLA 1JAPA 3VTGA 1Q3AA 2N8RA 5BOTA 2J83A 1UG0A 2JVHA 1LDKB 3KWVC 2Z1DA 3LMMA 2GOXB 1ZTQA 3DTKA 2OZRA 5L79A 3G2BA 2KMUA 1XFUA 4ZDLA 4PKUA 4HRIA 2L2OA 2KDOA 3D5SC 2O36A 3RTTA 3H35A 1SATA 2R7SA 4AYBA 1ATLA 3E0JB 1G12A 4FASD 4F92B 5H8XA 1QHGA 2CFOA 1H71P 1YOUA 5FROA 4AXQA 2PJRA 3LL7A 3LUNA 4PJJA 4XL9A 1HTDA 3HDBA 4XCTA 966CA 4B3XA 1DP3A 3N05A 3VYSB 5FRNA 4F91B 3OYGA 2IS6A 3QOEA 3K4LA 2DW2A 5CXAA 2VJ5A 1QHHD 3SHIA 2MD0A 5BPAA 2WY8Q 2CH0A 4XBHA 3BC8A 2LBFB 1XFZA 5I2ZA 3KEYA 2LREA 1DTHA 1QIBA 1YCMA 5D1SA 3U1RA 1LKXA 1G8XA 4WKIA 3TS4A 1D8MA 4E7LA 1I1IP 4CCNA 3LSGA 1YQYA 2IS2A 5BOYA 4BEHB 1IABA 3K4CA 5JHFA 1BIWA 4ZDPA 4KITB 4HNUA 2X51A 1Z3XA 3F17A 1WJEA 2HPIA 4AU7A 1AF0A 1ZXVA 5CQEA 3CP8A 1KAPP 3LMCA 3ZGKA 1WJ5A 2L9SA 4NNJA 4YRVA 3ELMA 2KLOA 4U7BA 1X1BA 2CV0A 1V5FA 4JOMA 3HL2A 1ZXCA 4IKFA 3L0VA 3MA2A 3PSFA 1G49A 5CQGA 1MMPA 1UMSA 2X3AA 4H1QA 2Q1ZB 4KJZA 2VIXA 4YELA 5D1TA 1CK7A 1KUHA 3F19A 3O64A 4NC7A 1XFVA 4BUPA 2MLRA 3HDAP 2PJTA 2R7RA 1PYVA 1YX5A 2CV1A 3H9QA 1KBCA 5D1UA 3L2UA 1BZSA 4WKEA 5I3MA 2E3XA 3EUAA 2RJQA 2K3PA 4XN3A 1QJIA 2A8HA 2XC7A 1PWVA 2X7MA 5I12A 4WF6A 2X85A 3BLYA 2DCEA 1G4KA 2LY2A 1X19A 2IGOA 3U21A 3DU5A 3S3OA 1CXVA 1JAQA 3RSNA 1UMTA 4XR6A 4Q1LA 2HVRA 2OI0A 4XKCA 4IN9A 3ZXHA 2XF6A 1U0JA 1D8FA 4BQNA 3EHYA 2VKHA 1MNDA 4BL0B 1Y0VA 1FMVA 3BCAA 2Y6CA 2KPMA 1JI8A 1JIZA 4RMNA 4ANJA 1EB6A 1LVKA 1P9QC 2MLSA 3VSLA 1ZVXA 2OW9A 3FBIB 3E8RA 4XM7A 3LJTA 1IADA 1ZS0A 4HMAA 2F5VA 2F6CA 2O5RA 2VJJA 2HVQA 2AIGP 1HFSA 3LGPA 1TT0A 2VQCA 4XOPA 2HU6A 4RM3A 4ZJZA 4H30A 1OO9A 4IZZA 1CGEA 1D0XA 3OYBA 2V7FA 5HNHA 3LQ0A 3BCBA 2E5NA 3GBGA 2HU9A 4N4NB 1EAKA 1FBLA 1QICA 2YIGA 4E7JA 3KYLA 1JIWP 1N77A 4KISA 1QUAA 1R54A 2Y6DA 3K70C 3EDGA 2OW0A 2JVGA 1Z7LA 2A5WA 2NOJB 2XSJC 2VASA 3LSKA 4P5OA 4AVZA 5HLTA 3WV3A 3OIQA 3DL1A 4HX3A 1GO7P 2XAUA 3OYIA 2IXSA 3PNTA 1D1AA 3KX2A 3OWTA 1UEAA 4LITA 3DKXA 2JSDA 4HPQA 3K4JA 3K4NA 1G9KA 3L2RA 4IQJA 2ZSHB 4OAYA 2OXWA 1EUBA 3DNGA 4GUYA 4IQ4A 5HVQC 4GWNA 4I03A 4CH7A 3CP2A 2D1OA 4L63A 4YEJA 1ZELA 2GOMA 2BW3B 1S4BP 2JIHA 4BGDA 3UR3C 4OWRB 1BR2A 4Y33A 3S93A 3N2UA 4JQGA 1WNIA 2ZXIA 2V26A 3SDBA 4GF1A 2OXZA 3DTIA 3IP4B 4ZR5A 1UTTA 5LD2C 2KHMA 2V9KA 3AKZA 1XUDA 5D7WA 3CKIA 4G6TB 2JA2A 4L6TA 1MW7A 3W2AA 2BVMA 3DQVC 2K5CA 3LQBA 2PJRB 2JSPA 1MMQA 1GXDA 1MMNA 4E7KA 1BKCA 2CS3A 3K4KA 4MLOA 3HYGA 3OYCA 4CUGA 1CQRA 3SEQA 2K2GA 5B5PA 1JH1A 4J4MA 1WFXA 2ZXHA 3DEEA 2BW3A 2L9NA 2Z2SB 3OR1C 1BKCI 3TSKA 4NC8A 4A7BA 4XLEA 3VDXA 1A85A 2XDVA 2RJPA 3P24A 3A2KA 3OOUA 4P1WA 1E0EA 4PFPA 2OW2A 3DLAA 2VJIA 2DXIA 4ZC3A 1D0ZA 1V5EA 4BE1A 4BU2A 1W36C 1D1BA 1O0TA 2X1CA 1PWWA 2XS4A 4C2UA 2L7KA 2OV7A 1K7QA 2MC4A 1ND1A 3MMYB 5B5OA 3HXLA 4H76A 3DPUA 4XKVA 3F1AA 1KUFA 3BG7A 4HSTA 2X3BA 4WK7A 5CUHA 2K9CA 3K10A 2LYCA 4BJTA 1J7NA 2I47A 3K7NA 2RQQA 3DU6A 1GO8P 3MKYB 4XM3A 3EDZA 5I4OA 3WV2A 2HQAA 1J09A 3ZCOA 4X0GA 4J01A 3BG6A 1HV5A 2J0TA 2BVLA 2X3CA 3DPTA 3H5NA 3H9GA 4LG3A 1PWUA 3OYFA 2OUMA 4H49A 4BDYA 4XLAA 4IUWA 2W4SA 1Z21A 3OYAA 1OS2A 3KMCA 1MMGA 4EFSA 1GE5A 4PJLA 3DWBA 2JUGA 1KUKA 3EWJA 4GQLA 1MNEA 3L2WA 3UVCA 5HOOA 3F18A 3B2ZA 4AIGA 1PWPA 2W1OA 3NWSA 3EPZA 2FV9A 4FXYP 3VWBA 4CTHA 2I8DA 3E1SA 4BE2A 3N2VA 3WV1A 3EUHC 1X1DA 4Y3OA 3EDIA 1ZP5A 3SZGA 2DW1A 4R3VA 4HNTA 4PJMA 1Z3YA 3OYKA 2KRCA 2V6EA 4FU4A 4F52A 3S3MA 4GWMA 4XKWA 2X6XA 1XFYA 3LUMA 3DWLE 3S8PA 4J00A 4BQOA 1BUVM 4PK4A 3GBOA 3FBNB 2QKLB 3OY9A 1CGLA 1XFWA 2XS3A 3DPEA 3HY7A 4R79A 1DQUA 4XMYA 3W3CA 1MMAA 2KRHA 1DGRM 3FDYA 4JQFA 1WJFA 4XNFA 4BDZA 2DDFA 2VB6A 4XLCA 4CCOA 3B92A 4CSWA 1USNA 3P1VA 4BE0A 2VXZA 2UUZA 1GE7A 2AYKA 4CZCA 5JMYA 3A4CA 2MZEA 3PL8A 4DF9A 1HA8A 1D5JA 4DPEA 4N4OB 2K9LA 4PJNA 2YB9A 5LABA 3IAS2 1T95A 3F16A 1V5GA 3IUOA 1L6JA 1QJJA 4G0DA 2HVSA 2IS1A 4BS9A 3I3LA 4G9LA 4E7SA 2IGNA 3ZQQA 4ZTFA 2OVZA 2QKMB 3KEKA 4DJAA 2PMZA 1NG7A 3PNYA 3ONQA 4Y4RA 1G59A 1K7IA 3LE9A 3W2VA 4PKTA 3K4MA 2EROA 1FM1A 2R4GA 4II2A 3HUGB 2W82A 3I9V2 1C7KA 2TCLA 2MABA 4F3QA 2LRDA 4XOTA 4AYKA 4ZTJA 4RM2A 1X4PA 1C8TA 3G42A 4CA0A 1PWQA 3M1CA 4ITVA 4E7IA 1WJBA 1PJRA 2R7OA 3OR2C 2DDYA 2AQEA 1A86A 2R7UA 1OMJA 5I0LA 3LJGA 1T0FC 1R6RA 2USNA 4IX7A 2HDWA 3AL0C 1TZLA 4H84A 3BA0A 456CA 2M4GA 3SEZA 1EA3A 2DT7B 4XLFA 2XF5A 3OS1A 4B43A 2VQLA 3ZRGA 1B3DA 2CV2A 2WBMA 2Y0SA 3CJRB 4HG2A 4XM8A 3VI1A 4DIQA 1AYKA 2VQHA 4XKBA 4PSWA 3TBIA 3AFHA 4ZYAA 3V42A 2M7AA 4HEA2 3KMEA 4CCKA 1MNCA 3OYHA 2JT5A 4A3WA 1OLTA 4LIUA 2E5ZA 2V4JC 4E7HA 3C2HA 3MD2A 2YUFA 3KECA 2M7BA 3K6GA 3RQ4A 1BQQM 3B8ZA 1ROSA 2VXDA 4H2EA 2DJIA 3LSHA 1WJAA 2UWMA 3K70D 3HOTA 1GKCA 2M3AA 2RNGA 2IS4A 3K4BA 1QU3A 3I7GA 3IAM2 1B8YA 3RTSA 2WADA 1HFCA 3EDHA 2X6WA 4DBRA 1JKYA 4GR8A 3S3NA 2KZVA 3HOSA 1XURA 3AIGA 5D2BA 3F15A 3HPHA 2ELJA 1WJCA 3HC7A 1JK3A 2CUJA 4BJ6C 2W13A 1YE9A 3RTRA 3PJRA 3V96B 4ZDOA 3H5AA 1SFKA 1D0YA 4XORA 1R1HA 3FKJA 3OHLA 1MMBA 5LFAA 2FUG2 3AYKA 4GRIA 1IAAA 4JIJA 2D1NA 2UV1A 4EATA 3HG9A 3LILA 3OL4A 3D5LA 1D7XA 2E2DA 1Y56A 4E7ZA 1BUDA 3NWTA 4F93B 4DV8A 3OYNA 1R1JA 3I7IA 2F4IA 2HPMA 2DT6A 2M0MA 3LEAA 4FXQA 4H82A 2XF7A 3QYFA 3K7LA 1BSWA 1XFXA 3KEJA 4XONA 1KUIA 5I43A 1DGWY 2CMPA 1SLNA 3G5CA 2O3EA 3H5RA 830CA 3DSLA 2LY1A 5CKTA 4ILWD 1I76A 2E1MC 4DD8A 3KRYA 4E4HA 1Y6IA 4CCMA 4PKWA 2LC2A 2VJ4A 2WOAA 4LIVA 3HBUP 3LSMA 2X6YA 2BOLA 1OR7C 2Q2EB 2WAQA 4CCLA 2W14A 1X1CA 4XM6A 1K7GA 2W0DA 1HOVA 1SMPA 3HB2P 1RMZA 4JP4A 4HSRA 3QODA 3AL0B 3PUBA 3DTEA 3RPUD 3KHIA 2OY2A 5KCMA 3HY9A 3LIKA 2DW0A 4AUOA 3QYBA 3CZ6A 4RLQA 1Y93A 1W36D 3OYMA 1CGFA 1QIAA 4U87A 3L2QA 1R1IA 4PKQA 2E60A 4JA1A 2IGKA 1JJ9A 2WO8A 1D1CA 1N78A 4C9YA 3TL4X 4FVLA 4C2TA 2V1NA 2V4BA 2L5QA 1C3IA 1OM6A 2K9MA 2MYSA 3CESA 2CKIA 4F55A 1RM8A 4PSXA 2JT6A 2WAFA 2Z2DA 2M4KA 3Q2GA 3OS0A 2MZHA 2P0WA 2FV5A 3MKZA 1DMTA 2W15A 2SRTA 3HBVP 4DGWB 1X4OA 3CJQB 3SYTA 4B48A 2R7VA 2LBFA 3LFUA 2LG4A 3MKWB 3UNGC 2WB1A 2OC6A 3EUKL 4PFOA 3NX7A 2JNPA 3LSIA 1MMDA 1MMRA 4BEHA 2R7WA 4L7AA 5HNFA 4DBQA 1XUCA 2OVXA 2AQFA 3OIPA 3LIRA 3ZVSA 3L2VA 3OMYA 2IGMA 2KL4A 2WY7Q 3H0DA 1CIZA 2R7XA 3OHOA 4NUBA 3H9JA 5KNLA 2KP6A 3DPFA 2A6TA 1SAUA 3VSKA 4B44A 1IAEA 2VL8A 3L0TA 1BM6A 1OM7A 3TT4A 3OYLA 2MZIA 4QPOA 4BJ5C 3OYDA 1OM8A 1S9HA 4H4KC 1IACA 5D3CA 2WO9A 4B47A 2VPLA 1KUGA 1SU3A 3S32A 2X1EA 3LJZA 2OW1A 2KRJA 4L19A 4NQWB 3CMMA 5FRMA 1SLMA 1JAOA 3RCOA 3PNVA 3W2WA 3FHNA 1I73A 2ERQA 2WA0A 4PKSA 3OS2A 2R7QA 1LFPA 2MFZA 5L7FA 3USNA 4RLFA 1KONA 3OYJA 4GR0A 2DOAA 2VQGA 1BQOA 2E1MB 3C2GA 3D5RC 2OXUA 4GR3A 2ERPA 5CZMA 3ZXSA 2L0RA 1WJDA 1BOBA 1BR1A 4XN0A 4E6KG 3DKYA 1FMWA 2HNHA 4CCJA 3LK8A 4PKVA 1BR4A 3HKZA 2W7NA 4XQFA 4ON1A 4DOZA 1Y8JA 4XLHA 3AYUA 2RREA 4C30A 1OS9A 1UTZA 4I35A 1VZ0A 3CF2A 3VYRB 3A1YA 2VLAA 1CAQA 1GLNA 4IJOA 1Z3JA 4PKRA 3F9KA 2HZDA 3Q2HA 1N75A 1IAGA 3EHXA 1AA7A 1HY7A 3TMOA 1SRPA 2CW8A 1K6YA 2VKDA 3O2XA 3VYTB 2LH9A 1BKCE 2LOOA 4BXFA 1UAAA 2KQRA 2ZSIB 3OL3A 3OYEA 3TVCA 1IRXA 4QPQA 3DPLC 3ZUKA 2WAEA 1YP1A 2CLTA 3LKAA 3PSIA 4BQQA 1YX3A 3QYEA 5TGTA 4BACA 4JPAA 2POJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTE A;  3DTI A;  3DTK A; 
#chains in the Genus database with same CATH topology
 4OAZ A;  1SD5 A;  2W12 A;  4D1Q A;  1LEA A;  1FWZ A;  3W2Z A;  2OY4 A;  2CG4 A;  2XKP A;  3V7R A;  4UA9 A;  2ZBB A;  3LID A;  3GWZ A;  2EZK A;  1NJ4 A;  1XFU A;  3HOU J;  966C A;  3BC8 A;  1LLB A;  5BOY A;  1BIW A;  5CHU A;  3Q0W A;  1ZRE A;  3VE3 A;  4Q48 A;  3Q7Z A;  5MC7 A;  5CQG A;  2W3E A;  5GHY A;  1PZP A;  2ZBK A;  4OPY A;  3IXD A;  3F19 A;  3O64 A;  2KIF A;  2KIM A;  4EV0 A;  1Y4O A;  4HOB A;  3G34 A;  4C6Y A;  3RPQ A;  4E70 A;  1E17 A;  5DF8 A;  2WZZ A;  2F5C A;  4ANJ A;  2W3D A;  2MLS A;  3K3D A;  2F6C A;  2CQ7 A;  4L0Y B;  1LT0 A;  2CW0 F;  1KU9 A;  2PI0 A;  1ACI A;  1WRJ A;  1EAK A;  3T4S A;  3DLL F;  4QU3 A;  1ZTU A;  3PBN A;  2ZJR F;  2L1M A;  2PJP A;  2QEX I;  4E3L A;  1QPI A;  4GF1 A;  3DTI A;  2KHM A;  3N4M A;  2J9P A;  3JRG A;  1T1A A;  3IF6 C;  3KEO A;  2OAQ 1;  4OP8 A;  2K40 A;  1QGP A;  2ZXH A;  3DEE A;  2QYO A;  1YG2 A;  3MZF A;  3OOU A;  4BU2 A;  1F5M A;  3IL2 A;  1TC3 C;  2JTV A;  3Q9V A;  3CCM I;  1KUF A;  4WK7 A;  1TTY A;  3GFM A;  2STT A;  1J7N A;  1UHM A;  4IOC F;  2HQA A;  2MLG A;  3TJZ C;  2BVL A;  1DU0 A;  1SVO A;  2X3C A;  3NUL A;  3CC2 I;  5F69 A;  1Z21 A;  3HUN A;  5E1X A;  4U3T A;  3H0G J;  3LIA A;  5GHZ A;  4U7D A;  1XKZ A;  2FSW A;  4PJM A;  2V6E A;  1LUJ B;  2X6X A;  3DPE A;  4ETS A;  1DQU A;  1DJA A;  3TO9 A;  2AYK A;  4EM2 A;  1FYK A;  3MBZ A;  4BS9 A;  1TW3 A;  4E7S A;  2W25 A;  3ONQ A;  3W2V A;  4HX4 A;  3HJI A;  1TS0 A;  2J5P A;  1X4P A;  5M5W J;  1KE3 A;  3CHW P;  2PD7 A;  2OCC H;  3I71 A;  3M7G A;  3LJG A;  4E3J A;  5AQA A;  2XGE A;  1TZL A;  4H84 A;  3UB5 P;  2M4G A;  2DT7 B;  3ZP5 A;  4CLC A;  5LGU A;  2CV2 A;  3CJR B;  4KZ6 A;  4D2O A;  3V42 A;  4CCK A;  5M3F J;  2VX8 A;  1LE8 A;  2YUF A;  1BQQ M;  2KIU A;  2NVQ J;  2JE5 A;  3I7G A;  1HFC A;  2HOA A;  5D2B A;  2VOP A;  4DDS A;  3A03 A;  3H5A A;  3R0J A;  5D6E A;  3BJA A;  2H8R A;  1IAA A;  3LIL A;  1BUD A;  5D5X B;  2H6B A;  3KZZ A;  3QYF A;  3M2J A;  4XON A;  4QHC A;  3LQR A;  5E2G A;  2STW A;  2QEN A;  5JVG F;  5LBQ A;  5CKT A;  1I76 A;  1FOY A;  5FAQ A;  2V9P A;  1MBF A;  1C0W A;  2COM A;  3UB7 A;  3QOD A;  3PUB A;  3VE4 A;  3KYZ A;  2FBI A;  1P7I A;  1ZLJ A;  1IFQ A;  5E43 A;  4PKQ A;  3Q3S A;  1S3J A;  2JRM A;  4C2T A;  1RIO H;  3G1L A;  3EQV A;  4B4X A;  1H9T A;  2M1B A;  3V39 A;  1NTC A;  3L2V A;  4Z1W A;  2A6T A;  2OZU A;  4M3D A;  3WGI A;  4L0L A;  5TGF A;  5D3C A;  1SU3 A;  2A68 F;  4IXA A;  2FNP A;  5FJ8 J;  5AVE A;  1K78 A;  4A93 J;  1T1C A;  1JAO A;  1SLM A;  3MKE A;  1K55 C;  3O8G A;  2V1Z A;  3PM1 A;  3HJK A;  4RAY A;  1Y0U A;  4XUZ A;  2L0R A;  3OC2 A;  3ZQ7 A;  1TDG A;  3IH9 A;  5EOO A;  4XQF A;  4E3N A;  1TS8 A;  4BHP A;  1CAQ A;  1JXS A;  1N75 A;  3R7W A;  5IP6 A;  3H1C A;  3TP3 A;  2KQR A;  3PO3 J;  1HZO A;  3P9I A;  3I5U A;  4H6J B;  2FE3 A;  2L01 A;  3VTG A;  3AAF A;  3HBR A;  2P9V B;  2EB7 A;  1K54 A;  5CPR B;  4FE4 A;  4II3 A;  3J7A Y;  2DMU A;  1FR1 A;  4PUS A;  2P5L C;  2J83 A;  1O3R A;  2PRF A;  4R6L A;  1WH5 A;  5F5Y A;  5J3L A;  2KX6 A;  4KIB A;  2CFO A;  3FIW A;  2DW2 A;  5BPA A;  4RQ9 A;  4K0W A;  3PO2 J;  3GF2 A;  3LNQ A;  1LKX A;  4OMY A;  1FZP B;  3EGD C;  3V4G A;  3ZGK A;  5D5V B;  1DU6 A;  1V5F A;  3MA2 A;  1ORK A;  1APL C;  4UY8 I;  4H1Q A;  3T8T A;  2AO9 A;  1Y28 A;  2PJT A;  1QVT A;  3ZN0 A;  3ZNT A;  1K6O A;  1ZG5 A;  2KLI A;  3I64 A;  1D8F A;  4XK4 A;  2IWB A;  1LQ1 A;  4RMN A;  2BXY A;  2EFU A;  3FBI B;  4XM7 A;  1E3H A;  2VE9 A;  3CPT B;  1SAN A;  2XLN A;  3UN7 A;  2Q9N A;  1OO9 A;  1CGE A;  3LQ0 A;  1YT4 A;  4LJZ F;  4E7J A;  1LHY A;  1AWI A;  1FIL A;  1ONG A;  2Y6D A;  5HLT A;  2OV5 A;  2ZME B;  1B1B A;  4WXD A;  4F7Z A;  3RH8 B;  4H8R A;  2Y2H A;  1I2S A;  4MTD A;  2JIH A;  1SC7 A;  4Y33 A;  3TQN A;  3S7P A;  1K4E A;  3NEU A;  2EWV A;  1I1S A;  2K5C A;  2XK1 A;  3Q81 A;  4R1G A;  1MMN A;  4LK0 F;  3GFJ A;  1EJ9 A;  4D0P A;  2JKG A;  3TSK A;  1FSE A;  4NB5 A;  2TDX A;  3WTV C;  4XIC A;  1W36 C;  2IAI A;  2WWY A;  2KDK A;  1VQ5 I;  4H76 A;  5BMZ A;  3CCL I;  2Y75 A;  4LLL A;  4A0X A;  4IHT A;  1MBL A;  3H9G A;  3G6O A;  2Z3Y A;  4G7Z F;  3DWB A;  2WKP A;  3WS5 A;  3V50 A;  4FXY P;  2ZL1 B;  2EBI A;  2BHZ A;  3EUH C;  1X1D A;  1OJ5 A;  2WUQ A;  4FUW A;  3ZHH A;  2R7F A;  4II7 A;  2DMT A;  1FIP A;  5J8C A;  1HW2 A;  1G2H A;  4OPQ A;  2DN0 A;  4JQF A;  3B92 A;  1K6R A;  5EF6 A;  1DUX C;  1BUL A;  4GHI B;  2VXZ A;  3DBR B;  1G5U A;  4MFD A;  3UPP A;  3V7S A;  2JBF A;  3KP2 A;  4ZTF A;  1KGF A;  2XGC A;  4DJA A;  4EW7 A;  2KT0 A;  4PKT A;  4DN0 A;  3QP6 A;  1YOV B;  2O6G E;  4V2F A;  2V1D A;  3JSP A;  3SS3 A;  4DW6 A;  2FD5 A;  3BOQ A;  3OR2 C;  4AID A;  2AQE A;  1PNE A;  4FX4 A;  3JTG A;  5GAG J;  2DMW A;  1EA3 A;  3J81 Z;  2WBM A;  2Y0S A;  5F1R A;  4HBU A;  3VMA A;  2VBY A;  3KP4 A;  5KMW A;  3CCU I;  2OQG A;  3J80 K;  3OPP A;  2QLZ A;  4YIN A;  5EVI B;  5F6A A;  2X6W A;  4IRH A;  1VF9 A;  2Y4A A;  3TRC A;  4A0Z A;  3IWO A;  3EQU A;  3IXG A;  1GUU A;  3HG9 A;  2EXB A;  3G3Z A;  2F4I A;  2HPM A;  1OME A;  1HLU P;  4EES A;  5F1J A;  4E3O A;  3UME A;  1V55 H;  1VEU A;  3I4P A;  3BLS A;  3CLO A;  2VOD A;  2NS8 A;  3D72 A;  1RMZ A;  1XM5 A;  3LIK A;  1I3Q J;  4OPZ A;  2CQX A;  2E60 A;  2LDU A;  3R6S A;  4R3B A;  1RM8 A;  4CLC D;  2M4K A;  3Q2G A;  1K79 A;  3DTM A;  3BQY A;  2ZM0 A;  5J8X A;  4PFO A;  4DJ2 A;  4QB8 A;  4MNR A;  3ABK H;  5K7Z A;  1B9N A;  1IAE A;  1I27 A;  2PYP A;  1TL8 A;  2VPL A;  5E3L A;  2WV0 A;  3RJP A;  3C7U A;  1R00 A;  4M6X A;  3EEA A;  3PIP F;  1KON A;  3DV8 A;  5DCM B;  5CZM A;  3T1X A;  2VJW A;  4IOA F;  3GSG A;  1MBG A;  4KG6 A;  4MQV A;  4BMW A;  5CVJ A;  5FA7 A;  3E2L A;  3AYU A;  2HTS A;  3VYR B;  3CF2 A;  3C8C A;  1E3U A;  3F1N A;  1SRP A;  4DE3 A;  4LD5 A;  2P7J A;  1QPM A;  3T1S A;  1FLS A;  3LEZ A;  4LV3 A;  2HOE A;  3LR5 A;  1O0Q A;  5E8G A;  5BOX A;  3GX4 X;  1HSJ A;  2Y2J A;  3LMM A;  1IUF A;  1ZK8 A;  5TR7 A;  3H35 A;  4ARZ A;  2KJC A;  5FRO A;  3WTW C;  4HH3 A;  3LUN A;  4XCT A;  3N05 A;  3WS0 A;  1MJB A;  5DF9 A;  3MR0 A;  1NH3 A;  4HNU A;  4FHT A;  2WGV A;  1AF0 A;  1OYY A;  5F82 A;  2F5F A;  2CV0 A;  1ZXC A;  3FM3 A;  1Z67 A;  3WGG A;  3DBL B;  3JPU A;  1MMP A;  1K7A A;  5AQB A;  4V19 K;  1BLH A;  3GME A;  3T8R A;  1FOX A;  3GFL A;  1FYM A;  4OON A;  4IHX A;  3BLY A;  3RSN A;  3CUQ C;  1V54 H;  2GLO A;  4UXN A;  1FMV A;  2KPM A;  1FCO A;  1ETK A;  4HES A;  3HUO A;  3RQI A;  3BRO A;  3AGE A;  4O6J A;  1S1Y A;  4KIS A;  1G3T A;  2V1A A;  1YHQ I;  5CYV A;  2IXS A;  3ZFZ A;  3JR9 A;  1FJL A;  4IQJ A;  2Y48 A;  2O9B A;  1I6H J;  2QGU A;  2J8Y A;  2IVM A;  2BW3 B;  1K83 J;  1XGI A;  4QWQ A;  4KZ9 A;  2ZC6 B;  2RDP A;  3NHQ A;  3V67 A;  2DQL A;  4W97 A;  2PJR B;  4AC0 A;  3CCS I;  1MC0 A;  1ZRD A;  3BEB A;  1GHC A;  4UHU A;  2XDV A;  4LRX C;  2XF3 A;  4P1W A;  2OV7 A;  2MC4 A;  4OKP A;  2V9V A;  3HXL A;  3O8H A;  1DP7 P;  3DPU A;  4XKV A;  3CC4 I;  3F1A A;  4AD9 A;  4Y5F A;  3ZQF A;  5BQT A;  3K2A A;  1T18 A;  4L9F A;  1WPK A;  1HW5 A;  5CGS A;  3OYF A;  2OUM A;  4A2U A;  1KZH A;  3HRM A;  3U1D A;  2DAO A;  2ZC3 B;  4HQM A;  3EWJ A;  4GQL A;  2ZMV A;  4Y2F A;  3F18 A;  4JF5 A;  1BSG A;  1PWP A;  1YTY A;  1HVB A;  2E7W A;  2O0Y A;  2XSS A;  5EZH A;  5U47 A;  2XS3 A;  3FKW A;  3FDY A;  1GE7 A;  2G0E A;  4Q5S F;  1HW1 A;  4A0Y A;  2INW A;  5EVE A;  1C3B A;  4S2N C;  3LE9 A;  2LRD A;  1OT9 A;  4MGR A;  3E5X A;  1U8B A;  2EX6 A;  4NXF A;  2NUP C;  456C A;  4NXE A;  2FQ3 A;  4PM6 A;  1AWC A;  2QA4 I;  4GYG A;  4OVD A;  2B0L A;  3S2H J;  5DFY A;  3KME A;  1ON1 A;  3P9K A;  4HBT A;  4EJO A;  1KGS A;  4HOI A;  2LB5 A;  1ETO A;  4M3K A;  1OTE A;  3AG3 H;  4M73 A;  2A24 A;  5HZH A;  3SS4 A;  4LPZ A;  4CZZ A;  3AIG A;  3EUH A;  1JK3 A;  2CUJ A;  2VLG A;  3JVU A;  4E6W A;  5DTK A;  4XOR A;  1PWG A;  2R9W A;  5HDN A;  4L18 B;  4IRG A;  3G5C A;  2PAV P;  3HTU A;  3HBU P;  3G32 A;  3V7C A;  1HBX G;  4JP4 A;  3AL0 B;  5LLQ A;  5B1A H;  1QME A;  5LGT A;  4JLF A;  1O07 A;  3HUM A;  2E71 A;  2K9M A;  1CQA A;  2DOE A;  1IRZ A;  1SD6 A;  5F6F A;  2LBF A;  3LFU A;  3MZ8 A;  3Q7V B;  2VKE A;  2ZQ7 A;  2E2H J;  4CGZ A;  1U5T A;  3KSF A;  1T2K A;  3VSK A;  1A31 A;  4UUS A;  3GTC A;  3IKT A;  2JCH A;  3FWL A;  2OW1 A;  2KRJ A;  3LOC A;  5FRM A;  1WH7 A;  3SH7 A;  2R7Q A;  2OQR A;  3VOZ A;  3MWM A;  5IT5 A;  2ZXJ A;  2DOA A;  4N9H A;  1FP1 D;  1OJG A;  3BY8 A;  2GIV A;  6PAX A;  4UQI M;  4Y17 A;  1DRM A;  2LLK A;  4BHB A;  1QMF A;  2PHY A;  2ME0 A;  3A1Y A;  1GLN A;  3MSH A;  1Z3J A;  1S7E A;  3EHX A;  2V6C A;  3ZNY A;  4JF6 A;  2W0N A;  2A69 F;  2VK3 A;  4BYY A;  3FMR A;  1AHD P;  1JKO C;  1N4O A;  2Z16 A;  5EG0 A;  2YR2 A;  3U1K A;  4KQO A;  4FET A;  5BPD A;  2O36 A;  4NC6 A;  1PP7 U;  5K5O A;  3O3V A;  2EQR A;  1FTT A;  4BKX A;  2WY8 Q;  3BYD A;  3KEY A;  5D1S A;  1N9B A;  1YLW A;  3TS4 A;  1NLY A;  3X2Q H;  3SJM A;  4GXO A;  4O01 A;  3LMC A;  1I6X A;  4M3E A;  1FPQ A;  3HL2 A;  2W1T A;  2HDD A;  2XRN A;  4ETZ A;  2CFX A;  2YS9 A;  3HM5 A;  1KUH A;  4MNU A;  2Y55 A;  1W8Y A;  2I5U A;  2DOF A;  4N0B A;  2NUT C;  4XN3 A;  5I12 A;  1UMT A;  4PM5 A;  1MBH A;  1RI7 A;  1K57 A;  1P4W A;  4NET A;  2M30 A;  3EHY A;  4IVI A;  1V3F A;  1U3E M;  5FLV A;  1JIZ A;  4JKT A;  1MH4 A;  1P9Q C;  1FTZ A;  4CYC A;  2PDR A;  2YIG A;  3KP7 A;  1JNU A;  1FCN A;  3SFI A;  3VP2 A;  1E3P A;  2JVG A;  3PHY A;  1GO7 P;  4HX3 A;  3DKX A;  4JP0 A;  2AHQ A;  4GUY A;  3L1P A;  3ABM H;  3CP2 A;  1S4B P;  2HP9 A;  1XMA A;  3H3Z A;  4X1E A;  3ERE D;  4S2M A;  1EWZ A;  2YX4 A;  4B8X A;  3HYG A;  3VP1 A;  5B5P A;  4ZZD A;  1OTD A;  1A0K A;  1NZU A;  3IX8 A;  4I39 A;  1V9Z A;  3GTP J;  4LRZ E;  1M1E B;  1GHM A;  3BFD A;  2J7V A;  3TSG A;  3BG7 A;  5L3G A;  1T08 B;  2K9C A;  2O61 A;  2FBH A;  2JA6 J;  4DXB A;  2XAS A;  1GSV A;  1I2W A;  2ZMA A;  3HLE A;  3E6M A;  1MBJ A;  2JUG A;  4X68 A;  3GDI A;  3W6J B;  4GS9 A;  3UVC A;  5M19 A;  4BE2 A;  2VOO A;  4KN7 X;  4YWZ A;  5M5Y J;  3LUQ A;  3I4M J;  3OYK A;  5EV0 A;  2KRC A;  5FKL A;  3JAM K;  4XID A;  5GLA A;  1K56 A;  4N1H A;  2NVX J;  2HEO A;  1IXR C;  1WJF A;  2DDF A;  4CSW A;  1MWS A;  5D8K B;  4HV6 A;  3GZN B;  3WU1 B;  4DPE A;  2K9L A;  2OZ6 A;  1IGN A;  2V2F F;  5J1Y A;  2O8K A;  3LA2 A;  2DLL A;  4XOT A;  1C8T A;  3N97 A;  3HLB A;  3G42 A;  3RPU A;  3S1Q J;  1H0M A;  3WGH A;  1T0F C;  2XR0 A;  3SEZ A;  2VQL A;  3ZRG A;  3S1M J;  2VQH A;  3FG8 A;  2M7A A;  5HDC A;  3OYH A;  3BR5 A;  3HLD A;  2E5Z A;  2K2N A;  3MXR A;  3B8Z A;  5FLX K;  2DJI A;  4QIW N;  1XDS A;  3UPO A;  3UE0 A;  1GHI A;  4EV4 A;  1G68 A;  5EM1 A;  2D1N A;  5K7H A;  2HYJ A;  4E7Z A;  2DT6 A;  3BTC A;  1CQT A;  1XCB A;  2GQQ A;  3Q5F A;  3IT9 A;  3KE2 A;  4UV8 A;  4C75 A;  3HB2 P;  1KU3 A;  2ZJP F;  3GRJ A;  3OZH A;  4S2N A;  3KHI A;  1PWD A;  3F6V A;  3ZMD A;  1N9O A;  1W36 D;  2FQ4 A;  2GDN A;  1R1I A;  4JA1 A;  3C3W A;  1JJ9 A;  5HS7 A;  1JWP A;  4BBR J;  3SQN A;  3F1P A;  1VM1 A;  4HYE A;  2YKH A;  1LB2 A;  2Q8K A;  4A3D J;  3T4Q A;  4I7H A;  4N92 A;  1T8I A;  1MKI A;  2EFX A;  3OIP A;  4M74 A;  2IGM A;  5EGO B;  2JQ7 A;  4AIH A;  1JTX A;  1BC7 C;  5FEF A;  1OM7 A;  3FIS A;  1IC8 A;  3LJZ A;  2VE8 A;  3PNV A;  3SHF A;  3W2W A;  2PBY A;  1MDM A;  3S7N A;  4ZAM A;  3G35 A;  4S2O A;  1W1W E;  2Y79 A;  2OXU A;  1J75 A;  3T1B A;  2ZM8 A;  2EV6 A;  5DM7 F;  4D7M A;  3HLC A;  1JKQ C;  3Q2H A;  4EJV A;  1JHF A;  3TMO A;  4PMA A;  1K6Y A;  2PYR A;  2WKH A;  3TW7 A;  1TWF J;  1U8R A;  2CLT A;  3M8E A;  3Q0V A;  3JSO A;  3QYE A;  4BAC A;  1RNL A;  2POJ A;  1X1A A;  1T39 A;  3MXS A;  3ZR8 X;  4D9J A;  5KZH A;  2ZQD A;  4FSF A;  5KAI C;  3F0C A;  3KWV C;  1KU7 A;  2H94 A;  1QBJ A;  2V8F A;  3IWF A;  4IVN A;  4IRI A;  4ENK A;  2DNS A;  3IRQ A;  2Y8H A;  2KDZ A;  5DUI A;  4P85 A;  3HTS B;  3JRD A;  1FQG A;  5DYM A;  1SFE A;  1D8M A;  1S5L C;  1AKH A;  4ZDP A;  2X51 A;  2KOI A;  3F17 A;  3FXR A;  4XT2 B;  3P01 A;  4NNJ A;  4G6D A;  3ZMT A;  4FT8 A;  4OLG A;  5K5Q A;  2R7Z J;  3C1D A;  2VUM J;  3LIC A;  3H9Q A;  1KBC A;  3FYZ A;  1PWC A;  3LY4 A;  4G7O F;  2VGJ A;  3SDG A;  1PWV A;  2X85 A;  1CF7 A;  2IGO A;  1CXV A;  1JJ6 C;  2G2U A;  1JJ8 C;  1Z7U A;  3PYP A;  4RVA A;  4HI4 A;  3PXP A;  2CU7 A;  2CGP A;  4M72 A;  1FT9 A;  1BIA A;  3LJT A;  3NOU C;  4UVC A;  1O57 A;  2ZO4 A;  2FU4 A;  5FQJ A;  4N4N B;  5D3O A;  1O7F A;  3K70 C;  3TE8 A;  1XJ3 A;  3OYI A;  3OWT A;  3BJ6 A;  4OAY A;  3DNG A;  3I54 A;  4GWN A;  4F3L A;  1L0E A;  3OSF A;  3BY9 A;  4LCM A;  1BR2 A;  3WTX C;  2P7C B;  4UVB A;  5DKL A;  2L7M P;  1SMT A;  3F1O A;  2BVM A;  3GLX A;  2VPR A;  1GXD A;  2QSG X;  1PRQ A;  4YNR A;  2H1L A;  2ZJQ F;  4CUG A;  1CQR A;  3RKX A;  1YQS A;  4WBG A;  4HDV A;  5GAE J;  2OW2 A;  4A3E J;  2DA2 A;  4C2U A;  1XAX A;  2EA9 A;  1YKD A;  3Q1F A;  3K2Z A;  4DZJ A;  4D5C A;  4OQI A;  3LCE A;  3K10 A;  3UDI A;  3S4X A;  3E6B A;  4HX7 A;  3MKY B;  1ES4 A;  5JYO A;  4S04 A;  1J09 A;  4BLM A;  2O9C A;  4BDY A;  3KX0 X;  4M6V A;  1TS6 A;  3LA3 A;  3BR3 A;  2AXT C;  1XJ4 A;  3LI9 A;  3WV1 A;  4Y3O A;  1LSX A;  4QWO A;  2DW1 A;  1UGU A;  2ZCW A;  3FBN B;  1RZ4 A;  4Y0T A;  1CGL A;  1F43 A;  1MMA A;  3I0T A;  3U4L P;  4CO8 A;  1ZYR F;  1BBY A;  1S4R A;  5E17 F;  4FCY A;  3IAS 2;  1IN7 A;  2OVZ A;  4X56 A;  1GV2 A;  2PMZ A;  4R8H A;  3H9W A;  1K7I A;  1YLJ A;  3T1Q B;  4DNC A;  1Z1D A;  4EEF G;  3VP0 A;  2V9A A;  4E7I A;  1WJB A;  2DT5 A;  4IPA A;  1KYZ A;  2DPD A;  2OU2 A;  3HSF A;  1RUO A;  3M6H A;  3VI1 A;  2L7F P;  4OIO F;  5IOY A;  3A0R A;  1SVM A;  4OH0 A;  3LST A;  1YPR A;  5FQK A;  5IP7 J;  2F4M B;  2CQN A;  2UWM A;  3MVP A;  2LKP A;  3HOT A;  2DDA A;  1QA6 A;  5AJG A;  4ID4 A;  3FPV A;  3BR2 A;  4A3C J;  1U9O A;  5L3C A;  3T4L A;  1MMB A;  1R9T J;  3A01 A;  2Z2L B;  3WTT C;  5FAT A;  5J8F A;  2Y9Z A;  1RES A;  1LI9 A;  3CCE I;  4QPR A;  4UHT A;  4E4H A;  1XX5 A;  4CCM A;  2W14 A;  5E2H A;  2PX9 A;  2O3F A;  4Q0J A;  2W0D A;  2D1H A;  3VP4 A;  4HSR A;  5CHM A;  3RPU D;  2DW0 A;  5CEC A;  3W4O A;  4U87 A;  3CI6 A;  1N78 A;  3CAX A;  1T56 A;  3T50 A;  2MYS A;  2B02 A;  4F94 A;  1YIT I;  4PSX A;  1SMP A;  4WCG A;  4PCQ A;  3MKW B;  2JNP A;  4WF2 A;  5KSH A;  3ZVS A;  4JGP A;  1Z0X A;  4R4S A;  2MZI A;  3OYD A;  3S32 A;  2GNX A;  2H10 A;  4FOF A;  3J7Z I;  4UUV A;  5F83 A;  1KVL A;  2ERQ A;  3I7J A;  1LE8 B;  2VQG A;  4GR3 A;  4WEJ A;  2P08 A;  4QY5 A;  2HNH A;  4GO1 A;  3LR4 A;  4ZJ2 A;  2W7N A;  4C3J J;  4C30 A;  5HDG A;  2VLA A;  2HDQ A;  3K3C A;  1MMS A;  4Q0H A;  1JUP A;  4I6Z A;  2GBY A;  5E3M A;  4NKP A;  1YP1 A;  3C5A A;  5KHD A;  2VBX A;  3M8F A;  3IWZ A;  4RA2 A;  2HYG D;  3OPL A;  3GFI A;  4GD8 A;  4JXV A;  3HL9 A;  3D5S C;  2Y9Y A;  2MH9 A;  2Y69 H;  1ZGW A;  4IHW A;  4W1U A;  1VQ7 I;  2E1C A;  2EX9 A;  1DP3 A;  2CH0 A;  1W7P A;  1AOY A;  1CK3 A;  3UDX A;  2ZME C;  4RBO A;  4AU7 A;  1VB6 A;  4KZ3 A;  5HS9 A;  4YRV A;  1AXB A;  4IKF A;  3RYP A;  4AIK A;  4GOG A;  2WKE A;  4MO7 A;  3PIO F;  1K78 B;  5A91 A;  1R7J A;  1TVI A;  5D1U A;  3QPS A;  3T4K A;  4ENM A;  2CC1 A;  2XGD A;  2LY2 A;  3DU5 A;  3S3O A;  4MEY F;  4AUX A;  3O2P E;  3ZQL A;  4P87 A;  2K7L A;  3A0B C;  3R7W B;  1J2X A;  5HAQ A;  2OD5 A;  1FBL A;  1YW7 A;  5FD5 A;  4JGO A;  4G6Q A;  5CER A;  1MBE A;  4PM9 A;  4I02 A;  4IEJ A;  1ZRF A;  3K4J A;  3E0Y A;  3M07 A;  1N9N A;  2PMH A;  5FQM A;  3B6A A;  2V26 A;  2B9S A;  2M5W A;  5F27 A;  3BTI A;  1JWZ A;  1P9R A;  3W2A A;  4OLD A;  3HOV J;  1ZR4 A;  4OIQ F;  2DPU A;  1PI4 A;  3SEQ A;  1WFX A;  1W79 A;  3WE2 A;  5IS1 A;  3OR1 C;  3MQ0 A;  1WCM J;  2XFS A;  4XLE A;  4LB6 B;  3ZOB A;  2RJP A;  4PFP A;  4HAM A;  3DLA A;  4PKY A;  2VJI A;  4LV1 A;  2QSF X;  3DBH B;  1TVF A;  1GXP A;  5B5E C;  2LK2 A;  3ERM A;  4HST A;  1YSQ A;  2DA4 A;  4BJT A;  5FLX Z;  4X0G A;  1H8M A;  2ACJ A;  1YSP A;  1KGE A;  1R4N B;  3MKF A;  3MFK A;  2EV0 A;  5D6F A;  4BXU A;  5HOO A;  2BY1 A;  3L7H A;  4Y3I A;  3DP7 A;  1OTI A;  4R3V A;  4F52 A;  1RR7 A;  5HAI A;  3RKQ A;  1BI2 A;  5EVI C;  5ILS A;  2X0L A;  4HV5 A;  1F36 A;  1YW8 A;  1G3Y A;  3P1V A;  3A0H C;  2UUZ A;  1NZO A;  1A35 A;  2XSD C;  1D5J A;  2YB9 A;  1R5H A;  2BTF P;  1JVJ A;  1L6J A;  4A3K J;  1L0G A;  3KEK A;  2H6C A;  3LEQ A;  1GA9 A;  1KYW A;  1FM1 A;  3I9V 2;  2L02 A;  4CA0 A;  3ZG0 A;  5E1W A;  4KT5 C;  1EF4 A;  2I72 A;  1QNT A;  2USN A;  4MTE A;  2FH5 A;  3Q0U A;  1J3W A;  3GV9 A;  4N9L A;  1USS A;  3BZC A;  2QPN A;  4XM8 A;  4DIQ A;  3QNC A;  1K4T A;  3MD2 A;  3ZG7 B;  2YU3 A;  4H2E A;  1ON2 A;  1JUS A;  4I76 A;  2Q0O A;  5FSR A;  3CO7 C;  4IHV A;  4OQH A;  3V96 B;  5J4V A;  3OHL A;  1S67 L;  4RB0 A;  2E2D A;  1Y56 A;  5CTN A;  2M0M A;  2XQZ A;  4DE1 A;  3FMS A;  4HH2 A;  5I43 A;  3OPH A;  2O3E A;  2DU9 A;  2YU9 J;  1MZU A;  2FMY A;  2K02 A;  5M5X J;  4RA7 A;  4IO9 F;  5KCM A;  1T1B A;  3QYB A;  4HW0 A;  2IGK A;  1S7O A;  1D1C A;  2EWN A;  2IW5 A;  3RDI A;  1TWC J;  3PQK A;  1C3I A;  1R71 A;  3IH2 A;  4GN2 A;  3WHC A;  3M1E A;  1DMT A;  1FBU A;  1JE8 A;  2GIZ A;  3S22 A;  4G3K A;  3MFD A;  2KP6 A;  1YIO A;  3QP2 A;  1UFM A;  2ZOI A;  5LHG A;  2QM3 A;  4H4K C;  4HBL A;  4ON0 A;  2VEA A;  1YLP A;  2CRG A;  5IY5 H;  2MD5 A;  2L4R A;  4IHS A;  2QQB A;  3RI4 A;  3FX3 A;  4G8X A;  4AYB N;  1ZG3 A;  2IA1 A;  2DK5 A;  2GX5 A;  3LK8 A;  2WAQ N;  1BR4 A;  1IXS B;  1RCJ A;  1FSY A;  1HY7 A;  2CW8 A;  4A5R A;  4ESJ A;  4EWF A;  4NXB A;  4A3B J;  5CVU A;  2FA5 A;  5DFX A;  1O3S A;  2R92 J;  2QYB A;  1ZR2 A;  2QPJ A;  4Y7N J;  3IXH A;  5J4Y A;  1X3W B;  4MHG A;  1ES5 A;  2IWC A;  4Q8I A;  2CW7 A;  1OCT C;  3A3D A;  3G4P A;  4KFC A;  4OQ0 A;  2J3W A;  2R7S A;  5EEC A;  1ZHF A;  1XGN A;  2QQ9 A;  1KDS A;  1H71 P;  1YJW I;  1VQ6 I;  1HTD A;  3HDB A;  2IS6 A;  5CXA A;  1FBS A;  2VJ5 A;  1QHH D;  2MH2 A;  3MN2 A;  4E7L A;  3K4C A;  2HZ5 A;  2K4J A;  3QWL A;  1Z09 A;  5DCF A;  4Y7P A;  4U7B A;  1HQC A;  1F98 A;  1WZ2 A;  5EEA A;  2MJ6 A;  3UPN A;  3GEZ A;  3ISG A;  2N8G A;  3HB9 A;  3A3F A;  2XAF A;  3ZMZ A;  1PYV A;  1D8J A;  4OU0 A;  4WKE A;  2QWS A;  3F72 A;  2LMD A;  4WF6 A;  4EU0 A;  1XA1 A;  2GZA A;  2FML A;  2F4O B;  1ZTR A;  4XR6 A;  4BQN A;  4OPR A;  2XB5 A;  3RKY A;  4B4Z A;  1L0D A;  1SKO A;  1ZVX A;  4LLG F;  3F1N B;  4EGY A;  1F9N A;  2HVQ A;  1STZ A;  3ZQC A;  4IZZ A;  3L09 A;  3OYB A;  2V7F A;  2V1B A;  1KQ9 A;  2UWX A;  1ZGA A;  3EDG A;  3LSK A;  2A3U A;  1ZH5 A;  1OQY A;  5CEB A;  4Y0O A;  1YJ9 I;  1EUB A;  5HVQ C;  4WZ5 A;  2JKR I;  2V8C A;  3S15 J;  1ZEL A;  4L63 A;  4OWR B;  4KIG A;  3SDB A;  4A6E A;  2BYV E;  4ARZ B;  3ZN1 A;  2JA2 A;  3CQZ J;  4DE2 A;  5EEH A;  1BKC I;  4NC8 A;  3KO6 A;  4EQI A;  2EK5 A;  4B4C A;  3BTL A;  1MGT A;  3ELM A;  2X1C A;  1P6R A;  1K7Q A;  2F2E A;  4LB5 A;  2GXG A;  5E3N A;  2HQR A;  4C2M J;  2E7X A;  2P5K A;  3DU6 A;  4I3I A;  3LR0 A;  2J5O A;  3ZCO A;  2ECC A;  1YRN A;  1J59 A;  1G6A A;  1HCR A;  3LQQ A;  5C3E J;  1IDZ A;  5ERI A;  2FFY A;  2RVC A;  2BY3 A;  5FDH A;  5F0F A;  3IH8 A;  4FU4 A;  1J9I A;  3S3M A;  4EJU A;  2HQ5 A;  3WU0 A;  3QOP A;  1HA8 A;  3IS2 A;  4HP9 A;  1XFN A;  3IX3 A;  2WGI A;  1QJJ A;  3S17 J;  2ZLY A;  3JCU C;  3J81 K;  3ZQQ A;  2BY0 A;  1Z6R A;  3IRR A;  4HQE A;  4DKI A;  3PNY A;  1ERM A;  2R4G A;  2W82 A;  3IWI A;  4GHI A;  3O88 A;  1U2W A;  3WG9 A;  4IL6 C;  1OMJ A;  3BQA A;  3AL0 C;  3PBT A;  4MN5 A;  4B09 A;  4GNU A;  3TBI A;  2X6O A;  4GZB A;  3SZT A;  1WKM A;  2JT5 A;  5HDK A;  5EZG A;  2NVU B;  2HP6 A;  1U6G A;  4S2P A;  2HYF A;  3H7W A;  3LSH A;  3K70 D;  4PZJ A;  5GPA A;  3WWX A;  1OR7 A;  2OF7 A;  2M3A A;  1S6R A;  3UB9 A;  3S3N A;  2EIL H;  1K38 A;  2MSY A;  1WJC A;  2W13 A;  3NDE A;  2MC3 A;  2ID6 A;  2DTZ A;  3G71 I;  1ERO A;  3FHZ A;  1ZRC A;  3E5U A;  4HP4 A;  4FXQ A;  3QHY A;  1ODV A;  5G18 A;  1HKT A;  3K7A J;  830C A;  4YFX F;  5GL9 A;  4R4R A;  1VHM A;  3CDI A;  2E34 A;  2DMQ A;  2WOA A;  1HOV A;  3DTE A;  2OY2 A;  2PG4 A;  3FMQ A;  3TED A;  1BA5 A;  2PLY A;  1OYW A;  2W15 A;  2SRT A;  1X4O A;  3IHA A;  1HF0 A;  1BC8 C;  3UNG C;  3WRZ A;  1O3Q A;  5A92 A;  1MMR A;  1ESU A;  3H3V K;  2HDC A;  2JZY A;  5KNL A;  4KQQ A;  2FX0 A;  2O7O A;  2M45 A;  3TT4 A;  3SOI A;  4UA7 A;  3HRS A;  3CO6 C;  4ZYD A;  2E8I A;  2ID3 A;  2X71 A;  3JRE A;  1GXQ A;  4AM3 A;  3TP0 A;  1R4M B;  4JXS A;  1JTG A;  2QWW A;  3TDU C;  1LSW A;  1KQ8 A;  3C2B A;  4E6K G;  1SKF A;  2A24 B;  2IT0 A;  1B59 A;  5IU1 A;  2EFN A;  5CLS A;  2F48 A;  1IJW C;  2EFW A;  1S1Z A;  3IWQ A;  5FI2 A;  1R22 A;  1IRX A;  2DQR A;  5JLX A;  4O8G A;  5GLB A;  1YX3 A;  5TGT A;  4RAZ A;  4OIP F;  4LRY C;  2CUE A;  4GDB A;  4HJ6 A;  1RKW A;  4A5M A;  5DS9 A;  5L3F A;  5FI6 A;  4MN6 A;  3F8B A;  3E4O A;  3L2C A;  1ZTQ A;  1Y0N A;  1SAT A;  2X48 A;  1LL9 A;  1KVM A;  2MA3 A;  3AG2 H;  2LBF B;  3ZG9 B;  5LHI A;  1QIB A;  1YQY A;  4YFM A;  1U5T B;  1ITY A;  3FV7 A;  1Q2Q A;  3R0A A;  4YG2 F;  1TQM A;  2Q1Z B;  5B3S H;  1VQ9 I;  3IHB A;  1X58 A;  1XMX A;  3JRC A;  1QRY A;  4KNY A;  5I3M A;  4NHJ A;  2K3P A;  1D8K A;  3PBQ A;  3NIA A;  5F1G A;  2R5Y A;  3ZXH A;  4ZRR A;  3ZVW A;  1U0J A;  3O3K A;  1MND A;  1R5G A;  4B3A A;  5HWT A;  3BPV A;  3BZ6 A;  4G12 A;  2OAZ A;  4CDG A;  4EBL A;  2Y0M A;  1HFS A;  4XOP A;  4ZJ1 A;  1D0X A;  5EG0 B;  4AVZ A;  1TWA J;  4ABZ A;  1HXD A;  2XH9 A;  4LIT A;  2ACG A;  3VOL A;  2W3H A;  1PUE E;  3G73 A;  3ECH A;  4ZR5 A;  1XUD A;  4WUJ A;  4EQ1 A;  3VOY A;  2JSP A;  1MMQ A;  4E7K A;  2BW3 A;  1BLP A;  3HGG A;  3LSJ A;  3NOP C;  2C6W B;  4FD8 A;  2QF7 A;  1IAW A;  2JKT M;  4ZC3 A;  4R1H A;  5JR3 A;  1UZC A;  1XDU A;  1ND1 A;  5B5O A;  4KMU X;  2L0W A;  2XAJ A;  3JVV A;  4XM3 A;  5FQ9 A;  2BY2 A;  3BG6 A;  1HV5 A;  3HSE A;  3DPT A;  5A2Q Z;  2ZB9 A;  3UE1 A;  1B6A A;  1N9L A;  3Q9S A;  5K1Y A;  3REO A;  4KZ8 A;  3L2W A;  3RZD J;  3CWF A;  4M3B A;  1XA7 A;  3VWB A;  3I55 I;  3N2V A;  2DOD A;  4RS8 A;  3WHB A;  1XCV A;  3N4I A;  2JA7 J;  1HLV A;  3GBO A;  4WN5 A;  3BG3 A;  3A02 A;  4ESB A;  2XAG A;  5FFZ A;  2OWH A;  5H6Q A;  4L7A A;  2K85 A;  4CCO A;  1JGS A;  2DDB A;  4HF2 A;  1YIJ I;  2QVO A;  4PJN A;  3MS6 A;  3F16 A;  1ACF A;  4EER A;  2NOG A;  2Y59 A;  1OKR A;  2QKM B;  1GCE A;  3E4Q A;  4EGZ A;  4GD6 A;  3UNW A;  2ERO A;  3CC7 I;  1LI0 A;  1OMI A;  3DF8 A;  2P04 A;  2RKH A;  4G7H F;  1A86 A;  2NNY A;  3V8J A;  3EYI A;  3C7V A;  2Q9M A;  3KSG A;  3OS1 A;  3UE3 A;  2M8E A;  2XRO A;  1BW5 A;  4PSW A;  5GP9 A;  2VN2 A;  5E79 C;  1H3Q A;  3CMZ A;  3FZC A;  3AG1 H;  1OLT A;  2V4J C;  3FXL A;  2VKV A;  3D0S A;  2M7B A;  5L07 A;  3H92 A;  4KIF A;  3K4B A;  1U60 A;  3F8F A;  5E3O A;  1EV7 A;  2VBZ A;  5B66 C;  2QZ8 A;  5C44 J;  5LFA A;  3GTM J;  2A05 A;  3QP8 A;  2B63 J;  4OOI A;  4GS9 B;  1K4S A;  4RGU A;  3K0L A;  1BSW A;  3WG7 H;  1KUI A;  3TOA A;  1OCO H;  3NJA A;  5DJT A;  1HDD C;  4KMF A;  4LIV A;  2HTJ A;  4X53 A;  2QMI A;  3CMA I;  3HY9 A;  2QKP A;  1YLZ A;  1P9W A;  1QIA A;  2V1X A;  3PUF A;  2BV6 A;  2Y0S N;  3FXO A;  3WS4 A;  2JT6 A;  4MN7 A;  2P0W A;  4UUT A;  2HXO A;  2VON A;  4JK1 X;  3FKV A;  4I5S A;  2O99 A;  3DPF A;  3GR2 A;  1W63 Q;  4R3J A;  4HIA A;  5TRD A;  5KIZ A;  2VV6 A;  4RYE A;  3KET A;  1Z05 A;  1SEU A;  1FBQ A;  4BBS J;  1TW2 A;  2XKO A;  1BLS A;  4MMN A;  2ZC2 A;  2BAS A;  5EVI D;  2MFZ A;  5HL6 A;  4RLF A;  1HDP A;  3OYJ A;  3KPH A;  4QLC U;  1O7L A;  4FQG A;  2JT1 A;  1BR1 A;  3KLN A;  1FMW A;  2W3G A;  4JGQ A;  4PAU A;  1T38 A;  4DRT A;  1ZKJ A;  4PKR A;  3WRT A;  3KSH A;  2HZD A;  4ZZL A;  5FGM A;  2DA7 A;  4IF4 A;  1BKC E;  2LOO A;  5M3M J;  1PW8 A;  4BQQ A;  3HSR A;  1WVR A;  5HD3 A;  1NG6 A;  4L9N A;  1UEL B;  1UB9 A;  4B9O A;  2HDR A;  4HHD A;  2N8R A;  1JTD A;  2FFF B;  1CF0 A;  2Y30 A;  2Z6D A;  3UE6 A;  2L2O A;  2KDO A;  3FXK A;  4X1L A;  2LD5 A;  2Y91 A;  5I5L A;  3C7J A;  5FDS A;  3FWE A;  1OFC X;  3F1P B;  4KZ7 A;  3KYQ A;  3HLF A;  2OLU A;  3F21 A;  1E3O C;  1FSH A;  4HJ3 A;  1IAB A;  1VFC A;  1WJE A;  3HVF A;  2XAH A;  1OJL A;  4JOM A;  2C6Y A;  1F4K A;  5L09 A;  2UV0 E;  2VIX A;  3TW6 A;  5JFR A;  5D1T A;  2MLR A;  3HDA P;  1ES2 A;  1S0W A;  5ICG A;  2O03 A;  2A49 A;  5L3D A;  2P81 A;  1SD7 A;  4B88 A;  3IXB A;  2G9W A;  3IF6 A;  4RAG A;  2O5R A;  4LEN A;  2HZT A;  2L0K A;  2VQC A;  4H30 A;  4ZJZ A;  2LY9 A;  4N9I A;  2ZXW H;  4AFI A;  1J7K A;  4WF0 A;  1QUA A;  2YUS A;  5I94 A;  2GZW A;  2VAS A;  1GVJ A;  1HKQ A;  1D1A A;  1UEA A;  5HLH A;  4HPQ A;  1I3A A;  1WGX A;  2P5V A;  4RDU A;  3L2R A;  3NAR A;  3QQA A;  5AIQ A;  2D1O A;  3CD6 I;  3EQL F;  2DO7 A;  2V1U A;  4P6B A;  1TQP A;  3QRF F;  3E3V A;  2K9S A;  5ICC A;  5TBM A;  4N1X A;  4GDN A;  1ZQ3 P;  3ABL H;  5FQI A;  4QY6 A;  1OCP A;  1AKH B;  1RGZ A;  1L3L A;  4LFU A;  4ESP A;  3RXX A;  2DXI A;  1O0T A;  3T4T A;  1E2X A;  1D7E A;  5FFX A;  3U9G A;  5CHJ A;  2LYC A;  1JGG A;  1L2S A;  5EEG A;  1HST A;  1EH7 A;  4LG3 A;  5GAD J;  1PWU A;  3A3E A;  4MDZ A;  2HKX A;  4IUW A;  4FH2 A;  1ULY A;  1CF7 B;  4PJL A;  3BWL A;  5E20 A;  2EV5 A;  3EPZ A;  4JGR A;  2VA0 A;  2RQP A;  2MGQ A;  3VOD A;  3NAU A;  2FZ0 A;  5IOZ A;  3D1N I;  1S7A A;  2D01 A;  4XMY A;  1ZAO A;  1F1Z A;  1SZV A;  2E8J A;  1XSD A;  4HX8 A;  4LLO B;  3GMW A;  3PL8 A;  4KYW A;  5DD8 A;  1RKT A;  1CEF A;  1T95 A;  1YFH A;  4G0D A;  2HVS A;  2IS1 A;  3I3L A;  4F3L B;  2JRT A;  1B8I A;  2LSO A;  3NDG A;  3JRH A;  4F3Q A;  3CJT B;  3F1O B;  4I09 A;  2PFB A;  2ZQA A;  2PN6 A;  3TOI A;  3FPW A;  1R36 A;  3OOV A;  4NG2 A;  4NQW A;  2YSR A;  2FF4 A;  5EPH A;  5EUA A;  4YIR X;  3GCM A;  4UVA A;  5CGX A;  3D9Y A;  1ROS A;  3VOE A;  1IOU A;  2O9L A;  1XGS A;  1BL0 A;  5KAF C;  2IS4 A;  1K61 A;  2WAD A;  4MFE A;  4K2E A;  1REP C;  3F15 A;  3HPH A;  4NK3 A;  3HC7 A;  2UZK A;  4JIJ A;  2UV1 A;  5DTS A;  1W5S A;  1S8N A;  1DGW Y;  1I5Q A;  2LY1 A;  1GV5 A;  4DD8 A;  1XX2 A;  1OZ9 A;  1Y6I A;  4BBT A;  3LSM A;  4B93 A;  3F8M A;  1RR8 C;  5J1U A;  2HGV A;  4BL2 A;  5FI7 A;  1BM9 A;  3JRB A;  1K55 A;  1XGO A;  1DP6 A;  4CHU A;  4DGW B;  2M9H A;  3FK7 A;  4B48 A;  4Z6Y A;  1S29 A;  1LSV A;  1YLF A;  2WB1 A;  4EET B;  1MMD A;  3PBR A;  4BEH A;  3UKG A;  1V9Y A;  1IYS A;  3MZH A;  1IG7 A;  3AGF A;  5EVL A;  1R49 A;  2CSO A;  4FE7 A;  2ECB A;  1PI5 A;  3UB8 A;  3S2D J;  3K1M A;  1B9M A;  2A5Y B;  3OS2 A;  3RTY A;  1LFP A;  5L7F A;  3USN A;  2DA5 A;  1XB4 A;  4BH9 A;  5J1R A;  2ISZ A;  2MW8 A;  4A69 C;  1Z6T A;  2LKS A;  4O3M A;  1UTZ A;  2QJ5 A;  2H8W A;  1MWR A;  1IAG A;  2KZG A;  2TCT A;  3O2X A;  3ESW B;  3S14 J;  3E2K A;  1K0K A;  3A01 B;  2OJE D;  3PSI A;  4ENN A;  5LRR A;  4EQQ A;  2X1D A;  1WI3 A;  3VYU B;  3OIO A;  4EMS A;  1YYV A;  1O3T A;  1JAN A;  3KYC B;  1AKL A;  3VFF A;  1B72 A;  1UG0 A;  5IYB J;  3NOT C;  3CJN A;  1DDN A;  2COB A;  1FOF A;  4PKU A;  4HRI A;  4AYB A;  2M1C A;  1T19 A;  1QHG A;  2YX7 A;  4AXQ A;  3VYS B;  3QOE A;  3TGN A;  2MD0 A;  3U1R A;  1LNW A;  3C4P A;  3ZYT A;  1Z91 A;  4G94 A;  3F3X A;  4CCN A;  2D02 A;  4V2G A;  1K54 C;  3H3U A;  4DZP A;  1ZXV A;  5CQE A;  4NXG A;  1XTA A;  4Q0I A;  2KLO A;  2B95 A;  3TO7 A;  3PSF A;  2LF8 A;  3QPL A;  1UMS A;  4Z2Y A;  3TO6 A;  1CK7 A;  5E2F A;  1J9M A;  1YX5 A;  2H5S A;  2D45 A;  1KDW A;  1LJ9 A;  3EUA A;  1QJI A;  2X7M A;  1GVD A;  3ZMS A;  3DWZ A;  2PBI A;  3ZMV A;  3U21 A;  1JAQ A;  2H1K A;  2XF6 A;  3HLW A;  4FTX A;  3V5M A;  2BHY A;  2HOS A;  2K27 A;  1UG2 A;  1IAD A;  2F5V A;  2AIG P;  2VJJ A;  1XS9 A;  3LGP A;  4A3J J;  2HU6 A;  1QZE A;  3KP3 A;  3BCB A;  2HU9 A;