3DTIA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
243
Chain Sequence
b'PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSLTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRRE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 73
structure length 243
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtiA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtiA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtiA01
3DTIA 3DTEA 3DTKA
chains in the Genus database with same CATH superfamily
2JZYA 3K2ZA 4BQAA 5J7EA 3QPSA 2EFQA 2JN6A 5GAGJ 5F0CA 1B1BA 1XN7A 2FX0A 3FK6A 2WKQA 3DWBA 3KLOA 3TOBA 2GX5A 3HC7A 4QHCA 2IGMA 1BR4A 5E2GA 2F4OB 4P85A 2CC1A 4M72A 2DTZA 1KE4A 1T1BA 5AIQA 1BSGA 1SFEA 4PSXA 4HI4A 2CQNA 1HKQA 4DGWB 1SZVA 3S1YA 4KUMA 2XD5A 4I03A 2FMLA 1NYMA 5M19A 4ZJ1A 4MLLA 1BKCA 3NARA 2POJA 5LHGA 4EU0A 2EX2A 4E6WA 5CVRA 1I2SA 4QJGA 5E20A 4E6KG 4EM1A 1CQTA 2R7UA 4XLPF 3L2WA 1YPRA 3AGFA 2WZZA 3T50A 2C6WB 4Y52J 1IRGA 3KYQA 4Y3OA 1JUPA 1RESA 1SKOB 1XFUA 4B93A 1E3UD 3BQ8A 5FLXZ 1UHSA 3UVCA 1O4XA 2CW7A 1FOFA 1TL8A 3R60A 4HOBA 1T33A 3CI6A 1IAWA 3RCOA 3OHOA 4CYCA 2JA2A 1Z09A 1BC7C 5EZHA 2KLOA 1MDMA 2V79A 2M34A 1XTAA 3HCYA 4UA9A 3K7AJ 1JKQC 4HHDA 5DUKA 4GR3A 4U7BA 5J1YA 4ANJA 1SAXA 1QZYA 1JTXA 1KA8A 4AIKA 3E3VA 2Y55A 2OI0A 4WN5A 2VA0A 2X71A 3EWJA 4HH2A 3HJKA 4PM8A 1FSHA 3C1DA 1D7XA 3ABMH 2ZB9A 3KYCB 3KETA 1OPCA 4WCGA 1D06A 1LLBA 3MKEA 4YIRX 1MPLA 3VP1A 2ZJPF 1IW7F 1E3OC 3IWZA 4RGXA 4FUWA 2XPWA 4JKTA 1MMSA 3LJTA 3H36A 2NOJB 1LDJA 4DDYA 2MYSA 4LB5A 3LQQA 4IQJA 4L19A 4CLCB 2YSRA 4G7OF 3CAXA 3PSIA 3JSOA 1PVEA 1B8IA 1MY8A 2L7ZA 3MZEA 1FSWA 4YFMA 1OR7A 2Y6CA 2AQFA 3CCSI 3ZNTA 3KMEA 2R78A 1G3WA 3P98A 2VT3A 3N8SA 4DBRA 4HSTA 3ZYTA 4RB0A 2ECBA 5EPHA 4O3MA 4A5MA 2O9LA 1R00A 1DP7P 3HUNA 1S4RA 2R7RA 3EEHA 3NBLA 2EBIA 3EPZA 1ZAOA 4QSHA 3A3DA 2NS8A 1C7KA 3OOPA 4GO1A 2VQGA 3E2KA 3JSPA 3MZFA 3N97A 4B9OA 1EI5A 1P4XA 3DL1A 2PAVP 1FIAA 2VQCA 3GUDA 4GD6A 3E5QA 3OYEA 1OMIA 1TWAJ 2KHMA 3KYEA 2NVUB 1VQOI 1GV2A 4ZTFA 3I55I 4O6JA 3U2RA 2CYYA 2VC0A 5EF6A 5KAFC 3VOLA 3ZDJA 1JKRC 3BG9A 3LQBA 3B2ZA 3KP3A 5FQ9A 1PZPA 1LEAA 5M3FJ 3DEEA 2KX6A 2EQRA 4KISA 3J80K 2YX7A 4A2UA 4RLQA 3EWKA 3T1QB 1UELB 1H9TA 2B7EA 4N1XA 2DNSA 5LABA 4ON0A 2ZC4B 2O8KA 1R4NB 4P1WA 4A3KJ 3I9V2 5GADJ 4LK0F 3W8KA 3F8MA 3VWBA 3IUOA 4R0QA 2MC3A 4PJJA 4PDKA 5TR7A 2XF6A 4YIFA 3IXBA 1ETVA 2ZM2A 1XS9A 5F04A 3Q1FA 2XB5A 3W2VA 2VV8A 1TZLA 1FBLA 1E17A 2HF6A 5D1TA 4KG2A 3F8NA 3M4OJ 2EILH 2DBBA 2DK5A 4HZFA 2J83A 3ZCZA 4LG0A 1KE0A 4I3AA 5CPRB 4KUOA 2L9VA 4G7HF 4QY6A 1U2WA 2HGVA 1SANA 4GW9A 3WU1B 1FJLA 1I1GA 4E3NA 4WEKA 2FE3A 3EUAA 4C3IJ 2Y9ZA 3UMEA 3VTGA 5HDCA 5JLWA 5EV0A 1FBQA 2L9RA 2FZ0A 5FDHA 3KZIC 2VKSA 3CLOA 1O7EA 2W57A 4O0PA 5E2EA 4D2OA 3OYFA 2KISA 3BW6A 2XKOA 3HUGB 1J9IA 5F69A 4O7DA 2HOAA 2G7UA 1R7JA 2WWYA 2VUMJ 2KFDA 3I3LA 1JTDA 4KQRA 3BTCA 2WAQN 4PKQA 1Y1WJ 1BKCE 5L3DA 4U0XA 5L3FA 1YG2A 2ZSHB 2EV0A 3TO9A 3BT9A 4BDYA 1MNMC 5FLVA 2Y79A 3BPXA 2WZXA 3BZ6A 2QJ5A 5JHFA 2XAJA 3KECA 4LIVA 3JRDA 4BACA 5L3BA 5CEDA 1OTAA 3EDHA 3PO3J 2ZNYA 4M74A 1LDDA 1DY6A 2H27A 2XFSA 4FX4A 5KCMA 4OH0A 2P5KA 2BTFP 1GV5A 3F8CA 3GTPJ 1E3PA 3A02A 4GB7A 3Q9SA 1XX2A 2HP5A 5L7FA 2ZFUA 4ETSA 5DFXA 4X6AJ 3HUOA 5TJJA 3ZQGA 3IC7A 4ESBA 5IP9J 2B02A 3K4LA 1QRYA 4QPOA 3UDIA 2QKPA 1WGXA 2CH0A 5D5UB 5HAQA 1QIAA 4NBQA 3WU0A 2RC4A 1PDNC 5EVID 3LSJA 1OTEA 2DMUA 2DMQA 3G1MA 2FOWA 1HSJA 2XROA 5U47A 2Z2SB 3IH8A 2EFNA 5GLBA 1WJEA 2NNNA 2M30A 1WI3A 4RAFA 2OW1A 2FUG2 1FPQA 2HP9A 3LAJA 3OS2A 2D5VA 4FH4A 4G3WA 4IEDA 4N92A 4GNUA 2MABA 1J59A 3BOQA 4OVDA 1I6XA 2LH9A 2P4WA 5IYCJ 1VHMA 3BQYA 4XKWA 4RS8A 4DE0A 3S1RJ 4CCKA 3LY4A 4EM0B 3C18A 4XIDA 1EKEA 4A5RA 3KYLA 3BCAA 1MBLA 2EFUA 3CMZA 3UPOA 4WXCA 2A24B 1USSA 1ZG3A 2CUEA 3OYMA 1W8QA 2RCXA 3SHFA 2ID3A 4ZBEA 3O5YA 3RXXA 2OY2A 5F1FA 1RKTA 5CJ9A 3MA2A 2VODA 2WAEA 4UUVA 4G12A 2GZWA 1QGPA 2EJRA 5LRSA 3N2VA 1A85A 3OSFA 1YS6A 2K7LA 5G4YA 4Q8IA 1LE8A 3FBNB 1NRFA 5DM7F 5CHMA 1RUOA 4D9JA 1TF1A 4HP9A 2VE8A 2MC4A 1R6RA 2QLZA 4UB8C 4CDGA 2HEOA 3O64A 2A07F 1RZ4A 2QYOA 2CJJA 5M5XJ 2HU6A 1Z91A 1I73A 3GBOA 4XLNF 3FWLA 4DV8A 3LUQA 1FCOA 3K1PA 1UCRA 3N8RA 3R4KA 4AIJA 1QVTA 1YI2I 2DT7B 2V0UA 1RGYA 1IN4A 1WNIA 1HOMA 1W7PD 3I7IA 1MZBA 3PM1A 3RSNA 1IKGA 3G35A 2I8DA 3CMYA 5EOOA 5EM1A 4E6XA 1VQ9I 2XSDC 5D5WB 2OC6A 1T56A 1SFXA 1S7EA 1ND1A 2WAFA 3TMOA 3H9JA 3R61A 2RNGA 4HX4A 3GMWA 4GLQA 3BJOA 4P6ZM 1JH1A 1IAGA 4QKZA 4ZZLA 4Y15A 3FIWA 1ODDA 3W3CA 4KFCA 5BS6A 5K5RA 4BJ6C 4MMNA 3S1NJ 2XSSA 2E36A 1S66L 1QJIA 3K4KA 1OFCX 3LCEA 2A3UA 3NJAA 1W79A 4CYDA 5A2QZ 2PHYA 2BW3B 3OR2C 4R1HA 2Y2OA 4F3QA 3IBRA 3G71I 3IRRA 1R1TA 4HAMA 4YNRA 2WK0A 3PBSA 1K57C 2QZ8A 2MA3A 3ASNH 3FMSA 1OCZH 4MHGA 3LWFA 3LI8A 1BIWA 3H0DA 2R7SA 2NS0A 2NS7A 1ZLKA 2LB5A 2L54A 4DOZA 5IOYA 1TVFA 4UUTA 4HP4A 4BQNA 5BPDA 2ACGA 3M8EA 1N9LA 4MBHA 3FXOA 4KJZA 5DD8A 3VFHA 3UR3C 4X55A 1P4WA 4LB6B 3DPLC 2J9PA 1XSXA 4GWNA 5HDKA 2QSGX 4WYYA 1WJCA 3V8KA 3IF5A 3MSHA 4JXGA 4DJ3A 1YW7A 3IH9A 1PUFA 4L9TA 5M3MJ 2VZWA 4UQIS 3VPRA 4BE2A 4CICA 5AVFA 1PYVA 1YLWA 2DQRA 4KZAA 1MC0A 2E3XA 4M73A 5EG0A 3UNWA 2W82A 3JVUA 2W7NA 5HWWA 5J8FA 3RTTA 2ZO4A 1XFWA 2XAHA 4MEYF 1VEUB 4I3IA 1SD7A 3KSHA 2VC1A 1VQ4I 5GL9A 3CESA 5C4JJ 3N4IA 1JIWP 2K40A 1WJBA 2WY7Q 4BJPA 4K91A 1Y28A 2PJPA 4A12A 2IWBA 3CCUI 4AVZA 2VJ4A 1I5QA 1SCWA 2KIQA 3IAS2 3WTYC 2RREA 1JIZA 1XFXA 3SZGA 4WF2A 4PM6A 1K55C 4GKUA 1P9QC 3T8TA 3C4OA 1S1ZA 4GJ4A 4AIHA 4PKRA 5AQ7A 4ENNA 2J5PA 3J7ZI 4FH2A 4E7ZA 3SS3A 1PFLA 4G94A 3K70C 3GTGJ 3OV8A 3A4CA 4KIBA 4IN9A 2JT1A 3NX7A 4WBGA 4PFPA 2YPRA 1QHHD 3LA2A 5FFZA 2XEPA 1ZTQA 5DF8A 2PMHA 3L2CA 2K2NA 4EVIA 1UAAA 4HJ6A 1PWUA 3DU5A 3CCRI 3LIAA 3RPUA 1YMXA 3CO7C 5D3OA 1AWCA 3W6KB 1PP8F 3WHCA 2XDMA 1P4AA 4II2A 4WEJA 3FXUA 3CDLA 5D1SA 1RR7A 3RTRA 1BI3A 3CDIA 1RI7A 4X53A 4EUVA 5B5PA 2V0WA 2HKXA 3ZQQA 3ZQFA 1BI0A 4HA8A 1KE3A 2PD8A 2ZXHA 5C44J 4HY8A 1OLTA 2QEXI 1D3YA 2CW8A 3OYAA 4LGWA 3VOYA 5DEQA 1RETA 1KQ9A 4IHWA 5E8IA 4P87A 5HLTA 1RPWA 1ZQ3P 2V8FA 2PJRA 4EW7A 3H7WA 1O0TA 3KSIA 2J80A 2HYFA 3VP0A 2FF4A 1FSYA 3TP0A 3EDZA 3FBIB 3K4JA 1BUDA 3A0BC 4MQVA 1MH3A 1S8NA 1FZPB 1V5EA 4D60A 1R22A 2L7MP 1VQ6I 1WWXA 2WB1A 2K86A 1GHPA 3A0VA 3H1CA 3L7HA 4EJOA 1OM8A 4XLEA 1LKXA 2CQQA 3SEQA 1XFVA 3DWZA 4OQ0A 2HGCA 4IF4A 2VGLM 1OMJA 3KSFA 4G3KA 5DM6F 4KZ4A 2W0NA 1HW2A 3LSRA 2R7DA 1LJ9A 4HMAA 2KL4A 3C2WA 1G3YA 3IX8A 4PUSA 1DGWY 3I7JA 1JTGA 5JMYA 2YS9A 4JF4A 4MIMA 5GLDA 1KYZA 4IX7A 1PWPA 2CO5A 2GXAA 5EJCA 3OR1C 2Y6DA 2KIFA 1E3HA 2ZC7A 2V1DA 4IQ4A 3NQOA 1PJRA 2M5WA 4ZDOA 1BSWA 1QICA 3KRYA 3I64A 1KGSA 1Q2PA 4HYEA 4CH7A 3ZG9B 5E1XA 2OOLA 3TRCA 3ECHA 5H8XA 2W3DA 2GAUA 1T2KA 1K54C 4EUZA 4MBFA 3BJNA 4NC6A 3HXLA 3DLAA 4BEHA 4BEHB 4E3JA 2K2GA 2V20A 1SFKA 4XXRA 4Z9QA 4HEA2 5TBMB 2P74A 2V9VA 5DD4A 2L02A 3HTSB 3RQ4A 5FL3A 3EQLF 4BXUA 3HSEA 3FKIJ 1Y39A 3CCYA 3K2NA 1BW6A 3CUEC 1ROSA 2HDSA 4NKPA 3K3DA 1P0ZA 4HJ3A 2QENA 2UV1A 1K4EA 3UE0A 2HDCA 2ACJA 3RYPA 2K3FA 5BOTA 4B4ZA 1R1HA 3A3EA 4A0ZA 3S7NA 1IC8A 1H3QA 5FROA 1YMSA 3OYNA 3J80Z 4IVNA 3D3OA 4F55A 3KX0X 1BUEA 4U87A 3MQOA 3E6CC 1R55A 5J6XA 1GXQA 3QAHA 3R0AA 3DBAA 3GTKJ 3LEAA 4XONA 1YTYA 3L09A 4F7ZA 1TC3C 2KDKA 1GUUA 2JKTI 1EW0A 3J7YJ 2GJ3A 4OIPF 3UY6A 2MJ6A 2WY8Q 1CIZA 2HVSA 3GO5A 1WA9A 1FOXA 3MKLA 2C5WB 4Q47A 1A35A 1LB2A 5E3MA 2XRNA 4AM3A 3P1VA 3Q2HA 3MFDA 4BD1A 1LNWA 2ZQ9A 5DFYA 3SHIA 1FSEA 1DTHA 4PKTA 4CPKA 5GTIC 2EB7A 1ZELA 2CWEA 5FO5A 4Y5FA 3ULFA 4ZAMA 1GHMA 2FU4A 2ZM0A 1WJDA 4GQLA 1LPQA 1QBJA 1K7QA 2VBYA 2YU9J 3N6IA 3ERMA 2VXDA 2NVYJ 4BY7J 2FSWA 4WF0A 3UB6A 1TWGJ 4D5FA 1YQAA 5FAOA 1YLTA 1UHMA 1B72A 4LCLA 1LEBA 4EESA 5J3LA 2BXZA 2JE5A 5FA7A 3LFUA 3VMAA 3NOPC 2CUZA 2HQNA 3KP6A 1TQMA 1K83J 2Z6CA 3WS1A 1XCVA 4F3LA 4F3LB 5FI7A 4ILWD 4A3CJ 3RFBA 4KN4X 2W3GA 3P09A 3EYIA 3FMRA 4ZC3A 1PWVA 4H82A 1OCRH 4BQMA 1ERQA 4ZR5A 4A6DA 1GE7A 3ZXHA 3W2WA 3I7GA 3T1SA 3FMQA 5HLHA 4JQGA 1GA0A 1B3DA 1OTDA 4EV0A 1ZYRF 5L3EA 2PQ8A 3LFVA 2ZD8A 3Q81A 4IUKA 2LB9A 3O3VA 2FBIA 1G59A 5D8LB 2W3EA 2RKHA 3A03A 3M07A 2R7ZJ 3BZCA 4GYIA 1DGRM 4BHPA 1DU0A 1J7KA 1LSXA 4IBRA 4YELA 2STWA 1MMQA 1JAQA 3I4NJ 2JCHA 3QWLA 4PM7A 4RGRA 1ERMA 4JA1A 4Q0JA 3V8JA 5MC7A 1X3ZB 1NK3P 3R7WA 1KGFA 5E17F 3TL4X 2AO9A 2E34A 2E2HJ 3BZKA 2DW0A 5CXWA 1LSWA 1IYPA 2E8JA 3RXWA 3OPHA 3CUOA 3VYSB 4W1UA 2TCLA 4EQ1A 4H84A 4WZVA 2D1OA 1NRJA 1PRQA 2DMNA 2XIGA 1BUVM 5J4EA 4L5JA 4AIGA 4RM3A 2DU9A 2LFBA 4JOMA 2VL8A 2GNXA 4IEJA 4A7BA 1HD8A 2VN2A 1ES4A 4XM6A 4UV9A 2ZC6B 1A31A 1RRJA 1CK3A 2X1DA 1OO9A 3UB9A 2UXXA 4N1HA 3CUQC 2Y31A 2E8IA 5CTMA 1IGNA 3VE3A 3PSFA 1ZKGA 4RBOA 4ENKA 2Y2NA 2OWHA 2NYXA 1RGZA 2F5DA 4CCLA 3HY9A 4E70A 3E7LA 2BV6A 2IGNA 3ZQLA 5DKKA 4S2NC 5E18F 3CMEI 4LMYA 1FX7A 3V96B 1IFQA 4IHQA 4H30A 3GQZA 4JP4A 3HL2A 4QPQA 2D1HA 2E19A 3H82A 2WV1A 2CQKA 1JAOA 5K7HA 5EGOB 2D1NA 1MMAA 1TQIA 3LO7A 3AG2H 1O0QA 3I59B 1ZS0A 2FNPA 1D5VA 1OCTC 5E2FA 1MWTA 4CLCD 3DP7A 1LI9A 3F1NB 3OSGA 3PXPA 3CCLI 5LRRA 3G3ZA 2X3BA 2WGVA 1D1AA 2OLUA 4H3XA 2XAQA 1B6AA 4II3A 2EFWA 3CP8A 4YG2F 1ZTUA 1U3EM 2DOFA 5IT9K 1ZVXA 4E7HA 4X25A 4XOTA 4U0VA 4NQWA 4BU2A 1K6SA 3O2XA 2GOMA 1VQ7I 2ZXWH 2WB1N 2BZTA 2ZXIA 3F1AA 2M7BA 1N9BA 2W14A 1AWIA 2DDYA 2EZIA 3UDFA 2JT6A 3KP4A 2IS4A 3W6JB 3GLLA 2P7JA 2JA7J 1I27A 3RTSA 2KIUA 3SH9A 1X58A 1BZSA 4MQ9F 2L7FP 1LFBA 3S7PA 4P9UA 3U1DA 4L9VA 4PCQA 4Y0OA 1GVJA 3ZG8B 3CKIA 1T1CA 3G30A 1U8BA 1XSDA 1Z1DA 4M6VA 2XLNA 1REPC 4EM2A 1K38A 4OP5A 2CLTA 2K9MA 2VJ5A 5B1AH 4UVBA 4I6ZA 3DPUA 5CGWA 5LFAA 4FCFA 3FKJA 1XFNA 2EWVA 3H9QA 3IQAA 1K57A 2PR5A 1S9HA 5H20A 3HEFA 4RGUA 2BG1A 4DF9A 4P9FA 1IUYA 2BY0A 5M5WJ 4OQIA 1CXVA 3BFFA 4A0YA 2NVQJ 3IKVA 1Z6TA 1UWPX 1BYWA 1JAPA 1CF0A 2QWSA 1RP5A 1BULA 2DW2A 5EVIC 1TDGA 2EWWA 5HPFA 1LQ1A 4PKUA 3DTEA 3SH7A 1PWWA 3F18A 1SFUA 2ZLYA 2R5YA 3JW4A 4FTHA 3SDGA 3ZG5A 3E4PA 4WK7A 2Q1ZB 1SVOA 2MW8A 1EB6A 4JXWA 3SOIA 5M5YJ 4OPYA 1G12A 3ZXSA 3QOPA 4YIIA 1MMRA 3JREA 3OWTA 5CGSA 1MMBA 4U88A 1TP4A 3V8LA 3FK7A 5FQMA 4ZYHA 4F93B 2XPUA 1RCJA 3JRAA 3PBOA 1V4RA 5EOEA 4N9KA 2OZ6A 4H6JB 2Q2EA 1W36D 5DKLA 1YW8A 1RMZA 2WO8A 1OTBA 3IWOA 2VGLS 3TOIA 2LP0A 2E5ZA 3HOXJ 1N9NA 4G9YA 2F5FA 3W4OA 2HQ5A 5CVJA 2KDZA 3LJGA 3HOWJ 5CERA 1QQIA 4Y3IA 4FETA 4WMCD 2IEKA 2FXAA 3HHHA 4MBKA 2E60A 3TVCA 2L0WA 5BOHA 4L9EA 1ONGA 1K55A 1VQ5I 2QUFA 2VQHA 3WWXA 2LDUA 5HDNA 3C5AA 4S05A 4J4MA 2CGPA 3PUBA 4HNTA 3H5NA 2XPVA 1EH6A 3CPTB 1IACA 2PYRA 4HQEA 3VB2A 3TSGA 4CCMA 4UUSA 1ULYA 2ZMVA 2P7CB 1MBHA 2F5VA 3ZQCA 3UE1A 5L3GA 2QYBA 4FISA 5I4OA 4WZ4A 3LQRA 2O0YA 4IO9F 4E7JA 2HDQA 4A3DJ 5M1AA 2WKEA 2M8EA 3LUMA 3WRZA 2KRHA 4A3WA 3G1LA 2LKPA 4PKYG 3SH8A 5TGFA 2FJ1A 4IHVA 3MQQA 2FA5A 1JUMA 3G42A 3GVAA 5IP6A 2JNPA 2CQ7A 2KQRA 3OZHA 4KUKA 2JQ7A 1C8TA 2ZMEC 2NVTJ 1OTIA 3JCUC 4L5EA 3CF5F 2Y2LA 3F0CA 3W4PA 3F15A 3WE2A 4DE3A 2HFHA 2OVXA 1UMSA 2DI3A 1HFCA 4AUOA 2JWTA 1IYOA 4I3JA 1OS2A 3AKZA 3H0GJ 2DOAA 2LBFB 3AGDA 1MBGA 1TNSA 1ZG1A 2ZQ8A 2X9DA 4I09A 3C38A 1GO8P 4WM9A 966CA 1MIJA 1YQYA 5I43A 1OS9A 3SFIA 4DZJA 2Z2LB 4DXBA 1MMNA 4FCYA 3K1MA 4MN7A 1O07A 1IELA 5B5EC 1Y4OA 2CU7A 5IT3A 1V5GA 3NWTA 1UEAA 1SHVA 2EZHA 5EECA 1HXDA 4PGGA 2VBWA 2QBYA 3CMAI 3ASOH 5ED4A 1Y6IA 3A3JA 3ZMUA 1EA3A 3BQZA 4PKYA 4I2OA 3GSGA 3OYIA 4BL2A 2E71A 2EX8A 2HNHA 4ARZA 5LBRA 3Q7VA 1WZ2A 1ZGJA 3HM5A 5IYBJ 4CHUA 2JSDA 2COBA 1XGMA 1MWSA 2DA6A 1RIOH 1P6RA 4OPRA 3G5CA 3HDAP 1WKMA 3HTUA 4GS9B 2H1LA 4AWXB 1ASTA 1D5YA 2ECCA 1MJBA 4B8XA 1F4KA 4OOLA 2ERPA 1U9OA 3W6VA 2KZGA 4ASNA 3DPFA 1IUFA 3MXQA 1MMPA 2HZTA 1KUIA 3IF6B 5ILSA 1U0JA 3J81K 2QQ9A 2RJQA 2D02A 3A01A 3A01B 4O01A 1K54A 2YIGA 3NEUA 1TD5A 1K4FA 1OYWA 1L0DA 3IXDA 2PBYA 4IHSA 3OIOA 3WTXC 1A0KA 4IHTA 3FKVA 2F4IA 3S8PA 1X19A 4I5SA 3GXOA 2FFYA 4LOCA 4K08A 3Q07A 3V7RA 4AIDA 4U0TA 2V6EA 2VJJA 3ABKH 4XICA 2IWDA 4F92B 5EEGA 1ON1A 1EROA 4DBQA 2DFEA 1G4KA 3V3SA 1T0FC 3CUEA 4L7AA 2STTA 2L3DA 3OL4A 3L1PA 3DLLF 2KZVA 1H89C 4KZ8A 1MSEC 4PGHA 1Z21A 3TDZC 2AXTC 2E2DA 3IWQA 3LL7A 1FIKA 1FQGA 3WG9A 3OIQA 3JR9A 5DVAA 3S16J 4BHBA 1Z3XA 3WTSC 4CCJA 4RMNA 2B95A 3BR5A 5I2ZA 2K9NA 1FMWA 2DDBA 1P2FA 1YP1A 2HPBA 2XR0A 4M6YA 2LK2A 4GRIA 1T38A 1SDNA 1Z77A 1T8IA 1UTZA 1FLSA 5EYRA 1KYWA 3S93A 4JGPA 1O7LA 3BWGA 3U1KA 1I5ZA 4M3GA 2JRMA 2VASA 3H9GA 3VOEA 4BJTA 2FBHA 3LFKA 4XLAA 3BRMA 5HLGA 2E1MB 4KT6A 3B47A 1I2WA 1ZRDA 1H8YA 4WX9A 3MZYA 2FBKA 2MLGA 2Y69H 3PIOF 2X1EA 1ETQA 4DNCA 2XA7M 1U5TC 3R0JA 1K78A 1GA9A 2J3TD 1HW1A 1LL8A 2XSJC 5F1JA 2HDDA 1E3UA 2M0MA 1UFMA 3F21A 4Y0TA 1FBUA 3UNGC 2WV0A 4EGZA 1PZOA 2NUPC 1AKHA 2K85A 3CMMA 1CQAA 5D5VB 1YFHA 2O3EA 1G05A 4XRSG 4C2TA 2Z33A 2NRAC 4MTEA 5HZHA 1G49A 4W97A 4XORA 4KZ7A 1IRZA 3OIPA 2XRLA 2DFIA 1YITI 4L0LA 2CMNA 1ORKA 2K4BA 1YLYA 4L9NA 1HDDC 3NRVA 2OXWA 1S29A 2H0YA 1MH4A 4Y33A 2VPLA 3ZN1A 3QPHA 2MH9A 1APLC 2YKFA 2Y2HA 1VETA 3JRFA 1F98A 3TBIA 3BYDA 5FKOA 3KYZA 4BL3A 3SXYA 2V8CA 2QQ8A 5J8XA 5ICGA 3UPPA 4S2KA 1HC8A 3NCKA 2Y2ZA 4NXBA 1SU3A 3HPGA 1SATA 1KBCA 3G2YA 1ZC2A 1YRNB 2V7FA 1QHGA 3W4QA 2Y2QA 5A91A 2DK8A 5F1GA 3HYIA 2F48A 3GX4X 1JANA 2J0TA 4DE2A 3LSGA 2R4GA 1TW2A 4XKBA 1QZEA 2ZQCA 4A93J 1BBYA 2HXIA 2PD7A 1M6KA 3MD2A 3OLOA 3JVVA 2LY9A 1QO0D 3WTWC 2AXLA 4RAZA 2UXNA 5KSHA 2ZKZA 5IOZA 3GDIA 2XD1A 4HV5A 3JRIA 3A0RA 1TW3A 2MZEA 1OYYA 1G2HA 2N8GA 4P55A 4R23A 4YRVA 1GDTA 4M4XA 3NC8A 3KHIA 2W1OA 3T1XA 3FC7A 1FBSA 3M6HA 4PK4A 2OU2A 1YAXA 3I53A 4IJAA 3CHWP 1T39A 5IP7J 3ZFZA 3N7WA 4A0XA 1MZUA 2OAP1 1FM1A 4RGSA 5CEBA 1N4OA 2L4MA 2YKHA 4M9ZA 3S32A 3GMEA 2QQBA 4IHYA 2RVCA 3BECA 2WADA 5J1RA 3CTAA 4R4SA 2K9QA 4G7ZF 3CJQB 3U4LP 1MBJA 4M6XA 2A5YB 2DDFA 1PWCA 2XGXA 2PT7A 3F3XA 3OHLA 1HZOA 3TQNA 2BE5F 1MBEA 1PI4A 3C4PA 4MNUA 1B9NA 3LOCA 3L0VA 3UB5P 5HWTA 3AL0B 1OJ5A 2K4JA 1NH3A 1D8KA 1SD6A 4L6TA 3WTVC 2NOGA 3P24A 3CUQA 4OLGA 1FY7A 2LY2A 5LD2C 3GFMA 4L0YB 3S14J 3D1NI 2WGWB 1WHUA 5LEKA 2P5LC 1WI9A 2VJIA 2O36A 1Z05A 5TISC 1I39A 2VV6A 3LKAA 1VF9A 3LEZA 4S2NA 5IHVA 4NHJA 1A6IA 3LUNA 1Y0NA 2JPCA 3TT4A 3BM6A 1EUBA 3RTYA 4X0GA 1OPXA 3QP5A 5IT9Z 1OJGA 3BJAA 5ICEA 2CS3A 1DJBA 4ZYAA 2RQPA 2VONA 3HLBA 2F5CA 5IU1A 4JGOA 1AU7A 3F19A 4DD8A 4XBFA 1ERDA 1USTA 4KMUX 3ZVTA 3MXSA 5CVIA 2EZLA 2Z99A 3FISA 3CC2I 3CDHA 3RIRA 1HKTA 1R58A 2VBZA 3PBQA 3E0YA 1G6AA 3B42A 3TSKA 3F6VA 5I94A 3KP2A 4HEFA 1L2SA 3VE4A 3GTMJ 3E6MA 4KZ6A 3USNA 1ES2A 3K3CA 1WPKA 2VXZA 1VQNI 2BY2A 4ZJ2A 3DWKA 2XAGA 3L2UA 4AUXA 4M3BA 3NDEA 1WQ2A 1Z7UA 2I9VA 4ZTKA 3SZPA 3FZVA 1AKLA 3MCZA 3MZDA 2W1TA 2W1TB 5EDNA 2F6CA 4LLOB 2H09A 3REOA 2SRTA 4QB8A 1SVLA 1HBXG 2P0WA 4B3XA 5HS9A 2DOEA 1S4BP 1O3QA 4ZYDA 2E5NA 4UA6A 4DYQA 2LNBA 2A05A 2L9NA 3E8RA 2VX8A 1ALQA 3QP2A 4UAAA 4C2UA 5FRNA 4RLFA 3CCEI 3DFGA 2R9WA 2H1KA 2X6OA 2ZFWA 4UNOA 4Q0HA 2Q9MA 3T4JA 4CYCB 5AJGA 2BHZA 3HRMA 4FHTA 3A0HC 4MNRA 2A6HF 5TFQA 1MDMB 1DJCA 1W5DA 4JXSA 4PJ0C 3OS0A 2VKVA 4OMZA 5HX9A 1LT0A 5DF9A 3E98A 3CZDA 4BUPA 1YT4A 2KDOA 4AD9A 1HDPA 5EVIA 1H9GA 3LSIA 5CGXA 3BFEA 1HSTA 1O57A 3T12B 1D8JA 2ESHA 3ABUA 1HFSA 3GFIA 1T6SA 4D7NA 2ZBKA 5H2FC 4DPEA 1AOYA 3G6OA 1IN7A 4HX3A 4IOCF 5HD5A 4L63A 2IT0A 2PBDP 3KEYA 1HKSA 4B44A 3PTEA 2VLAA 3OOUA 2O99A 2QWWA 5FEFA 4U7DA 1B8IB 3UE6A 1IXSB 2CG4A 1NHAA 2OCEA 2LOOA 2UWXA 3RZDJ 3N4MA 1JXSA 1YX5A 2DT5A 4LPZA 2P8TA 1T98A 1S1YA 3IS2A 3KPHA 4K2EA 1P7JA 1JT6A 3F1PA 3F1PB 2O3FA 2A61A 4CLCC 3KEQA 4G3VA 3DEWA 2XFTA 4E7LA 4Q48A 4OOYA 3N05A 4X69A 2IBDA 1GXDA 5EUAA 3C7UA 2W3HA 5A8BA 2DA2A 2OAQ1 2Z2DA 4MCWA 3ZQIA 2Y8HA 2G0EA 1L0EA 4EEFG 1VNDA 3M2JA 1YSPA 2M3AA 1GHCA 1MNDA 2H6CA 2L2OA 4OAZA 2ZSIB 5FKKA 4S2IA 5JR3A 4JYKA 1W7PA 2W15A 5G4ZA 4JGRA 5ICFA 1TWCJ 4GYGA 4KNYA 1B59A 4AC0A 4NETA 4AYKA 5CRFA 3U21A 2NNYA 1M1EB 4BDZA 3S2DJ 4GGGA 2I47A 3SFZA 2JA6J 1XB4A 1NLYA 4JX6A 3KZZA 3ESWB 3TJZC 3LR3A 3HGYA 4IJOA 4B4CA 5HS7A 3UPNA 1T95A 2JK3A 3WGIA 1NJ4A 4KICA 5L3CA 5K7ZA 4GCZA 1CI8A 1W63Q 1KU3A 4OAYA 2FRHA 5KAIC 1ODVA 4HH3A 1TS0A 1JT0A 3BR6A 1H5XA 3RPQA 4L9FA 5FB2A 3D5RC 4JXVA 3ECOA 4HNBA 3B6AA 2QVOA 3V7CA 2OQRA 3SJMA 3VV4A 2ZMEA 3TW6A 1BTLA 1A86A 3GEZA 4JQFA 1KQ8A 3V42A 1IAAA 3S4XA 1KVMA 3ISPA 4XN0A 1K7GA 2I72A 4RAGA 4GDNA 2BLSA 4FX0A 3T5XA 3G34A 1GKDA 1FP1D 2MSYA 3C7VA 4LG0B 1X3WB 1O3TA 3GVBA 5CQGA 1KGGA 2VV7A 3ELKA 2ZCWA 4M3EA 4LLGF 4Q0IA 1IABA 3H5RA 5G18A 1ESIA 2RGVA 1FYKA 3LJZA 2Z3YA 1A5JA 5AIPA 3F23A 3TW8A 4BBRJ 3BY6A 1OT9A 2P7VB 1BC8C 1QPIA 2XA7S 1IRXA 3O87A 5GTHC 1X3UA 2DRWA 4JGQA 5CECA 4S2PA 2OXUA 3FWEA 1UWNX 3EOIA 3HGGA 4DXCA 2O9BA 5A92A 1D8MA 2X3AA 2QSHX 1SAUA 3C2HA 4B4XA 2INWA 3I5UA 2XV4S 1W36C 3LR0A 2GOXB 1O7FA 4EQQA 2YUFA 1NYYA 3OY9A 2P9VA 2DFFA 2OUMA 3J81Z 3LSKA 5J47A 5I5LA 1EWZA 1K6YA 1RNLA 2QM3A 1EH7A 2TDXA 4ZH4F 4XSZF 1GVDA 1MKMA 1R5ID 1TNTA 4CO8A 4ESPA 2V1ZA 3O88A 3KFWX 1XPBA 1NY0A 2Y48A 3AG1H 4D5CA 1XP4A 4JX5A 1EV7A 2XASA 1TQPA 3MFXA 3F9KA 2ZQAA 5BPAA 4HW0A 1S6RA 1ES3A 1UTTA 3K69A 3AYKA 3DTKA 2ELJA 3S7QA 1QVUA 3ROUA 4QWOA 3JAMZ 2XGDA 1A36A 4OOIA 3VI1A 1T08B 4DJAA 3PO2J 3Q2GA 1Y0UA 3LIFA 4FU4A 3GZ5A 4XUXA 4LRYC 4R1GA 4RQ9A 3KWVC 3MKWB 2XF5A 2NUTC 3WS2A 1V55H 2BYVE 3QU6A 2C6YA 3IBJA 2G2WA 3EDGA 4S0HB 3ITAA 1DP8A 5ILUA 3MS6A 1T0FA 4EMSA 2GXGA 1XGIA 2VGKA 5AONA 3E0JB 3SZTA 4C9YA 2ZM8A 2VJWA 4R3AA 1HTZA 3HBLA 1J09A 1VQ8I 4ESJA 2IW5A 3T4KA 2ZJRF 2EH3A 1XUCA 2MG4A 3B3XA 4MN6A 4EEPA 4IRHA 3Q3SA 1YHQI 2A3SA 4DJ2A 1ZHFA 2VB6A 2IS6A 2RL3A 3IWIA 3F1OA 2CSOA 4UVAA 4HLXA 1KUHA 456CA 4C3QA 2K5CA 3TG9A 5FJ8J 4RM2A 2CMPA 4R8HA 3BLYA 1K56D 4G0DA 2BEOA 5D5XB 2IA1A 2YUSA 1JKPC 1LE8B 3CITA 3D72A 1SLMA 2OV7A 3NULA 2QA4I 1YLJA 2I5UA 5FEGA 1ZLJA 1JWZA 3F17A 2WA0A 2ZC3B 2OTJI 3PBRA 3BDDA 1NXYA 3GFLA 4RYEA 2HYJA 3PFYA 4ZJZA 2ZC2A 3VP4A 5F08A 2HDRA 2XAUA 2FD5A 3I4PA 1UMTA 5EZGA 3GFJA 1JJ8C 1U60A 4GCVA 2O6GE 4KZ9A 2JRTA 1X1DA 5ICCA 2M1BA 3B8ZA 1E4DA 2R92J 4HBLA 3QPTA 3MF0A 1P9WA 4UHTA 4FT8A 4BE1A 2HJ9C 4A6EA 1RUNA 1Y93A 4X1LA 1TWHJ 1BR1A 2XF7A 5IY5H 4BBUA 2HXOA 3BG7A 3EGXC 4FQGA 2IA2A 3DNGA 4LV3A 2K3PA 3DBHB 4N9LA 1QMFA 5JYPA 2MBFA 5HS8A 2V6CA 1S67L 1ZP5A 2JVGA 1FOYA 3ZCOA 1GLNA 4EJWA 3PR6A 4QWQA 2QPJA 4HQAA 5L09A 4E3KA 2ZOHA 2EFXA 1LSVA 3S3MA 2Y30A 5FQQA 3UB8A 4LRXC 5F64A 2FNAA 2RAEA 4QIWN 4HESA 3OYHA 2XUBA 2AIGP 4PMAA 4Y7NJ 3O6BB 4ZDLA 1GSXA 4JBAA 2LD5A 3F8FA 4LK1F 1EJ9A 4NXGA 3Q7ZA 2TRTA 2ZL1A 3NAUA 2Q9NA 3PNYA 4I01A 2M9HA 4Q5SF 3V67A 3MMHA 1IZ1A 2A5WA 4OOMA 1QU3A 2PR6A 4LV2A 5HFOA 3VOZA 5JYOA 4H8RA 1B8YA 1NTCA 1DJAA 2DO7A 2PU4A 2FOKA 1UGUA 2QKMB 4XMYA 1PUFB 2HOEA 4R3BA 4KQQA 3PNVA 3FDYA 3D4FA 4I76A 3M7GA 5AQAA 2X0LA 1YE9A 4HLYA 3LIBA 1SD5A 2HKOA 2HVRA 5EG0B 2HV1A 2CV2A 3EUHA 1G68A 1DUXC 4X68A 4N4NB 2D01A 4GXOA 1KONA 4GR0A 4WKIA 1Z6FA 2V1BA 1SMTA 3GZ6A 2VKEA 1ZRFA 1AXBA 2PYPA 1KUGA 4KG6A 3T4LA 4ZRRA 1TS8A 3CWFA 1IDYA 2G9WA 3KIOA 2L4RA 4R3VA 2OVZA 3ONQA 1UHWA 3NOTC 1ZR4A 1LI0A 5F6AA 4OQHA 1I1SA 2FH5A 2JT5A 4NXEA 4XKVA 3V50A 2J3TC 2PG4A 5FSRA 3GECA 2JJ7A 3BLMA 2CRGA 2ISZA 3WS5A 1F9IA 3OYCA 2J9OA 3KO6A 3W2AA 4XK4A 1HA8A 2A69F 1VB6A 2G7HA 1ACFA 5GHXA 2VE9A 3MKYB 3EGDC 2DPDA 1XGJA 4DYRA 1MNEA 3V4GA 4DZPA 4IUHA 4DW6A 5CXAA 3HJEA 3LYXA 5HW3A 1SVMA 2DTRA 2KKOA 3K4MA 3KP5A 5BPIA 5K1YA 3G4PA 4IHXA 5EFWA 1K25A 5H6QA 3U9GA 3LE9A 3HBRA 4MFEA 4E3LA 2IPQX 5EEAA 3BQAA 3WV3A 4HF1A 3VYTB 4EFSA 2HR3A 1BW5A 3WHBA 4M9XA 1BI1A 4IBXA 2PFBA 2R5ZA 3F72A 2PN6A 1TWFJ 4LLNA 4C3JJ 1V9YA 2H8RA 4XT2A 4XT2B 1ETYA 5BOYA 2EX6A 3FM5A 3H35A 4KYWA 2BBYA 2ERQA 1XFYA 4I02A 1ZG4A 1NG7A 4E4HA 1ATLA 2H94A 2X6YA 2PJRB 1IADA 3BROA 3H7WB 1OCPA 2EZKA 3KP7A 4HJ4A 3OOVA 4ESFA 1VFCA 5FAQA 4R6LA 2DMPA 1R23A 2EXAA 3HY7A 1XUDA 5GHYA 5D1UA 1OISA 4A3JJ 1C3BA 1M40A 2MZIA 4OMYA 1R71A 2A49A 3EQVA 3AYUA 4XLHA 4WKEA 1TEMA 4X1EA 1LVKA 2O8XA 3BTJA 3G2ZA 3WS4A 1XC5A 3K4NA 2UZKA 4NK3A 3LMMA 2X6WA 1T19A 2TCTA 2OXZA 2KLIA 3FKWA 3S1QJ 3L9KA 3FX3A 2XAFA 4F94A 3DW0A 4RDUA 4WXDA 4E3MA 5LBQA 2EIKH 4FE7A 5FKLA 4UQIM 1YX3A 4XLCA 4ENJA 3HOUJ 1SKOA 1FT9A 4BNCA 3B73A 3COAC 4B43A 1N9OA 3E2LA 3Q9VA 3BJ6A 5LHIA 2WGIA 3A0SA 2LMDA 3RYRA 4LG3A 4KITB 4QU3A 2JMWA 4A3FJ 1XGNA 3L2QA 4EEUA 1IN5A 1JTYA 1QPMA 4PAUA 1GSWA 3LGOA 1BOAA 1P7IA 1VZ0A 4LENA 3B02A 2E7WA 1SRPA 3K7NA 5EM0A 4XKCA 4G9LA 2X02A 2HOSA 2DYRH 3MFKA 4C2MJ 5FFXA 4UVCA 1WH5A 3LIDA 2X48A 5GAHJ 3DBLB 2Y2JA 4HSRA 1I50J 4XM7A 2JIHA 2P5VA 1QUAA 3S7OA 1QJJA 2W12A 4KMFA 1LHYA 3T4QA 4OLDA 4RX2A 4DIQA 4DE1A 4HIAA 2JPBA 2XVCA 1MNCA 3HB2P 5HL1A 1FTTA 1AA7A 1WJFA 3HB9A 1BLPA 1RM8A 3F8BA 1TTYA 4CLCA 4E3IA 2IWCA 3IP4B 1S0WA 2EIJH 5GPAA 3KEJA 3ERED 4J00A 3FG8A 3E4QA 3HHGA 1G28A 4V19K 1HVBA 1Z3JA 3MN2A 5EVLA 3SS4A 3TP3A 3O3KA 3G73A 3BG5A 4JX4A 1OCCH 1BOBA 2V4JC 3D0SA 4JPAA 2R7OA 2A8HA 3ZMDA 1MJ9A 2DJNA 4NC8A 4YFXF 3CJRB 5I12A 4B47A 2L1MA 3KLNA 3KSGA 3CLQA 1FMVA 4PKSA 3HYGA 1S7OA 2BVMA 4HBTA 1C3IA 1JNUA 4ON1A 2GA1A 2W13A 2KIMA 1YCMA 3RZOJ 2LLKA 3ZN0A 4GOGA 3MWMA 2VOOA 4S2JA 1DRMA 3K0LA 3DPTA 4RAYA 1J2XA 4QPRA 2VPRA 2WOAA 4GDBA 2P04A 1JKYA 3WGHA 4YOFA 4LV1A 3DTMA 3ZPLA 4QTRA 3NDGA 3K7LA 2HPIA 1JKOC 1PW8A 4H0EA 4ZTJA 1MWUA 3DEUA 4XM8A 3N8LA 3QNBA 5D2BA 5A90A 3HL9A 3CCJI 1Q3AA 2JC7A 1S5LC 1BT5A 4ZDPA 3QHYA 4G8XA 2M4GA 2GBYA 3E5UA 2CUFA 2EV5A 3W2ZA 4OQGA 3HLWA 3OYGA 5JLXA 2GIZA 3A1YA 1B72B 3IHBA 1KU9A 2JKFA 1PUEE 1ETWA 1IYSA 3GLXA 2KP6A 2R7WA 1XA1A 1L0OC 2IXSA 5FGMA 2QJ7A 1F36A 4RA7A 2XB0X 4KZ3A 2BVLA 1KDSA 3LR4A 3OC2A 2JUGA 2Z16A 4I99C 1W5TA 1Q1HA 3MAJA 1IXCA 1VQLI 2PDRA 1VI0A 2V1XA 2LC2A 4ETXA 3B33A 4HF2A 4UXNA 1ETKA 4ITVA 4CZCA 4Y4RA 2M0CA 2RJPA 2HDWA 3HLDA 2Y59A 3WV1A 4LIUA 4DRTA 1ON2A 3MR0A 5L10A 4BL0B 2JA8J 1YJ9I 1DP3A 3PFIA 3S17J 2MGQA 4CGZA 2WUQA 5E3OA 1FILA 4R38A 4I35A 5FATA 4HF0A 3A3IA 3ZOBA 4D1QA 4CSWA 3FPWA 3HRUA 3HUGA 1WE4A 4L0ZB 1XFZA 1YLZA 4P96A 5TGTA 2DCEA 2YR2A 4WMCA 5E3LA 4BGDA 2A6EF 3QYFA 4P6ZS 3K4CA 3IRQA 3R7WB 4HNUA 3S2HJ 2OQGA 3IX3A 4RX3A 1Y1VJ 1CEFA 2QQAA 1G6NA 2ELKA 2RN7A 4IVIA 1N75A 5DYMA 1OQYA 5HNHA 1DQUA 3K10A 3LIKA 3HOSA 3GW2A 3ELMA 1TVIA 3S3NA 3PL8A 3OBFA 1BM9A 1T18A 4S04A 1XA7A 1FYMA 3DQVC 1NWZA 3VODA 4JF6A 5DDGA 3S3OA 3KYDB 2HQRA 1F1ZA 1B9MA 2OAZA 1SMPA 3S15J 3BG3A 2Z2MB 5BNGA 4HX8A 3ZMSA 3FXLA 1H8ZA 4JPMA 5IYDJ 4Y2FA 2L7KA 1BL0A 1UG0A 2VT2A 4G6TB 3Q0UA 3SW1A 4A3MJ 4QLCU 2M7UA 5E8GA 2AYKA 2A6TA 1MW7A 2O9AA 1OMEA 4NNJA 3V7SA 1OJLA 4EBPA 4WK8F 1WYBA 1W5CC 1Q1VA 2E1NA 4NEED 1WVRA 2V1UA 2E1CA 3H82B 3ZVSA 4KQOA 5DF7A 3JRHA 1DP9A 3FXJA 4CLCE 2K31A 3HZJA 1YW9A 5TRDA 5JFRA 5D4SA 2W4SA 1ETOA 3LY3A 2W00A 4PHTA 2M87A 2RV8A 3KEOA 4KZ5A 4EETB 1K4SA 1Z9CA 2DN0A 3WS0A 1ZXVA 3ZR8X 2A24A 5FI6A 3VFFA 3WODF 3BFCA 5AQBA 3HLFA 2W0DA 2MH2A 3RKQA 1K4TA 2DCFA 1H8AC 1IYQA 3BY8A 4NQWB 2FV9A 4FXYP 4A3BJ 3ZQ5A 3X2QH 4MDZA 1YS7A 1X0OA 2HP6A 2PMZA 4PKVA 4DKIA 4N0BA 2F2EA 3I0TA 2GDNA 1D1CA 2AQEA 5KMWA 4HOIA 3M8JA 1HOVA 5HODA 3QP4A 1PYYA 1VTNC 4FE4A 1V54H 2CFOA 2XGNA 3PAEA 3HOYJ 4JBFA 2HTSA 2ZC5B 4GF1A 3ISGA 1OZ9A 3HLCA 1IKIA 3E6BA 3K9TA 1V5FA 4DQ2A 3CCVI 1IO2A 4BS9A 5KK1A 2BXYA 2JKRI 2J5OA 2PBIA 2JKTM 1GO7P 2JN7A 1CI9A 1KGEA 3VSKA 1YO5C 4BY1J 3EETA 4ZDXA 5CHJA 2DODA 3TO7A 1J0RA 4WUJA 1N77A 4IRGA 5CVUA 3MZ8A 1GE6A 4F52A 2L0KA 4ZZDA 3VYRB 1UJ8A 1WRJA 2MLKA 2G2UA 2Z1DA 3T4TA 4A69C 1XMKA 3OPRA 3G31A 3OYBA 2F4MB 1Y8QB 5DTKA 2RQQA 2Y2MA 2CW0F 1XDUA 4GD8A 2OF7A 1H0MA 2BW3A 3PQJA 2R5YB 2VLGA 2O5RA 4RB1A 3LILA 3H3VK 2LTPA 2FQ4A 1KU7A 1FOKA 1SC7A 3QYEA 4ZYGA 4OKPA 3BR0A 1FNNA 3MMYB 1UG2A 3NWSA 4MLOA 4LRZE 2R7XA 4UEYA 5IPAA 1BA5A 1X2MA 4I0BA 1WFXA 4A3EJ 3HRSA 4R79A 1OKRA 3G6EI 1USNA 2X4HA 2GQQA 1U6GA 3E4OA 1GHIA 5HNFA 2ZJ9A 5A93A 3E5XA 2MD5A 3OYJA 2IAIA 3L2VA 5AQ9A 4KDPA 5EE8A 5HOOA 1WYCA 4K0WA 4CUGA 2V4BA 4RB3C 1BLHA 4J01A 1ZREA 2W3FA 1XDSA 2Q2EB 1S4SA 4PFOA 3NI9A 4XOPA 3QODA 4A3GJ 2R3SA 1QA6A 3FZCA 3ZMZA 4XBHA 1D0XA 4II7A 1FTZA 1WCMJ 3JRBA 1BJZA 5F0FA 2DXIA 3MBZA 1IV6A 3C2GA 5GP9A 1FR1A 1DDNA 3CCQI 2MLRA 2IA0A 2H5SA 4LD5A 5FAPA 3PUFA 5F1RA 1VEUA 5LLQA 1HCRA 4C75A 4EBNA 5K5BA 4DN0A 1D5JA 5F27A 2EV6A 1I6HJ 1K6OA 4H76A 1PNEA 3M3YJ 1IV8A 3FXQA 1KUFA 4Z2YA 1XX5A 4OU0A 1D1BA 3PAGA 4IPAA 1DPUA 2IS2A 4A5NA 5CHUA 1XKZA 1R1UA 1XG1A 3LI9A 4BBVA 4R3JA 4UUSB 2DA5A 2EWNA 5DTDA 5CUHA 3ZUKA 2D1VA 2P81A 3WTTC 3LR5A 3EDPA 2MLSA 2W24A 5D6FA 1R5HA 1UMQA 3QP1A 2Y9YA 3OS1A 5FD6A 3G2BA 1DP6A 2GXBA 3IH4A 2JA5J 2OA4A 4IZZA 3HDBA 2MZHA 2EINH 4YEJA 1IN8A 4AVPA 3N2UA 5M18A 1P9RA 2VI6A 1XJ2A 2EFPA 2ISYA 4HNVA 3O8GA 3CP2A 2LVSA 3CQZJ 5H6RA 5J3WA 3RJPA 3IHUA 2OLVA 1ZGAA 1ONVA 5HWVA 1KUKA 4WWCA 2DQLA 5DJTA 3OCNA 1W0UA 3JPUA 4BHCA 1MJAA 2DLLA 5J40A 2ZNZA 3OPPA 2ME6A 2OV5A 2FEZA 2VBXA 5L8MA 4M3FA 1NZOA 4EERA 2NAZA 2A68F 1H8MA 2XK1A 3T1BA 3GR2A 2Y2IA 5KSCA 2J3WA 4ZJ3A 3I71A 3MJQA 2DDAA 4LITA 5J4VA 4H1QA 2LRDA 1L3LA 2HWVA 3A3FA 1X1PA 4FXQA 3DV8A 2QBYB 3JTHA 2ID6A 2DT6A 4KA4A 3BR3A 1HW5A 3CG5A 4RA2A 3OCLA 1IEMA 4B3AA 1R49A 4QD4A 1XJ3A 1Z3YA 4ARZB 1G3SA 2MD0A 4BXXJ 3Q7VB 2AVXA 1ONHA 1XD7A 2Q8KA 1O3SA 1JJ6C 3CC4I 3UMDA 3LGPA 2K9CA 1LUJB 3KE2A 5JVGF 5J8CA 3SS5A 5HLIA 3FXMA 1BQOA 3GRJA 4E7SA 2VKDA 3FF5A 3ML6A 5F82A 5I3MA 2XGEA 4C30A 4E7IA 1A6QA 4S2OA 3QQAA 2DA4A 1YSQA 1KAPP 4B88A 3WE3A 3EEAA 3BG6A 1G9KA 2DA1A 1OT6A 4JP0A 1PIOA 4R70A 2EA4A 1JJ9A 2K9SA 3R6SA 2JKRM 3LIEA 1CK7A 2QZ6A 1R1JA 1WJAA 2IP2A 2KJCA 2X3CA 4I39A 4BWIA 2R7TA 1D7EA 2XS4A 3OYKA 2HTJA 5D3CA 3G32A 5JI6A 5HDGA 3IF6C 3K6GA 3UDXA 3C8CA 3IXGA 3ZMVA 1KQ0A 2XQZA 1XURA 1BN5A 4AU7A 4RB2C 3LK8A 3OYDA 4Y7PA 2I10A 2O61A 3T4SA 4XRMA 2LYCA 2GZAA 5ERIA 5HSQA 5F0HA 1MGTA 4O5VA 4E04A 4BBSJ 1QNTA 3PJRA 4U0WA 2LR8A 1UZCA 4H2EA 5TBMA 1XFQA 2V1NA 3S22A 2OJED 5E3NA 1PWDA 1ZG6A 3FYZA 2DW4A 2X51A 3BP8A 2AS5F 3MVPA 3WTUC 4DMZA 5CYVA 4J19A 5FDSA 3AG3H 1R36A 4NXFA 2E2IJ 4EWFA 1YJWI 4RVAA 1IAEA 4XRFA 3H92A 4TV7A 4A3IJ 2PMZN 2HVQA 1S3JA 5K7FA 5GLCA 2HQAA 1WJ5A 5FD5A 3HKZA 1W1WE 3Q0VA 1FCNA 5FKMA 830CA 4EGYA 1K78B 2N8RA 2EFOA 1XSVA 2X6XA 4X1MA 3QP8A 2VKHA 3LA7A 1H88C 1FEXA 4JK1X 2O03A 1BI2A 3QOEA 4KIGA 3FPVA 4BKXA 1ES5A 2OY4A 3M1EA 3SEZA 3AAFA 3F22A 2B0LA 2WYXA 1AKHB 1YYVA 3LMCA 1BIAA 3ZG7B 2E1MC 3BEBA 3FXRA 2YX4A 2Y0SA 4KT5C 5LGUA 3VP3A 1KDWA 2Y2GA 4N9IA 3JYIA 3IKTA 1Z7LA 3MEXA 3ZNYA 1Y56A 2UUZA 5KIZA 3HBVP 3AGEA 3ABLH 3M1CA 3RI4A 1CF7A 1CF7B 4GUYA 3CCMI 1VETB 2PI0A 3RKYA 3TS4A 2NXNB 2JHEA 1U9NA 5CTNA 2RDPA 4OPQA 1SDEA 1ZG5A 5CVVA 4EJUA 4IOAF 1YM1A 3K4BA 4BMWA 4XQFA 3LICA 3HG9A 1HLUP 4PPRA 1IG7A 4Y17A 4IVKA 4U3TA 1HF0A 1ITYA 4YWZA 3QYBA 5F68A 1X1AA 2EA9A 2OCCH 4N9HA 1SD4A 4R4RA 1XM5A 3RPUD 3P5JA 4MFDA 2HS5A 1YOVB 3NY4A 3RQIA 1CEGA 1D8FA 5EVEA 1VQQA 2K7SA 3BY9A 2PRFA 2Y2KA 2DAOA 3EQUA 2IS1A 5HDDA 4CXFA 3IL2A 2EPFA 4L9JA 1K6RA 1ZHHB 5KVRA 4L18B 3MXRA 3SDBA 4GFBA 1FR6A 4I98B 1OM7A 1VQKI 2ZMFA 2DFHA 4MTDA 2W27A 2DA7A 3J7AY 5C3EJ 1MKIA 1O3RA 3WG7H 3DKYA 1B4AA 3S1MJ 3P01A 2B5RA 2H8WA 1H71P 4KENB 2PEXA 4M9SA 3OMYA 4ENMA 3E1SA 1XJ6A 5DJUA 2CKIA 3VP2A 4WZ5C 2HZDA 1DU6A 4HX7A 3QPLA 1QIBA 4MO7A 4P5OA 2B9SA 2QPNA 3VYUB 2M2EA 5LGNA 4C3HJ 3F16A 5BOXA 5J4YA 4ID4A 3UO9A 1KZHA 2UWMA 3BWLA 1JE8A 2A2LA 2R0QC 4OINF 4FTXA 1W8YA 1MD0A 1N78A 5CX7A 3TW7A 4BXFA 2L4AA 2OWJA 2HZ5A 2PU2A 3S2WA 4E7KA 3KEKA 1GXPA 4D0PA 1GSVA 1PI5A 1E2XA 3CUQB 2BY1A 3IHAA 3RDIA 1HQCA 2HJEA 2K02A 4Z6YA 3O86A 3DF8A 2IVMA 3JRGA 3RKWA 3ZMTA 1G5UA 4PM5A 3CJTB 2BGCA 3E97A 1LFUP 3C7JA 1D0YA 1EF4A 2OTLI 1W4MA 4FASD 4IXAA 3KCCA 3AL0C 3Q82A 1CGFA 4CZZA 5GAEJ 1MMDA 5DTSA 1NZUA 5J1UA 4UA7A 3IV5A 5GLAA 3P9IA 3DWLE 1LDKB 4BQOA 4BAYA 2D45A 4LFUA 3IX4A 5K5OA 1VQPI 1Z67A 4Y0UA 2QCOA 1HY7A 1XGSA 1P97A 2WTEA 4EATA 4GDFA 4EJVA 4HRIA 2MFZA 2QKLB 4V2GA 3P7NA 2WO9A 2BY3A 2Z5UA 1N25A 1JWPA 2W85A 3ZRGA 4CA0A 2FQ3A 2HOTA 4A3LJ 4EV4A 1CGEA 5L07A 1RC9A 1ZR2A 5FKNA 4OONA 2ADUA 1JWVA 1I3AA 1W0TA 1EAKA 4Z1WA 2ZMAA 3K2AA 5EGOA 4KG5A 5B66C 1FLIA 4XLFA 4LV0A 1KOUA 3PBTA 3F6OA 1FP2A 2EK5A 3T8RA 3B92A 3I59A 1K61A 3M9AA 1LFPA 3HOTA 3LNQA 1MBFA 2WKPA 4E3OA 2E1OA 4K0XA 3EYYA 2GIVA 3F1NA 4KQDA 3P9KA 3C30A 3L0TA 1G4DA 5HDSA 1ZH5A 1P92A 5FQIA 2CUJA 5AVEA 3HLEA 4BENA 2OPTA 2X85A 4ME4A 3VDXA 5FI2A 1AYKA 1JGSA 3CJMA 1DMTA 1IF1A 1D0ZA 3BPVA 4KIFA 2LREA 2WKHA 2XHKA 1LL9A 2P6SA 1PWQA 2FV5A 3EDIA 3GTLJ 5D7WA 3TO6A 2OW0A 3U1RA 2Z9OA 3KZYA 1NG6A 4P6BA 3BCBA 4I38A 1HLVA 4O8GA 3GF2A 1I76A 5B3SH 4DF6A 1FOWA 2V9PA 1HTDA 2GWRA 1Y54A 4AYBA 3FHZA 2M7AA 4NB5A 4H4KC 4HDVA 3D9YA 1RR8C 2LF8A 3UE3A 2R7VA 2OZRA 2W84A 5LGTA 3SYTA 3HRTA 2OBPA 5DV5A 4NG2A 2HI3A 2ZQDA 2WBMA 2WKIA 3JTGA 1ZRCA 4NDLA 5BQTA 1CAQA 3DPEA 5EVIB 2QHKA 3CF2A 4PJLA 1R5GA 3L2RA 3LQ0A 1PWGA 3OYLA 1XAXA 4BH9A 1YOUA 3PNTA 3LSHA 5DCMA 5DCMB 1DPRA 2ZXJA 4BJ5C 1BKCI 2LF7A 5IS1A 1TLHB 4XN3A 2P08A 5FLXK 3IWFA 1V9ZA 3QNCA 3LAPA 3ZGAB 3LSTA 2V2FF 3ZP5A 1SLNA 3GBGA 2KMUA 2VQLA 3LSMA 3Q5FA 1BJAA 4XL9A 5GPCA 2CQXA 2ESNA 5IT5A 1FCMA 1ZTRA 4Q4ZF 3CJNA 3H3ZA 2LG4A 1MMGA 3IH2A 2J8YA 3IS2B 1T1AA 5DTTA 2OSUA 3T1RA 2XS3A 2KT0A 3DCFA 4BYYA 4PSWA 1X2NA 1K56A 3BR2A 3ZQHA 1ACIA 3PQKA 1PP7U 4HPQA 4JF5A 5C5KA 1S72I 1OR7C 2LKSA 4M3KA 1GKCA 2PMUA 4PJNA 5KNLA 5HAPA 2YB9A 5JVTA 3HKZN 3LIRA 1GCEA 4H6JA 1JHHA 2H28A 1W63M 2E7XA 1J75A 2K9LA 2E35A 1CQRA 1W7PB 2DW1A 2BHYA 2JUCA 5CZMA 2DJIA 3HSFA 4IJGA 3TOAA 1FWZA 4XCTA 3AIGA 1F2KA 3WU2C 4UY8I 2H10A 3L7WA 2M7VA 2Y0SN 3G1OA 4ABZA 4H49A 2W25A 1TDLA 3ZHHA 3JRCA 4NUBA 2VEAA 1BQQM 3CC7I 4Q1LA 1FYLA 3V5MA 4GN2A 4M71A 3RJUA 1XGOA 1X1BA 4MN5A 4GZBA 3NIAA 3CPTA 1OM6A 1Y0VA 2O7OA 1U8RA 4WL9A 3MQ0A 2M4KA 1QMEA 3DXJF 4B48A 2HDUA 2W48A 5FRMA 4QY5A 4IUWA 2QSFX 5D6EA 2WC2A 1TBXA 3GTOJ 2QMIA 5L79A 3GZNB 3LEQA 3DKWA 3RH8B 2ZMEB 2EA2A 2Y2PA 1YJNI 2HYGD 5F83A 3T4OA 2JVHA 3LA3A 2FMYA 4NC7A 3L9FA 1BM6A 1TT0A 5HARA 2ICWG 3Q0WA 3EUKL 2BASA 1SEUA 4I7HA 5FQKA 4OIOF 1W7FA 4IRIA 4OWRB 2LSOA 3NECA 5DS9A 4I0AA 1JGGA 2VIXA 2VGJA 1YIJI 4AFIA 4ZYEA 4L5IA 1WSUA 1KVLA 2XF3A 3BFGA 3HREA 4BD0A 2O9CA 1BLSA 3DBRB 5E1WA 2GLOA 1HV5A 1ZARA 1G8XA 2PX9A 1R9TJ 1AHDP 1FC3A 5HAIA 4WF6A 1Y8RB 2B63J 1GE5A 3QP6A 5CKTA 2LBFA 3NHQA 3M2KA 3HDDA 2OZUA 4FVLA 1I1IP 1SKFA 1Z0XA 2UV0E 3O2PE 1E0EA 1OCOH 1F5MA 2P9VB 1BZAA 4JIJA 3AFHA 3WTZA 3V3RA 2H0TA 2R93J 3DKXA 3RKXA 2JSPA 1G3TA 3CD6I 2IRFG 3HOVJ 2IJLA 5F6FA 4FD8A 3FXKA 1K0KA 5ILVA 5F5YA 1YLFA 5L2FA 2V26A 2W1RA 3P9CA 3D5SC 1ZGWA 2M45A 5E1ZB 4XM3A 3M6BA 1XXMA 2E2JJ 1I3QJ 2VK3A 3BA0A 1STZA 2H6BA 2DA3A 2R7QA 3FV7A 3GWZA 4YINA 1ZN2A 2EXBA 4FSFA 2OW9A 4S2LA 1LL5A 3TKYA 2FFFB 2R9XA 4DYCA 2DPUA 4U0YA 3I58A 2EROA 5HPIA 1JK3A 4V2FA 4GS9A 4BQQA 1JVJA 5FQJA 4OIQF 4C6YA 3U2AA 2M8GX 9ANTA 4XSXF 3IF6A 4CQHA 3I4MJ 4YFNF 2GA2A 4WXHA 2KPMA 4G6QA 3HVFA 4MEZA 2R7FA 2M1CA 4UV8A 4PZJA 1YQSA 3ICYA 2L9SA 5E79C 2ME0A 2PJTA 2Q0OA 5KHDA 4BLMA 4JLFA 3BC8A 1X1CA 2PLYA 4ETZA 2CV1A 1YKDA 2Y4AA 5B1BH 3EHYA 3PHYA 3BLSA 1NK2P 5E2HA 3J7AO 2V1AA 1XCBA 2XKPA 1CGLA 3ABTA 4B09A 1IOUA 1ZXCA 2D2WA 1FIPA 5I0LA 1QZZA 3MKFA 3JAMK 3F1OB 3L00A 3E6DA 3GCMA 3UB7A 2EIMH 2X1CA 3IH3A 4HV6A 4HQMA 4XUZA 4WELA 5BMZA 1YLPA 4AXQA 1IRFA 2L01A 2QF7A 3K1NA 3BR1A 4LLLA 3BTLA 1Y8JA 4PKWA 1WH7A 3D5LA 4X6TA 1F43A 4PJMA 1U5TA 1U5TB 3UKGA 4MGRA 4CTHA 4F91B 2IGOA 3DSLA 1EH8A 2V9AA 2YU3A 1IDZA 5E43A 4YFKF 3HUMA 1ZKJA 3C3WA 4GHIA 4GHIB 1SMYF 1LVAA 2XH9A 2IGKA 2AHQA 4L9GA 1XPXA 5B5OA 3HSRA 4KZBA 5K5QA 3GYHX 1R1VA 1J5YA 3LSPA 1JUSA 1IJWC 3PBNA 1D1JA 5D8KB 2Y75A 3AG4H 4B1RA 2JSCA 5DCFA 5FASA 3QU3A 2ZOIA 3ITBA 3BFDA 1E25A 3HJIA 4AYBN 3CZ6A 3H5AA 4EQIA 3A2KA 2RNJA 3G4SI 3TEDA 3HLGA 3HIFA 3H3UA 4N4OB 2J7VA 3IAM2 4CCOA 3O8HA 5KZHA 3OPLA 1U78A 5HL6A 3C2BA 1R54A 2F5EA 1JHFA 2NVXJ 2ZQ7A 5CLSA 1L0FA 3K70D 2Z6DA 6PAXA 2CFXA 4IL6C 2QGUA 4KN7X 1XMXA 1Q2QA 1K7IA 1TS6A 4OP8A 4LJZF 3MZHA 4PM9A 1X4PA 2COMA 1ENHA 4BE0A 4HBUA 5LEJA 3IXHA 2DMTA 3UN7A 1TS7A 4S2MA 3DTIA 1AF0A 2LKXA 2VOPA 3B6CA 4XNFA 4UHUA 1G6OA 2KJBA 4Y13A 1Z6RA 2Y91A 5D4RA 1PW1A 5EEHA 1F5TA 1YRNA 2ZBBA 1NLZA 2ZL1B 1K7AA 2LY1A 1TT5B 4FOFA 1ETXA 1GT0C 1J3WA 3GV9A 3I56I 1SFOJ 4LCMA 5HD3A 2USNA 3VSLA 1V3FA 3HBUP 1C0WA 3OL3A 3ZVWA 2ELHA 3FM3A 4GWMA 1MWRA 1ZK8A 3H9WA 4X56A 4OPZA 3GTCA 1K79A 1RKWA 5A2QK 2OD5A 4XRSA 4WZ5A 1BR2A 1VM1A 1R4MB 3WV2A 5FLMJ 3PYPA 3TGNA 1L6JA 2JKGA 1ESUA 1A04A 3MKZA 4BBTA 3M8FA 1CJFA 4D7MA 3QRFF 2BOLA 3KMCA 3BTIA 3VEPA 3TE8A 1BLCA 3HOZJ 1W5SA 4HDUA 4UB6C 3DAVA 1OYIA 3TDUC 4MEXF 3WRTA 2HU9A 2WAQA 5C4XJ 1J9MA 5JHUA 3CO6C 2ZJQF 2CV0A 2DMWA 3EUHC 1L0GA 2V9KA 2JBFA 3GTQJ 1MXOA 2XDVA 2L5QA 4EJTA 5DUIA 4M3DA 3GTJJ 3T0YA 1POGA 5GHZA 3EHXA 3IT9A 4EBLA 4CCNA 1S7AA 4OIRF 2L0RA 3V39A 2XGCA 4P0MA 1IXRC 1MBKA 1XJ4A 3KX2A 4DDSA 1XMAA 1MSFC 3ZG0A 2HPMA 4XR6A 1BIBA 1KU2A 2ZJ2A 2P6TA 2B18A 2WKRA 2WGWA 2XC7A 2KOIA 2DYSH 3ULQB 2KRFA 5CQEA 3NOUC 3ZQ7A 1X4OA 1CGPA 2ETHA 3DU6A 2GM4A 1IN6A 1UB9A 3WGGA 4IKFA 2EX9A 1R1IA 2X7MA 1F9NA 4G6DA 5LHHA 2KRJA 3ZGKA 5HVQC 2KRCA 1J7NA 2K27A 3FHNA 1S6LA 1JI8A 3HPHA 4HG2A 3VFZA 2OW2A 3SQNA 1VQMI 4WLAA 2JTVA 2Y0MA 2R5ZB 3PIPF 2X01A 3I54A 4CJNA 4EXOA 4GR8A 1YIOA
chains in the Genus database with same CATH topology
2BVMA 3PSFA 5H8XA 3F9KA 4HPQA 3DKYA 1C3IA 2JT5A 1D1CA 4AXQA 4XKVA 5BPAA 1BIWA 3H0DA 4CCLA 1H71P 3OS0A 3HY9A 2R7SA 4ON1A 2OXWA 2W13A 2DT6A 2AQEA 3OMYA 1YCMA 3E1SA 3M8JA 4DOZA 2J83A 1OR7C 5CPRB 1UTTA 1HOVA 1GKCA 2CKIA 3AYKA 3DTKA 3HXLA 4BQNA 5I4OA 4Y33A 2ELJA 2HZDA 2VPLA 4PJNA 3DLAA 2IGNA 5KNLA 4E7JA 1Y8JA 3DWBA 4BEHA 4BEHB 4PKWA 2CFOA 2YB9A 1QIBA 2K2GA 3D5LA 4P5OA 3HC7A 3VYUB 1Z3YA 4GF1A 3DPTA 3F16A 3TBIA 1SFKA 3LIRA 3LUMA 4PJMA 2KRHA 3OYCA 2MD0A 4A3WA 2WOAA 3EUAA 2IGMA 4BUPA 4CTHA 3VTGA 1JKYA 2UWMA 4F91B 2IGOA 3DSLA 1BR4A 2KDOA 3V96B 1V5FA 3W2AA 4HEA2 3VI1A 4H30A 4JP4A 4KJZA 4DJAA 1HA8A 3LSIA 4BS9A 3K7LA 2HPIA 3Q2GA 2K9LA 4FU4A 3G42A 3HL2A 3UR3C 1N78A 4QPQA 3LGPA 1CQRA 2K9CA 2IGKA 2JNPA 3MKYB 2KQRA 3KWVC 3RQ4A 3MKWB 2XF5A 4ZTJA 4PSXA 1SU3A 3OYFA 1C8TA 1GO7P 1HFSA 2DW1A 1JAOA 4DGWB 5B5OA 5CZMA 3HPGA 1SATA 4BXFA 1MNEA 1KBCA 3DPLC 2DJIA 3VSKA 3HUGB 2V7FA 1BQOA 1MMAA 2D1NA 4I03A 4XM8A 5CXAA 1QHGA 3F15A 4E7SA 2VKDA 4DPEA 4XCTA 3AIGA 5D2BA 4GWNA 3EDGA 1ROSA 2OVXA 4HX3A 4E7KA 1UMSA 1WJCA 3KEKA 4L63A 1HFCA 5I3MA 1O0QA 4AUOA 1Q3AA 4C30A 3K4MA 1N77A 4E7IA 1OS2A 1ZS0A 3KEYA 2UV1A 3E0JB 3I3LA 4C9YA 4ZDPA 1JANA 3CZ6A 4B44A 3AKZA 4BE2A 1GE6A 2J0TA 3H5AA 3LSGA 2R4GA 4XKBA 2M4GA 1BKCA 2DOAA 1PYVA 4H49A 2VLAA 1KAPP 2POJA 3OOUA 4PKQA 4F52A 2LBFB 3A2KA 5BOTA 1BKCE 1R1HA 3MD2A 4NUBA 3LE9A 3VYRB 2X3BA 2E3XA 1D1AA 1BQQM 3OYGA 1J09A 4H3XA 4Q1LA 5FROA 1GO8P 4II3A 2W82A 3BG6A 4E6KG 3OYNA 3LJGA 966CA 2ZSHB 1G9KA 3CP8A 3A1YA 1YQYA 2W7NA 4F55A 2R7UA 2LOOA 3L2WA 4BDYA 1JJ9A 2Z1DA 1XUCA 3RTTA 4N4OB 3WV3A 4U87A 5I43A 1XFWA 3IAM2 1OS9A 4CCOA 1R55A 4Y3OA 1X1BA 1ZVXA 1CK7A 2KP6A 2R7WA 4E7HA 3VYTB 3OYBA 4XOTA 1YX5A 4EFSA 1XFUA 1OM6A 1D0YA 1MMNA 2IXSA 2RQQA 4BU2A 3CESA 5JHFA 1R1JA 1Y0VA 1WJAA 3O2XA 2M4KA 3LEAA 4FASD 2MZEA 3UVCA 1R54A 3AL0C 4XONA 1JIWP 3KECA 4LIVA 2CW7A 1CGFA 1WJBA 4BACA 2GOMA 2WY7Q 2X3CA 2BW3A 1MMDA 4YRVA 3EDHA 2BVLA 4B48A 2JUGA 2R7TA 3RCOA 2VB6A 2IS6A 3OHOA 5FRMA 4IUWA 3KHIA 2Z16A 3K70D 2XS4A 3OYKA 2JA2A 2O5RA 2W1OA 5D3CA 2ZXIA 3F1AA 1V5GA 3DWLE 3LILA 3NWTA 1UEAA 2M7BA 4PK4A 3K6GA 3QYEA 5L79A 1LDKB 2KLOA 2WY8Q 1KUHA 3MMYB 4BQOA 3NWSA 2W14A 2LC2A 4AVZA 1K7IA 456CA 4MLOA 5BOYA 2K5CA 3H35A 1CIZA 2ERQA 1XFYA 4E7LA 2VJ4A 2R7XA 2DDYA 5KCMA 4RM2A 2JT6A 1Y6IA 2CMPA 2JVHA 3IAS2 1NG7A 1XURA 4E4HA 4NC7A 2HVSA 1EA3A 2IS4A 2RREA 1FM1A 1ATLA 1BM6A 3N05A 4AU7A 3LK8A 1TT0A 1WFXA 3OYDA 4ITVA 1HY7A 4GR3A 1GXDA 4R79A 3BLYA 4CZCA 4U7BA 3OYIA 3EUKL 4Y4RA 2X6YA 1X4PA 2PJRB 1JIZA 3S32A 4EATA 4G0DA 4ANJA 1IADA 2RJPA 2LYCA 3RTSA 2HDWA 1XFXA 3SZGA 4BE0A 2WADA 1USNA 1BZSA 2Z2DA 4HRIA 3P1VA 1P9QC 2HNHA 1SLMA 2OI0A 2OV7A 2MFZA 3WV1A 4OWRB 2QKLB 1RM8A 4LIUA 5HNFA 4PKRA 3CJQB 5L7FA 3EWJA 3PJRA 3Q2HA 2WO9A 2ZFUA 4H2EA 2DDFA 4BL0B 3HY7A 3DTIA 3OYJA 1DP3A 1D7XA 1XUDA 3ZRGA 1AF0A 4CA0A 2M3AA 2JSDA 2V1NA 5D1UA 4E7ZA 3L2VA 1MNDA 3F17A 2L2OA 4OAZA 3K4LA 2ZSIB 2VIXA 4QPOA 1CGEA 2X51A 3K70C 3CKIA 4I35A 2WA0A 2MZIA 5HOOA 3OHLA 4XNFA 2CH0A 2W15A 3SHIA 1QIAA 3A4CA 4CUGA 3AYUA 4XLHA 3PFYA 2V4BA 4IN9A 1DTHA 4J01A 4WKEA 3NX7A 4PKTA 1EAKA 4PFPA 4ZJZA 2Q2EB 4D1QA 4CSWA 3G5CA 3HDAP 1ZELA 1LVKA 1QHHD 2CLTA 4PFOA 4XOPA 3QODA 1ZTQA 4AYKA 4XLFA 1ASTA 3L0VA 3U21A 2XAUA 3K4NA 1HV5A 3AL0B 1XFZA 1UAAA 1D0XA 4XBHA 4BDZA 2K9MA 5TGTA 1PWUA 3DU5A 2LY1A 1WJDA 2DCEA 2I47A 1UMTA 3LJTA 2ERPA 1G8XA 2VJ5A 4GQLA 2Z2SB 3DPUA 3B92A 3LMMA 4BGDA 1IAEA 1WJEA 2NOJB 3QYFA 5LFAA 3DPFA 3K4CA 2MYSA 3HOTA 1LFPA 2X6WA 2DXIA 4WF6A 1MMPA 2OW1A 2FUG2 3FKJA 2USNA 4L6TA 2OXZA 4HNUA 1K7QA 3VSLA 3HBUP 3P24A 3C2GA 4IQJA 3H9QA 4L19A 1KUIA 1X1DA 3OL3A 3OS2A 1U0JA 1GE5A 1S9HA 5CKTA 2HVQA 2VXDA 4GWMA 3B8ZA 2LBFA 2LY2A 4II2A 2RJQA 3L0TA 5LD2C 4DF9A 2HQAA 4IJOA 3PSIA 2YIGA 2MLRA 1WJ5A 2MABA 2CUJA 3HKZA 2LH9A 4BE1A 1T95A 2Y6CA 2X85A 2AQFA 3VDXA 2VJIA 2O36A 3KMEA 1CXVA 5D1SA 3RTRA 830CA 1N75A 4XKWA 1BR2A 4FVLA 1AYKA 4CCKA 5HNHA 1I1IP 1Y93A 2N8RA 2F4IA 1DMTA 2X6XA 1YX3A 5B5PA 4XLCA 1JAPA 1DQUA 1BR1A 1D0ZA 3K10A 3ZQQA 2XF7A 1D5JA 2DW2A 3LKAA 3LIKA 2VKHA 3S8PA 1X19A 1L6JA 2LREA 1E0EA 3HOSA 3ELMA 3LFUA 4OAYA 3KYLA 3BG7A 4B43A 3DTEA 4PKUA 3BCAA 3S3NA 1PWQA 1PWWA 3PL8A 3MKZA 2FV5A 3EDIA 3F18A 4JIJA 3AFHA 2CUZA 3QOEA 2OW0A 5D7WA 4DBRA 3U1RA 4HSTA 2ZXHA 4H76A 3DQVC 3DNGA 1NG6A 2OY4A 3SEZA 3DKXA 3BCBA 1OLTA 2V6EA 3LUNA 2JSPA 2K3PA 4WK7A 3D5RC 4LG3A 2Q1ZB 4KITB 2VJJA 3OYMA 3S3OA 1KUFA 4ILWD 2CW8A 3TT4A 4F92B 1EUBA 1EB6A 2BOLA 3OYAA 4X0GA 3KMCA 2R7RA 2OY2A 3LMCA 4DBQA 3L2QA 1A86A 3MA2A 2E1MC 4JQFA 1I76A 1G4KA 1D1BA 2V26A 1ZP5A 1SMPA 4ZC3A 2JVGA 1PWVA 4H82A 3EPZA 3V42A 1IAAA 2WAEA 4ZR5A 1VZ0A 3ZCOA 1GLNA 1T0FC 2Y0SA 2IS2A 4XN0A 1HTDA 1G12A 2QPJA 4L7AA 3ZXSA 3D5SC 1C7KA 5HLTA 1GE7A 1K7GA 2CS3A 2VQGA 4XM3A 1OM8A 3ZXHA 3W2WA 3OL4A 4ZYAA 1SRPA 3I7GA 3N2VA 2KZVA 4AYBA 2PJRA 1A85A 3K7NA 1MMRA 2M7AA 2HU9A 4XKCA 2WAQA 1O0TA 3BA0A 4H4KC 4G9LA 3DL1A 3FBNB 1GKDA 1Z21A 3OWTA 5CUHA 2VQCA 4JQGA 3F19A 3ZUKA 1MMBA 2L7KA 2E2DA 4DD8A 2R7VA 2OZRA 1UG0A 1B3DA 1Z7LA 3S3MA 2CV0A 1Y56A 2R7QA 3SYTA 3OYEA 1ERDA 3LL7A 2UUZA 3EUHC 3EDZA 3HBVP 3OIQA 2V9KA 5CQGA 4D9JA 2KHMA 3FBIB 3K4JA 3M1CA 4G6TB 1BUDA 1Z3XA 2MC4A 4CCJA 2MLSA 4GUYA 4RMNA 3OYHA 2OW9A 1R6RA 2AIGP 2WBMA 2AYKA 5I2ZA 2XDVA 2A6TA 2L5QA 1FMWA 1MW7A 4F93B 4HSRA 1YP1A 4ZTFA 4XM7A 1V5EA 2JIHA 3O64A 1IABA 3H5RA 1G59A 2HU6A 3OS1A 4ZDLA 4NNJA 3TS4A 1I73A 3EHXA 1QUAA 4GRIA 2EROA 3GBOA 4CCNA 3G2BA 1W36D 4DV8A 1DGRM 1JK3A 1QJJA 3LJZA 1CAQA 1UTZA 2L0RA 3DPEA 1FLSA 4BQQA 1RMZA 2WO8A 2WB1A 2W12A 3TSKA 2DT7B 4YELA 1MMQA 1WNIA 3CF2A 4IZZA 3HDBA 3S93A 1JAQA 2E5ZA 3PNYA 4DIQA 4PJLA 3I7IA 3LQBA 3RSNA 2MZHA 3K4BA 4XQFA 3KX2A 3B2ZA 4YEJA 3USNA 4JA1A 3L2RA 3HG9A 1MNCA 3HB2P 2VASA 3LQ0A 2I8DA 3N2UA 3ZVSA 1AA7A 3OYLA 3DEEA 3H9GA 2VXZA 4KISA 1IRXA 1WJFA 2A5WA 4BJTA 3PNTA 3TL4X 4XLEA 1LKXA 3QYBA 3L2UA 2HPMA 3LSHA 4XLAA 3SEQA 1QU3A 4XR6A 1X1AA 3IP4B 2DW0A 1XFVA 4BJ5C 2OC6A 2OXUA 1BKCI 1B8YA 3WV2A 2E1MB 4RLQA 1ND1A 4FETA 4KT6A 1OMJA 3CP2A 2KPMA 2WAFA 3TMOA 3H9JA 2E60A 1UELB 4XN3A 2RNGA 3KEJA 3RPUD 2XC7A 3TVCA 2QKMB 4XMYA 1AKLA 4J00A 5LABA 1D8MA 1JH1A 2L9SA 2X1EA 2F6CA 2W4SA 3FDYA 3PNVA 5CQEA 3VYSB 1KUKA 1Z3JA 2X3AA 4HMAA 2KL4A 1IAGA 2TCLA 4QKZA 1SAUA 2PJTA 2SRTA 1D8FA 3C2HA 1SLNA 4H84A 1X4OA 5KHDA 4WZVA 4PUSA 4P1WA 1YE9A 3W3CA 2W00A 2D1OA 1DGWY 3GBGA 2P0WA 2VQHA 3I9V2 1W36C 2KMUA 4B3XA 2GOXB 2VQLA 1X1CA 3BC8A 2YUFA 3LSMA 2XSJC 3DU6A 2HVRA 1BUVM 5JMYA 4BJ6C 2CV1A 4AIGA 2M0MA 3OY9A 4XL9A 2CV2A 4RM3A 1ZXVA 3EHYA 1S4BP 3VWBA 3IUOA 3ZR8X 4JOMA 4N4NB 2OUMA 1KONA 4IKFA 4J4MA 1BOBA 2V4JC 1R1IA 4GR0A 4JPAA 2VL8A 4WKIA 2X7MA 2R7OA 2E5NA 3LSKA 2IS1A 1QJIA 4IX7A 3K4KA 4PJJA 3UNGC 1PWPA 2A8HA 2L9NA 2W0DA 3PUBA 4A7BA 1CGLA 4HNTA 3H5NA 3OR1C 1K6YA 2Y6DA 2XF6A 4NC8A 3E8RA 1IACA 2KRJA 4NQWB 4XM6A 3ZGKA 3CMMA 4C2UA 5FRNA 2FV9A 5HVQC 1KUGA 2LG4A 2KRCA 4IQ4A 4RLFA 1J7NA 1PJRA 3FHNA 4FXYP 4ZDOA 1JI8A 3HPHA 1ZXCA 1MMGA 4HG2A 3SDBA 3W2VA 1TZLA 2BW3B 3OR2C 3CJRB 1BSWA 4LITA 1FBLA 1QICA 3KRYA 5I0LA 5I12A 2O3EA 4B47A 1OM7A 2OW2A 1G05A 2X1DA 1OO9A 4C2TA 2XS3A 4R3VA 4F3QA 4CCMA 2OVZA 5D1TA 3ONQA 4PSWA 4H1QA 1G49A 2LRDA 1FMVA 2PMZA 4CH7A 1YOUA 4PKVA 2X1CA 4GR8A 4PKSA 4XORA 3J7AY 3HYGA 3OIPA 2F5VA 4FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTI A;  3DTE A;  3DTK A; 
#chains in the Genus database with same CATH topology
 2JZY A;  3K2Z A;  4BQA A;  5J7E A;  3QPS A;  2EFQ A;  2JN6 A;  5GAG J;  5F0C A;  1B1B A;  1XN7 A;  2FX0 A;  3FK6 A;  2WKQ A;  3DWB A;  3KLO A;  3TOB A;  2GX5 A;  3HC7 A;  4QHC A;  2IGM A;  1BR4 A;  5E2G A;  2F4O B;  4P85 A;  2CC1 A;  4M72 A;  2DTZ A;  1KE4 A;  1T1B A;  5AIQ A;  1BSG A;  1SFE A;  4PSX A;  4HI4 A;  2CQN A;  1HKQ A;  4DGW B;  1SZV A;  3S1Y A;  4KUM A;  2XD5 A;  4I03 A;  2FML A;  1NYM A;  5M19 A;  4ZJ1 A;  4MLL A;  1BKC A;  3NAR A;  2POJ A;  5LHG A;  4EU0 A;  2EX2 A;  4E6W A;  5CVR A;  1I2S A;  4QJG A;  5E20 A;  4E6K G;  4EM1 A;  1CQT A;  2R7U A;  4XLP F;  3L2W A;  1YPR A;  3AGF A;  2WZZ A;  3T50 A;  2C6W B;  4Y52 J;  1IRG A;  3KYQ A;  4Y3O A;  1JUP A;  1RES A;  1SKO B;  1XFU A;  4B93 A;  1E3U D;  3BQ8 A;  5FLX Z;  1UHS A;  3UVC A;  1O4X A;  2CW7 A;  1FOF A;  1TL8 A;  3R60 A;  4HOB A;  1T33 A;  3CI6 A;  1IAW A;  3RCO A;  3OHO A;  4CYC A;  2JA2 A;  1Z09 A;  1BC7 C;  5EZH A;  2KLO A;  1MDM A;  2V79 A;  2M34 A;  1XTA A;  3HCY A;  4UA9 A;  3K7A J;  1JKQ C;  4HHD A;  5DUK A;  4GR3 A;  4U7B A;  5J1Y A;  4ANJ A;  1SAX A;  1QZY A;  1JTX A;  1KA8 A;  4AIK A;  3E3V A;  2Y55 A;  2OI0 A;  4WN5 A;  2VA0 A;  2X71 A;  3EWJ A;  4HH2 A;  3HJK A;  4PM8 A;  1FSH A;  3C1D A;  1D7X A;  3ABM H;  2ZB9 A;  3KYC B;  3KET A;  1OPC A;  4WCG A;  1D06 A;  1LLB A;  3MKE A;  4YIR X;  1MPL A;  3VP1 A;  2ZJP F;  1IW7 F;  1E3O C;  3IWZ A;  4RGX A;  4FUW A;  2XPW A;  4JKT A;  1MMS A;  3LJT A;  3H36 A;  2NOJ B;  1LDJ A;  4DDY A;  2MYS A;  4LB5 A;  3LQQ A;  4IQJ A;  4L19 A;  4CLC B;  2YSR A;  4G7O F;  3CAX A;  3PSI A;  3JSO A;  1PVE A;  1B8I A;  1MY8 A;  2L7Z A;  3MZE A;  1FSW A;  4YFM A;  1OR7 A;  2Y6C A;  2AQF A;  3CCS I;  3ZNT A;  3KME A;  2R78 A;  1G3W A;  3P98 A;  2VT3 A;  3N8S A;  4DBR A;  4HST A;  3ZYT A;  4RB0 A;  2ECB A;  5EPH A;  4O3M A;  4A5M A;  2O9L A;  1R00 A;  1DP7 P;  3HUN A;  1S4R A;  2R7R A;  3EEH A;  3NBL A;  2EBI A;  3EPZ A;  1ZAO A;  4QSH A;  3A3D A;  2NS8 A;  1C7K A;  3OOP A;  4GO1 A;  2VQG A;  3E2K A;  3JSP A;  3MZF A;  3N97 A;  4B9O A;  1EI5 A;  1P4X A;  3DL1 A;  2PAV P;  1FIA A;  2VQC A;  3GUD A;  4GD6 A;  3E5Q A;  3OYE A;  1OMI A;  1TWA J;  2KHM A;  3KYE A;  2NVU B;  1VQO I;  1GV2 A;  4ZTF A;  3I55 I;  4O6J A;  3U2R A;  2CYY A;  2VC0 A;  5EF6 A;  5KAF C;  3VOL A;  3ZDJ A;  1JKR C;  3BG9 A;  3LQB A;  3B2Z A;  3KP3 A;  5FQ9 A;  1PZP A;  1LEA A;  5M3F J;  3DEE A;  2KX6 A;  2EQR A;  4KIS A;  3J80 K;  2YX7 A;  4A2U A;  4RLQ A;  3EWK A;  3T1Q B;  1UEL B;  1H9T A;  2B7E A;  4N1X A;  2DNS A;  5LAB A;  4ON0 A;  2ZC4 B;  2O8K A;  1R4N B;  4P1W A;  4A3K J;  3I9V 2;  5GAD J;  4LK0 F;  3W8K A;  3F8M A;  3VWB A;  3IUO A;  4R0Q A;  2MC3 A;  4PJJ A;  4PDK A;  5TR7 A;  2XF6 A;  4YIF A;  3IXB A;  1ETV A;  2ZM2 A;  1XS9 A;  5F04 A;  3Q1F A;  2XB5 A;  3W2V A;  2VV8 A;  1TZL A;  1FBL A;  1E17 A;  2HF6 A;  5D1T A;  4KG2 A;  3F8N A;  3M4O J;  2EIL H;  2DBB A;  2DK5 A;  4HZF A;  2J83 A;  3ZCZ A;  4LG0 A;  1KE0 A;  4I3A A;  5CPR B;  4KUO A;  2L9V A;  4G7H F;  4QY6 A;  1U2W A;  2HGV A;  1SAN A;  4GW9 A;  3WU1 B;  1FJL A;  1I1G A;  4E3N A;  4WEK A;  2FE3 A;  3EUA A;  4C3I J;  2Y9Z A;  3UME A;  3VTG A;  5HDC A;  5JLW A;  5EV0 A;  1FBQ A;  2L9R A;  2FZ0 A;  5FDH A;  3KZI C;  2VKS A;  3CLO A;  1O7E A;  2W57 A;  4O0P A;  5E2E A;  4D2O A;  3OYF A;  2KIS A;  3BW6 A;  2XKO A;  3HUG B;  1J9I A;  5F69 A;  4O7D A;  2HOA A;  2G7U A;  1R7J A;  2WWY A;  2VUM J;  2KFD A;  3I3L A;  1JTD A;  4KQR A;  3BTC A;  2WAQ N;  4PKQ A;  1Y1W J;  1BKC E;  5L3D A;  4U0X A;  5L3F A;  1YG2 A;  2ZSH B;  2EV0 A;  3TO9 A;  3BT9 A;  4BDY A;  1MNM C;  5FLV A;  2Y79 A;  3BPX A;  2WZX A;  3BZ6 A;  2QJ5 A;  5JHF A;  2XAJ A;  3KEC A;  4LIV A;  3JRD A;  4BAC A;  5L3B A;  5CED A;  1OTA A;  3EDH A;  3PO3 J;  2ZNY A;  4M74 A;  1LDD A;  1DY6 A;  2H27 A;  2XFS A;  4FX4 A;  5KCM A;  4OH0 A;  2P5K A;  2BTF P;  1GV5 A;  3F8C A;  3GTP J;  1E3P A;  3A02 A;  4GB7 A;  3Q9S A;  1XX2 A;  2HP5 A;  5L7F A;  2ZFU A;  4ETS A;  5DFX A;  4X6A J;  3HUO A;  5TJJ A;  3ZQG A;  3IC7 A;  4ESB A;  5IP9 J;  2B02 A;  3K4L A;  1QRY A;  4QPO A;  3UDI A;  2QKP A;  1WGX A;  2CH0 A;  5D5U B;  5HAQ A;  1QIA A;  4NBQ A;  3WU0 A;  2RC4 A;  1PDN C;  5EVI D;  3LSJ A;  1OTE A;  2DMU A;  2DMQ A;  3G1M A;  2FOW A;  1HSJ A;  2XRO A;  5U47 A;  2Z2S B;  3IH8 A;  2EFN A;  5GLB A;  1WJE A;  2NNN A;  2M30 A;  1WI3 A;  4RAF A;  2OW1 A;  2FUG 2;  1FPQ A;  2HP9 A;  3LAJ A;  3OS2 A;  2D5V A;  4FH4 A;  4G3W A;  4IED A;  4N92 A;  4GNU A;  2MAB A;  1J59 A;  3BOQ A;  4OVD A;  1I6X A;  2LH9 A;  2P4W A;  5IYC J;  1VHM A;  3BQY A;  4XKW A;  4RS8 A;  4DE0 A;  3S1R J;  4CCK A;  3LY4 A;  4EM0 B;  3C18 A;  4XID A;  1EKE A;  4A5R A;  3KYL A;  3BCA A;  1MBL A;  2EFU A;  3CMZ A;  3UPO A;  4WXC A;  2A24 B;  1USS A;  1ZG3 A;  2CUE A;  3OYM A;  1W8Q A;  2RCX A;  3SHF A;  2ID3 A;  4ZBE A;  3O5Y A;  3RXX A;  2OY2 A;  5F1F A;  1RKT A;  5CJ9 A;  3MA2 A;  2VOD A;  2WAE A;  4UUV A;  4G12 A;  2GZW A;  1QGP A;  2EJR A;  5LRS A;  3N2V A;  1A85 A;  3OSF A;  1YS6 A;  2K7L A;  5G4Y A;  4Q8I A;  1LE8 A;  3FBN B;  1NRF A;  5DM7 F;  5CHM A;  1RUO A;  4D9J A;  1TF1 A;  4HP9 A;  2VE8 A;  2MC4 A;  1R6R A;  2QLZ A;  4UB8 C;  4CDG A;  2HEO A;  3O64 A;  2A07 F;  1RZ4 A;  2QYO A;  2CJJ A;  5M5X J;  2HU6 A;  1Z91 A;  1I73 A;  3GBO A;  4XLN F;  3FWL A;  4DV8 A;  3LUQ A;  1FCO A;  3K1P A;  1UCR A;  3N8R A;  3R4K A;  4AIJ A;  1QVT A;  1YI2 I;  2DT7 B;  2V0U A;  1RGY A;  1IN4 A;  1WNI A;  1HOM A;  1W7P D;  3I7I A;  1MZB A;  3PM1 A;  3RSN A;  1IKG A;  3G35 A;  2I8D A;  3CMY A;  5EOO A;  5EM1 A;  4E6X A;  1VQ9 I;  2XSD C;  5D5W B;  2OC6 A;  1T56 A;  1SFX A;  1S7E A;  1ND1 A;  2WAF A;  3TMO A;  3H9J A;  3R61 A;  2RNG A;  4HX4 A;  3GMW A;  4GLQ A;  3BJO A;  4P6Z M;  1JH1 A;  1IAG A;  4QKZ A;  4ZZL A;  4Y15 A;  3FIW A;  1ODD A;  3W3C A;  4KFC A;  5BS6 A;  5K5R A;  4BJ6 C;  4MMN A;  3S1N J;  2XSS A;  2E36 A;  1S66 L;  1QJI A;  3K4K A;  1OFC X;  3LCE A;  2A3U A;  3NJA A;  1W79 A;  4CYD A;  5A2Q Z;  2PHY A;  2BW3 B;  3OR2 C;  4R1H A;  2Y2O A;  4F3Q A;  3IBR A;  3G71 I;  3IRR A;  1R1T A;  4HAM A;  4YNR A;  2WK0 A;  3PBS A;  1K57 C;  2QZ8 A;  2MA3 A;  3ASN H;  3FMS A;  1OCZ H;  4MHG A;  3LWF A;  3LI8 A;  1BIW A;  3H0D A;  2R7S A;  2NS0 A;  2NS7 A;  1ZLK A;  2LB5 A;  2L54 A;  4DOZ A;  5IOY A;  1TVF A;  4UUT A;  4HP4 A;  4BQN A;  5BPD A;  2ACG A;  3M8E A;  1N9L A;  4MBH A;  3FXO A;  4KJZ A;  5DD8 A;  3VFH A;  3UR3 C;  4X55 A;  1P4W A;  4LB6 B;  3DPL C;  2J9P A;  1XSX A;  4GWN A;  5HDK A;  2QSG X;  4WYY A;  1WJC A;  3V8K A;  3IF5 A;  3MSH A;  4JXG A;  4DJ3 A;  1YW7 A;  3IH9 A;  1PUF A;  4L9T A;  5M3M J;  2VZW A;  4UQI S;  3VPR A;  4BE2 A;  4CIC A;  5AVF A;  1PYV A;  1YLW A;  2DQR A;  4KZA A;  1MC0 A;  2E3X A;  4M73 A;  5EG0 A;  3UNW A;  2W82 A;  3JVU A;  2W7N A;  5HWW A;  5J8F A;  3RTT A;  2ZO4 A;  1XFW A;  2XAH A;  4MEY F;  1VEU B;  4I3I A;  1SD7 A;  3KSH A;  2VC1 A;  1VQ4 I;  5GL9 A;  3CES A;  5C4J J;  3N4I A;  1JIW P;  2K40 A;  1WJB A;  2WY7 Q;  4BJP A;  4K91 A;  1Y28 A;  2PJP A;  4A12 A;  2IWB A;  3CCU I;  4AVZ A;  2VJ4 A;  1I5Q A;  1SCW A;  2KIQ A;  3IAS 2;  3WTY C;  2RRE A;  1JIZ A;  1XFX A;  3SZG A;  4WF2 A;  4PM6 A;  1K55 C;  4GKU A;  1P9Q C;  3T8T A;  3C4O A;  1S1Z A;  4GJ4 A;  4AIH A;  4PKR A;  5AQ7 A;  4ENN A;  2J5P A;  3J7Z I;  4FH2 A;  4E7Z A;  3SS3 A;  1PFL A;  4G94 A;  3K70 C;  3GTG J;  3OV8 A;  3A4C A;  4KIB A;  4IN9 A;  2JT1 A;  3NX7 A;  4WBG A;  4PFP A;  2YPR A;  1QHH D;  3LA2 A;  5FFZ A;  2XEP A;  1ZTQ A;  5DF8 A;  2PMH A;  3L2C A;  2K2N A;  4EVI A;  1UAA A;  4HJ6 A;  1PWU A;  3DU5 A;  3CCR I;  3LIA A;  3RPU A;  1YMX A;  3CO7 C;  5D3O A;  1AWC A;  3W6K B;  1PP8 F;  3WHC A;  2XDM A;  1P4A A;  4II2 A;  4WEJ A;  3FXU A;  3CDL A;  5D1S A;  1RR7 A;  3RTR A;  1BI3 A;  3CDI A;  1RI7 A;  4X53 A;  4EUV A;  5B5P A;  2V0W A;  2HKX A;  3ZQQ A;  3ZQF A;  1BI0 A;  4HA8 A;  1KE3 A;  2PD8 A;  2ZXH A;  5C44 J;  4HY8 A;  1OLT A;  2QEX I;  1D3Y A;  2CW8 A;  3OYA A;  4LGW A;  3VOY A;  5DEQ A;  1RET A;  1KQ9 A;  4IHW A;  5E8I A;  4P87 A;  5HLT A;  1RPW A;  1ZQ3 P;  2V8F A;  2PJR A;  4EW7 A;  3H7W A;  1O0T A;  3KSI A;  2J80 A;  2HYF A;  3VP0 A;  2FF4 A;  1FSY A;  3TP0 A;  3EDZ A;  3FBI B;  3K4J A;  1BUD A;  3A0B C;  4MQV A;  1MH3 A;  1S8N A;  1FZP B;  1V5E A;  4D60 A;  1R22 A;  2L7M P;  1VQ6 I;  1WWX A;  2WB1 A;  2K86 A;  1GHP A;  3A0V A;  3H1C A;  3L7H A;  4EJO A;  1OM8 A;  4XLE A;  1LKX A;  2CQQ A;  3SEQ A;  1XFV A;  3DWZ A;  4OQ0 A;  2HGC A;  4IF4 A;  2VGL M;  1OMJ A;  3KSF A;  4G3K A;  5DM6 F;  4KZ4 A;  2W0N A;  1HW2 A;  3LSR A;  2R7D A;  1LJ9 A;  4HMA A;  2KL4 A;  3C2W A;  1G3Y A;  3IX8 A;  4PUS A;  1DGW Y;  3I7J A;  1JTG A;  5JMY A;  2YS9 A;  4JF4 A;  4MIM A;  5GLD A;  1KYZ A;  4IX7 A;  1PWP A;  2CO5 A;  2GXA A;  5EJC A;  3OR1 C;  2Y6D A;  2KIF A;  1E3H A;  2ZC7 A;  2V1D A;  4IQ4 A;  3NQO A;  1PJR A;  2M5W A;  4ZDO A;  1BSW A;  1QIC A;  3KRY A;  3I64 A;  1KGS A;  1Q2P A;  4HYE A;  4CH7 A;  3ZG9 B;  5E1X A;  2OOL A;  3TRC A;  3ECH A;  5H8X A;  2W3D A;  2GAU A;  1T2K A;  1K54 C;  4EUZ A;  4MBF A;  3BJN A;  4NC6 A;  3HXL A;  3DLA A;  4BEH A;  4BEH B;  4E3J A;  2K2G A;  2V20 A;  1SFK A;  4XXR A;  4Z9Q A;  4HEA 2;  5TBM B;  2P74 A;  2V9V A;  5DD4 A;  2L02 A;  3HTS B;  3RQ4 A;  5FL3 A;  3EQL F;  4BXU A;  3HSE A;  3FKI J;  1Y39 A;  3CCY A;  3K2N A;  1BW6 A;  3CUE C;  1ROS A;  2HDS A;  4NKP A;  3K3D A;  1P0Z A;  4HJ3 A;  2QEN A;  2UV1 A;  1K4E A;  3UE0 A;  2HDC A;  2ACJ A;  3RYP A;  2K3F A;  5BOT A;  4B4Z A;  1R1H A;  3A3E A;  4A0Z A;  3S7N A;  1IC8 A;  1H3Q A;  5FRO A;  1YMS A;  3OYN A;  3J80 Z;  4IVN A;  3D3O A;  4F55 A;  3KX0 X;  1BUE A;  4U87 A;  3MQO A;  3E6C C;  1R55 A;  5J6X A;  1GXQ A;  3QAH A;  3R0A A;  3DBA A;  3GTK J;  3LEA A;  4XON A;  1YTY A;  3L09 A;  4F7Z A;  1TC3 C;  2KDK A;  1GUU A;  2JKT I;  1EW0 A;  3J7Y J;  2GJ3 A;  4OIP F;  3UY6 A;  2MJ6 A;  2WY8 Q;  1CIZ A;  2HVS A;  3GO5 A;  1WA9 A;  1FOX A;  3MKL A;  2C5W B;  4Q47 A;  1A35 A;  1LB2 A;  5E3M A;  2XRN A;  4AM3 A;  3P1V A;  3Q2H A;  3MFD A;  4BD1 A;  1LNW A;  2ZQ9 A;  5DFY A;  3SHI A;  1FSE A;  1DTH A;  4PKT A;  4CPK A;  5GTI C;  2EB7 A;  1ZEL A;  2CWE A;  5FO5 A;  4Y5F A;  3ULF A;  4ZAM A;  1GHM A;  2FU4 A;  2ZM0 A;  1WJD A;  4GQL A;  1LPQ A;  1QBJ A;  1K7Q A;  2VBY A;  2YU9 J;  3N6I A;  3ERM A;  2VXD A;  2NVY J;  4BY7 J;  2FSW A;  4WF0 A;  3UB6 A;  1TWG J;  4D5F A;  1YQA A;  5FAO A;  1YLT A;  1UHM A;  1B72 A;  4LCL A;  1LEB A;  4EES A;  5J3L A;  2BXZ A;  2JE5 A;  5FA7 A;  3LFU A;  3VMA A;  3NOP C;  2CUZ A;  2HQN A;  3KP6 A;  1TQM A;  1K83 J;  2Z6C A;  3WS1 A;  1XCV A;  4F3L A;  4F3L B;  5FI7 A;  4ILW D;  4A3C J;  3RFB A;  4KN4 X;  2W3G A;  3P09 A;  3EYI A;  3FMR A;  4ZC3 A;  1PWV A;  4H82 A;  1OCR H;  4BQM A;  1ERQ A;  4ZR5 A;  4A6D A;  1GE7 A;  3ZXH A;  3W2W A;  3I7G A;  3T1S A;  3FMQ A;  5HLH A;  4JQG A;  1GA0 A;  1B3D A;  1OTD A;  4EV0 A;  1ZYR F;  5L3E A;  2PQ8 A;  3LFV A;  2ZD8 A;  3Q81 A;  4IUK A;  2LB9 A;  3O3V A;  2FBI A;  1G59 A;  5D8L B;  2W3E A;  2RKH A;  3A03 A;  3M07 A;  2R7Z J;  3BZC A;  4GYI A;  1DGR M;  4BHP A;  1DU0 A;  1J7K A;  1LSX A;  4IBR A;  4YEL A;  2STW A;  1MMQ A;  1JAQ A;  3I4N J;  2JCH A;  3QWL A;  4PM7 A;  4RGR A;  1ERM A;  4JA1 A;  4Q0J A;  3V8J A;  5MC7 A;  1X3Z B;  1NK3 P;  3R7W A;  1KGF A;  5E17 F;  3TL4 X;  2AO9 A;  2E34 A;  2E2H J;  3BZK A;  2DW0 A;  5CXW A;  1LSW A;  1IYP A;  2E8J A;  3RXW A;  3OPH A;  3CUO A;  3VYS B;  4W1U A;  2TCL A;  4EQ1 A;  4H84 A;  4WZV A;  2D1O A;  1NRJ A;  1PRQ A;  2DMN A;  2XIG A;  1BUV M;  5J4E A;  4L5J A;  4AIG A;  4RM3 A;  2DU9 A;  2LFB A;  4JOM A;  2VL8 A;  2GNX A;  4IEJ A;  4A7B A;  1HD8 A;  2VN2 A;  1ES4 A;  4XM6 A;  4UV9 A;  2ZC6 B;  1A31 A;  1RRJ A;  1CK3 A;  2X1D A;  1OO9 A;  3UB9 A;  2UXX A;  4N1H A;  3CUQ C;  2Y31 A;  2E8I A;  5CTM A;  1IGN A;  3VE3 A;  3PSF A;  1ZKG A;  4RBO A;  4ENK A;  2Y2N A;  2OWH A;  2NYX A;  1RGZ A;  2F5D A;  4CCL A;  3HY9 A;  4E70 A;  3E7L A;  2BV6 A;  2IGN A;  3ZQL A;  5DKK A;  4S2N C;  5E18 F;  3CME I;  4LMY A;  1FX7 A;  3V96 B;  1IFQ A;  4IHQ A;  4H30 A;  3GQZ A;  4JP4 A;  3HL2 A;  4QPQ A;  2D1H A;  2E19 A;  3H82 A;  2WV1 A;  2CQK A;  1JAO A;  5K7H A;  5EGO B;  2D1N A;  1MMA A;  1TQI A;  3LO7 A;  3AG2 H;  1O0Q A;  3I59 B;  1ZS0 A;  2FNP A;  1D5V A;  1OCT C;  5E2F A;  1MWT A;  4CLC D;  3DP7 A;  1LI9 A;  3F1N B;  3OSG A;  3PXP A;  3CCL I;  5LRR A;  3G3Z A;  2X3B A;  2WGV A;  1D1A A;  2OLU A;  4H3X A;  2XAQ A;  1B6A A;  4II3 A;  2EFW A;  3CP8 A;  4YG2 F;  1ZTU A;  1U3E M;  2DOF A;  5IT9 K;  1ZVX A;  4E7H A;  4X25 A;  4XOT A;  4U0V A;  4NQW A;  4BU2 A;  1K6S A;  3O2X A;  2GOM A;  1VQ7 I;  2ZXW H;  2WB1 N;  2BZT A;  2ZXI A;  3F1A A;  2M7B A;  1N9B A;  2W14 A;  1AWI A;  2DDY A;  2EZI A;  3UDF A;  2JT6 A;  3KP4 A;  2IS4 A;  3W6J B;  3GLL A;  2P7J A;  2JA7 J;  1I27 A;  3RTS A;  2KIU A;  3SH9 A;  1X58 A;  1BZS A;  4MQ9 F;  2L7F P;  1LFB A;  3S7P A;  4P9U A;  3U1D A;  4L9V A;  4PCQ A;  4Y0O A;  1GVJ A;  3ZG8 B;  3CKI A;  1T1C A;  3G30 A;  1U8B A;  1XSD A;  1Z1D A;  4M6V A;  2XLN A;  1REP C;  4EM2 A;  1K38 A;  4OP5 A;  2CLT A;  2K9M A;  2VJ5 A;  5B1A H;  4UVB A;  4I6Z A;  3DPU A;  5CGW A;  5LFA A;  4FCF A;  3FKJ A;  1XFN A;  2EWV A;  3H9Q A;  3IQA A;  1K57 A;  2PR5 A;  1S9H A;  5H20 A;  3HEF A;  4RGU A;  2BG1 A;  4DF9 A;  4P9F A;  1IUY A;  2BY0 A;  5M5W J;  4OQI A;  1CXV A;  3BFF A;  4A0Y A;  2NVQ J;  3IKV A;  1Z6T A;  1UWP X;  1BYW A;  1JAP A;  1CF0 A;  2QWS A;  1RP5 A;  1BUL A;  2DW2 A;  5EVI C;  1TDG A;  2EWW A;  5HPF A;  1LQ1 A;  4PKU A;  3DTE A;  3SH7 A;  1PWW A;  3F18 A;  1SFU A;  2ZLY A;  2R5Y A;  3JW4 A;  4FTH A;  3SDG A;  3ZG5 A;  3E4P A;  4WK7 A;  2Q1Z B;  1SVO A;  2MW8 A;  1EB6 A;  4JXW A;  3SOI A;  5M5Y J;  4OPY A;  1G12 A;  3ZXS A;  3QOP A;  4YII A;  1MMR A;  3JRE A;  3OWT A;  5CGS A;  1MMB A;  4U88 A;  1TP4 A;  3V8L A;  3FK7 A;  5FQM A;  4ZYH A;  4F93 B;  2XPU A;  1RCJ A;  3JRA A;  3PBO A;  1V4R A;  5EOE A;  4N9K A;  2OZ6 A;  4H6J B;  2Q2E A;  1W36 D;  5DKL A;  1YW8 A;  1RMZ A;  2WO8 A;  1OTB A;  3IWO A;  2VGL S;  3TOI A;  2LP0 A;  2E5Z A;  3HOX J;  1N9N A;  4G9Y A;  2F5F A;  3W4O A;  2HQ5 A;  5CVJ A;  2KDZ A;  3LJG A;  3HOW J;  5CER A;  1QQI A;  4Y3I A;  4FET A;  4WMC D;  2IEK A;  2FXA A;  3HHH A;  4MBK A;  2E60 A;  3TVC A;  2L0W A;  5BOH A;  4L9E A;  1ONG A;  1K55 A;  1VQ5 I;  2QUF A;  2VQH A;  3WWX A;  2LDU A;  5HDN A;  3C5A A;  4S05 A;  4J4M A;  2CGP A;  3PUB A;  4HNT A;  3H5N A;  2XPV A;  1EH6 A;  3CPT B;  1IAC A;  2PYR A;  4HQE A;  3VB2 A;  3TSG A;  4CCM A;  4UUS A;  1ULY A;  2ZMV A;  2P7C B;  1MBH A;  2F5V A;  3ZQC A;  3UE1 A;  5L3G A;  2QYB A;  4FIS A;  5I4O A;  4WZ4 A;  3LQR A;  2O0Y A;  4IO9 F;  4E7J A;  2HDQ A;  4A3D J;  5M1A A;  2WKE A;  2M8E A;  3LUM A;  3WRZ A;  2KRH A;  4A3W A;  3G1L A;  2LKP A;  4PKY G;  3SH8 A;  5TGF A;  2FJ1 A;  4IHV A;  3MQQ A;  2FA5 A;  1JUM A;  3G42 A;  3GVA A;  5IP6 A;  2JNP A;  2CQ7 A;  2KQR A;  3OZH A;  4KUK A;  2JQ7 A;  1C8T A;  2ZME C;  2NVT J;  1OTI A;  3JCU C;  4L5E A;  3CF5 F;  2Y2L A;  3F0C A;  3W4P A;  3F15 A;  3WE2 A;  4DE3 A;  2HFH A;  2OVX A;  1UMS A;  2DI3 A;  1HFC A;  4AUO A;  2JWT A;  1IYO A;  4I3J A;  1OS2 A;  3AKZ A;  3H0G J;  2DOA A;  2LBF B;  3AGD A;  1MBG A;  1TNS A;  1ZG1 A;  2ZQ8 A;  2X9D A;  4I09 A;  3C38 A;  1GO8 P;  4WM9 A;  966C A;  1MIJ A;  1YQY A;  5I43 A;  1OS9 A;  3SFI A;  4DZJ A;  2Z2L B;  4DXB A;  1MMN A;  4FCY A;  3K1M A;  4MN7 A;  1O07 A;  1IEL A;  5B5E C;  1Y4O A;  2CU7 A;  5IT3 A;  1V5G A;  3NWT A;  1UEA A;  1SHV A;  2EZH A;  5EEC A;  1HXD A;  4PGG A;  2VBW A;  2QBY A;  3CMA I;  3ASO H;  5ED4 A;  1Y6I A;  3A3J A;  3ZMU A;  1EA3 A;  3BQZ A;  4PKY A;  4I2O A;  3GSG A;  3OYI A;  4BL2 A;  2E71 A;  2EX8 A;  2HNH A;  4ARZ A;  5LBR A;  3Q7V A;  1WZ2 A;  1ZGJ A;  3HM5 A;  5IYB J;  4CHU A;  2JSD A;  2COB A;  1XGM A;  1MWS A;  2DA6 A;  1RIO H;  1P6R A;  4OPR A;  3G5C A;  3HDA P;  1WKM A;  3HTU A;  4GS9 B;  2H1L A;  4AWX B;  1AST A;  1D5Y A;  2ECC A;  1MJB A;  4B8X A;  1F4K A;  4OOL A;  2ERP A;  1U9O A;  3W6V A;  2KZG A;  4ASN A;  3DPF A;  1IUF A;  3MXQ A;  1MMP A;  2HZT A;  1KUI A;  3IF6 B;  5ILS A;  1U0J A;  3J81 K;  2QQ9 A;  2RJQ A;  2D02 A;  3A01 A;  3A01 B;  4O01 A;  1K54 A;  2YIG A;  3NEU A;  1TD5 A;  1K4F A;  1OYW A;  1L0D A;  3IXD A;  2PBY A;  4IHS A;  3OIO A;  3WTX C;  1A0K A;  4IHT A;  3FKV A;  2F4I A;  3S8P A;  1X19 A;  4I5S A;  3GXO A;  2FFY A;  4LOC A;  4K08 A;  3Q07 A;  3V7R A;  4AID A;  4U0T A;  2V6E A;  2VJJ A;  3ABK H;  4XIC A;  2IWD A;  4F92 B;  5EEG A;  1ON1 A;  1ERO A;  4DBQ A;  2DFE A;  1G4K A;  3V3S A;  1T0F C;  3CUE A;  4L7A A;  2STT A;  2L3D A;  3OL4 A;  3L1P A;  3DLL F;  2KZV A;  1H89 C;  4KZ8 A;  1MSE C;  4PGH A;  1Z21 A;  3TDZ C;  2AXT C;  2E2D A;  3IWQ A;  3LL7 A;  1FIK A;  1FQG A;  3WG9 A;  3OIQ A;  3JR9 A;  5DVA A;  3S16 J;  4BHB A;  1Z3X A;  3WTS C;  4CCJ A;  4RMN A;  2B95 A;  3BR5 A;  5I2Z A;  2K9N A;  1FMW A;  2DDB A;  1P2F A;  1YP1 A;  2HPB A;  2XR0 A;  4M6Y A;  2LK2 A;  4GRI A;  1T38 A;  1SDN A;  1Z77 A;  1T8I A;  1UTZ A;  1FLS A;  5EYR A;  1KYW A;  3S93 A;  4JGP A;  1O7L A;  3BWG A;  3U1K A;  1I5Z A;  4M3G A;  2JRM A;  2VAS A;  3H9G A;  3VOE A;  4BJT A;  2FBH A;  3LFK A;  4XLA A;  3BRM A;  5HLG A;  2E1M B;  4KT6 A;  3B47 A;  1I2W A;  1ZRD A;  1H8Y A;  4WX9 A;  3MZY A;  2FBK A;  2MLG A;  2Y69 H;  3PIO F;  2X1E A;  1ETQ A;  4DNC A;  2XA7 M;  1U5T C;  3R0J A;  1K78 A;  1GA9 A;  2J3T D;  1HW1 A;  1LL8 A;  2XSJ C;  5F1J A;  2HDD A;  1E3U A;  2M0M A;  1UFM A;  3F21 A;  4Y0T A;  1FBU A;  3UNG C;  2WV0 A;  4EGZ A;  1PZO A;  2NUP C;  1AKH A;  2K85 A;  3CMM A;  1CQA A;  5D5V B;  1YFH A;  2O3E A;  1G05 A;  4XRS G;  4C2T A;  2Z33 A;  2NRA C;  4MTE A;  5HZH A;  1G49 A;  4W97 A;  4XOR A;  4KZ7 A;  1IRZ A;  3OIP A;  2XRL A;  2DFI A;  1YIT I;  4L0L A;  2CMN A;  1ORK A;  2K4B A;  1YLY A;  4L9N A;  1HDD C;  3NRV A;  2OXW A;  1S29 A;  2H0Y A;  1MH4 A;  4Y33 A;  2VPL A;  3ZN1 A;  3QPH A;  2MH9 A;  1APL C;  2YKF A;  2Y2H A;  1VET A;  3JRF A;  1F98 A;  3TBI A;  3BYD A;  5FKO A;  3KYZ A;  4BL3 A;  3SXY A;  2V8C A;  2QQ8 A;  5J8X A;  5ICG A;  3UPP A;  4S2K A;  1HC8 A;  3NCK A;  2Y2Z A;  4NXB A;  1SU3 A;  3HPG A;  1SAT A;  1KBC A;  3G2Y A;  1ZC2 A;  1YRN B;  2V7F A;  1QHG A;  3W4Q A;  2Y2Q A;  5A91 A;  2DK8 A;  5F1G A;  3HYI A;  2F48 A;  3GX4 X;  1JAN A;  2J0T A;  4DE2 A;  3LSG A;  2R4G A;  1TW2 A;  4XKB A;  1QZE A;  2ZQC A;  4A93 J;  1BBY A;  2HXI A;  2PD7 A;  1M6K A;  3MD2 A;  3OLO A;  3JVV A;  2LY9 A;  1QO0 D;  3WTW C;  2AXL A;  4RAZ A;  2UXN A;  5KSH A;  2ZKZ A;  5IOZ A;  3GDI A;  2XD1 A;  4HV5 A;  3JRI A;  3A0R A;  1TW3 A;  2MZE A;  1OYY A;  1G2H A;  2N8G A;  4P55 A;  4R23 A;  4YRV A;  1GDT A;  4M4X A;  3NC8 A;  3KHI A;  2W1O A;  3T1X A;  3FC7 A;  1FBS A;  3M6H A;  4PK4 A;  2OU2 A;  1YAX A;  3I53 A;  4IJA A;  3CHW P;  1T39 A;  5IP7 J;  3ZFZ A;  3N7W A;  4A0X A;  1MZU A;  2OAP 1;  1FM1 A;  4RGS A;  5CEB A;  1N4O A;  2L4M A;  2YKH A;  4M9Z A;  3S32 A;  3GME A;  2QQB A;  4IHY A;  2RVC A;  3BEC A;  2WAD A;  5J1R A;  3CTA A;  4R4S A;  2K9Q A;  4G7Z F;  3CJQ B;  3U4L P;  1MBJ A;  4M6X A;  2A5Y B;  2DDF A;  1PWC A;  2XGX A;  2PT7 A;  3F3X A;  3OHL A;  1HZO A;  3TQN A;  2BE5 F;  1MBE A;  1PI4 A;  3C4P A;  4MNU A;  1B9N A;  3LOC A;  3L0V A;  3UB5 P;  5HWT A;  3AL0 B;  1OJ5 A;  2K4J A;  1NH3 A;  1D8K A;  1SD6 A;  4L6T A;  3WTV C;  2NOG A;  3P24 A;  3CUQ A;  4OLG A;  1FY7 A;  2LY2 A;  5LD2 C;  3GFM A;  4L0Y B;  3S14 J;  3D1N I;  2WGW B;  1WHU A;  5LEK A;  2P5L C;  1WI9 A;  2VJI A;  2O36 A;  1Z05 A;  5TIS C;  1I39 A;  2VV6 A;  3LKA A;  1VF9 A;  3LEZ A;  4S2N A;  5IHV A;  4NHJ A;  1A6I A;  3LUN A;  1Y0N A;  2JPC A;  3TT4 A;  3BM6 A;  1EUB A;  3RTY A;  4X0G A;  1OPX A;  3QP5 A;  5IT9 Z;  1OJG A;  3BJA A;  5ICE A;  2CS3 A;  1DJB A;  4ZYA A;  2RQP A;  2VON A;  3HLB A;  2F5C A;  5IU1 A;  4JGO A;  1AU7 A;  3F19 A;  4DD8 A;  4XBF A;  1ERD A;  1UST A;  4KMU X;  3ZVT A;  3MXS A;  5CVI A;  2EZL A;  2Z99 A;  3FIS A;  3CC2 I;  3CDH A;  3RIR A;  1HKT A;  1R58 A;  2VBZ A;  3PBQ A;  3E0Y A;  1G6A A;  3B42 A;  3TSK A;  3F6V A;  5I94 A;  3KP2 A;  4HEF A;  1L2S A;  3VE4 A;  3GTM J;  3E6M A;  4KZ6 A;  3USN A;  1ES2 A;  3K3C A;  1WPK A;  2VXZ A;  1VQN I;  2BY2 A;  4ZJ2 A;  3DWK A;  2XAG A;  3L2U A;  4AUX A;  4M3B A;  3NDE A;  1WQ2 A;  1Z7U A;  2I9V A;  4ZTK A;  3SZP A;  3FZV A;  1AKL A;  3MCZ A;  3MZD A;  2W1T A;  2W1T B;  5EDN A;  2F6C A;  4LLO B;  2H09 A;  3REO A;  2SRT A;  4QB8 A;  1SVL A;  1HBX G;  2P0W A;  4B3X A;  5HS9 A;  2DOE A;  1S4B P;  1O3Q A;  4ZYD A;  2E5N A;  4UA6 A;  4DYQ A;  2LNB A;  2A05 A;  2L9N A;  3E8R A;  2VX8 A;  1ALQ A;  3QP2 A;  4UAA A;  4C2U A;  5FRN A;  4RLF A;  3CCE I;  3DFG A;  2R9W A;  2H1K A;  2X6O A;  2ZFW A;  4UNO A;  4Q0H A;  2Q9M A;  3T4J A;  4CYC B;  5AJG A;  2BHZ A;  3HRM A;  4FHT A;  3A0H C;  4MNR A;  2A6H F;  5TFQ A;  1MDM B;  1DJC A;  1W5D A;  4JXS A;  4PJ0 C;  3OS0 A;  2VKV A;  4OMZ A;  5HX9 A;  1LT0 A;  5DF9 A;  3E98 A;  3CZD A;  4BUP A;  1YT4 A;  2KDO A;  4AD9 A;  1HDP A;  5EVI A;  1H9G A;  3LSI A;  5CGX A;  3BFE A;  1HST A;  1O57 A;  3T12 B;  1D8J A;  2ESH A;  3ABU A;  1HFS A;  3GFI A;  1T6S A;  4D7N A;  2ZBK A;  5H2F C;  4DPE A;  1AOY A;  3G6O A;  1IN7 A;  4HX3 A;  4IOC F;  5HD5 A;  4L63 A;  2IT0 A;  2PBD P;  3KEY A;  1HKS A;  4B44 A;  3PTE A;  2VLA A;  3OOU A;  2O99 A;  2QWW A;  5FEF A;  4U7D A;  1B8I B;  3UE6 A;  1IXS B;  2CG4 A;  1NHA A;  2OCE A;  2LOO A;  2UWX A;  3RZD J;  3N4M A;  1JXS A;  1YX5 A;  2DT5 A;  4LPZ A;  2P8T A;  1T98 A;  1S1Y A;  3IS2 A;  3KPH A;  4K2E A;  1P7J A;  1JT6 A;  3F1P A;  3F1P B;  2O3F A;  2A61 A;  4CLC C;  3KEQ A;  4G3V A;  3DEW A;  2XFT A;  4E7L A;  4Q48 A;  4OOY A;  3N05 A;  4X69 A;  2IBD A;  1GXD A;  5EUA A;  3C7U A;  2W3H A;  5A8B A;  2DA2 A;  2OAQ 1;  2Z2D A;  4MCW A;  3ZQI A;  2Y8H A;  2G0E A;  1L0E A;  4EEF G;  1VND A;  3M2J A;  1YSP A;  2M3A A;  1GHC A;  1MND A;  2H6C A;  2L2O A;  4OAZ A;  2ZSI B;  5FKK A;  4S2I A;  5JR3 A;  4JYK A;  1W7P A;  2W15 A;  5G4Z A;  4JGR A;  5ICF A;  1TWC J;  4GYG A;  4KNY A;  1B59 A;  4AC0 A;  4NET A;  4AYK A;  5CRF A;  3U21 A;  2NNY A;  1M1E B;  4BDZ A;  3S2D J;  4GGG A;  2I47 A;  3SFZ A;  2JA6 J;  1XB4 A;  1NLY A;  4JX6 A;  3KZZ A;  3ESW B;  3TJZ C;  3LR3 A;  3HGY A;  4IJO A;  4B4C A;  5HS7 A;  3UPN A;  1T95 A;  2JK3 A;  3WGI A;  1NJ4 A;  4KIC A;  5L3C A;  5K7Z A;  4GCZ A;  1CI8 A;  1W63 Q;  1KU3 A;  4OAY A;  2FRH A;  5KAI C;  1ODV A;  4HH3 A;  1TS0 A;  1JT0 A;  3BR6 A;  1H5X A;  3RPQ A;  4L9F A;  5FB2 A;  3D5R C;  4JXV A;  3ECO A;  4HNB A;  3B6A A;  2QVO A;  3V7C A;  2OQR A;  3SJM A;  3VV4 A;  2ZME A;  3TW6 A;  1BTL A;  1A86 A;  3GEZ A;  4JQF A;  1KQ8 A;  3V42 A;  1IAA A;  3S4X A;  1KVM A;  3ISP A;  4XN0 A;  1K7G A;  2I72 A;  4RAG A;  4GDN A;  2BLS A;  4FX0 A;  3T5X A;  3G34 A;  1GKD A;  1FP1 D;  2MSY A;  3C7V A;  4LG0 B;  1X3W B;  1O3T A;  3GVB A;  5CQG A;  1KGG A;  2VV7 A;  3ELK A;  2ZCW A;  4M3E A;  4LLG F;  4Q0I A;  1IAB A;  3H5R A;  5G18 A;  1ESI A;  2RGV A;  1FYK A;  3LJZ A;  2Z3Y A;  1A5J A;  5AIP A;  3F23 A;  3TW8 A;  4BBR J;  3BY6 A;  1OT9 A;  2P7V B;  1BC8 C;  1QPI A;  2XA7 S;  1IRX A;  3O87 A;  5GTH C;  1X3U A;  2DRW A;  4JGQ A;  5CEC A;  4S2P A;  2OXU A;  3FWE A;  1UWN X;  3EOI A;  3HGG A;  4DXC A;  2O9B A;  5A92 A;  1D8M A;  2X3A A;  2QSH X;  1SAU A;  3C2H A;  4B4X A;  2INW A;  3I5U A;  2XV4 S;  1W36 C;  3LR0 A;  2GOX B;  1O7F A;  4EQQ A;  2YUF A;  1NYY A;  3OY9 A;  2P9V A;  2DFF A;  2OUM A;  3J81 Z;  3LSK A;  5J47 A;  5I5L A;  1EWZ A;  1K6Y A;  1RNL A;  2QM3 A;  1EH7 A;  2TDX A;  4ZH4 F;  4XSZ F;  1GVD A;  1MKM A;  1R5I D;  1TNT A;  4CO8 A;  4ESP A;  2V1Z A;  3O88 A;  3KFW X;  1XPB A;  1NY0 A;  2Y48 A;  3AG1 H;  4D5C A;  1XP4 A;  4JX5 A;  1EV7 A;  2XAS A;  1TQP A;  3MFX A;  3F9K A;  2ZQA A;  5BPA A;  4HW0 A;  1S6R A;  1ES3 A;  1UTT A;  3K69 A;  3AYK A;  3DTK A;  2ELJ A;  3S7Q A;  1QVU A;  3ROU A;  4QWO A;  3JAM Z;  2XGD A;  1A36 A;  4OOI A;  3VI1 A;  1T08 B;  4DJA A;  3PO2 J;  3Q2G A;  1Y0U A;  3LIF A;  4FU4 A;  3GZ5 A;  4XUX A;  4LRY C;  4R1G A;  4RQ9 A;  3KWV C;  3MKW B;  2XF5 A;  2NUT C;  3WS2 A;  1V55 H;  2BYV E;  3QU6 A;  2C6Y A;  3IBJ A;  2G2W A;  3EDG A;  4S0H B;  3ITA A;  1DP8 A;  5ILU A;  3MS6 A;  1T0F A;  4EMS A;  2GXG A;  1XGI A;  2VGK A;  5AON A;  3E0J B;  3SZT A;  4C9Y A;  2ZM8 A;  2VJW A;  4R3A A;  1HTZ A;  3HBL A;  1J09 A;  1VQ8 I;  4ESJ A;  2IW5 A;  3T4K A;  2ZJR F;  2EH3 A;  1XUC A;  2MG4 A;  3B3X A;  4MN6 A;  4EEP A;  4IRH A;  3Q3S A;  1YHQ I;  2A3S A;  4DJ2 A;  1ZHF A;  2VB6 A;  2IS6 A;  2RL3 A;  3IWI A;  3F1O A;  2CSO A;  4UVA A;  4HLX A;  1KUH A;  456C A;  4C3Q A;  2K5C A;  3TG9 A;  5FJ8 J;  4RM2 A;  2CMP A;  4R8H A;  3BLY A;  1K56 D;  4G0D A;  2BEO A;  5D5X B;  2IA1 A;  2YUS A;  1JKP C;  1LE8 B;  3CIT A;  3D72 A;  1SLM A;  2OV7 A;  3NUL A;  2QA4 I;  1YLJ A;  2I5U A;  5FEG A;  1ZLJ A;  1JWZ A;  3F17 A;  2WA0 A;  2ZC3 B;  2OTJ I;  3PBR A;  3BDD A;  1NXY A;  3GFL A;  4RYE A;  2HYJ A;  3PFY A;  4ZJZ A;  2ZC2 A;  3VP4 A;  5F08 A;  2HDR A;  2XAU A;  2FD5 A;  3I4P A;  1UMT A;  5EZG A;  3GFJ A;  1JJ8 C;  1U60 A;  4GCV A;  2O6G E;  4KZ9 A;  2JRT A;  1X1D A;  5ICC A;  2M1B A;  3B8Z A;  1E4D A;  2R92 J;  4HBL A;  3QPT A;  3MF0 A;  1P9W A;  4UHT A;  4FT8 A;  4BE1 A;  2HJ9 C;  4A6E A;  1RUN A;  1Y93 A;  4X1L A;  1TWH J;  1BR1 A;  2XF7 A;  5IY5 H;  4BBU A;  2HXO A;  3BG7 A;  3EGX C;  4FQG A;  2IA2 A;  3DNG A;  4LV3 A;  2K3P A;  3DBH B;  4N9L A;  1QMF A;  5JYP A;  2MBF A;  5HS8 A;  2V6C A;  1S67 L;  1ZP5 A;  2JVG A;  1FOY A;  3ZCO A;  1GLN A;  4EJW A;  3PR6 A;  4QWQ A;  2QPJ A;  4HQA A;  5L09 A;  4E3K A;  2ZOH A;  2EFX A;  1LSV A;  3S3M A;  2Y30 A;  5FQQ A;  3UB8 A;  4LRX C;  5F64 A;  2FNA A;  2RAE A;  4QIW N;  4HES A;  3OYH A;  2XUB A;  2AIG P;  4PMA A;  4Y7N J;  3O6B B;  4ZDL A;  1GSX A;  4JBA A;  2LD5 A;  3F8F A;  4LK1 F;  1EJ9 A;  4NXG A;  3Q7Z A;  2TRT A;  2ZL1 A;  3NAU A;  2Q9N A;  3PNY A;  4I01 A;  2M9H A;  4Q5S F;  3V67 A;  3MMH A;  1IZ1 A;  2A5W A;  4OOM A;  1QU3 A;  2PR6 A;  4LV2 A;  5HFO A;  3VOZ A;  5JYO A;  4H8R A;  1B8Y A;  1NTC A;  1DJA A;  2DO7 A;  2PU4 A;  2FOK A;  1UGU A;  2QKM B;  4XMY A;  1PUF B;  2HOE A;  4R3B A;  4KQQ A;  3PNV A;  3FDY A;  3D4F A;  4I76 A;  3M7G A;  5AQA A;  2X0L A;  1YE9 A;  4HLY A;  3LIB A;  1SD5 A;  2HKO A;  2HVR A;  5EG0 B;  2HV1 A;  2CV2 A;  3EUH A;  1G68 A;  1DUX C;  4X68 A;  4N4N B;  2D01 A;  4GXO A;  1KON A;  4GR0 A;  4WKI A;  1Z6F A;  2V1B A;  1SMT A;  3GZ6 A;  2VKE A;  1ZRF A;  1AXB A;  2PYP A;  1KUG A;  4KG6 A;  3T4L A;  4ZRR A;  1TS8 A;  3CWF A;  1IDY A;  2G9W A;  3KIO A;  2L4R A;  4R3V A;  2OVZ A;  3ONQ A;  1UHW A;  3NOT C;  1ZR4 A;  1LI0 A;  5F6A A;  4OQH A;  1I1S A;  2FH5 A;  2JT5 A;  4NXE A;  4XKV A;  3V50 A;  2J3T C;  2PG4 A;  5FSR A;  3GEC A;  2JJ7 A;  3BLM A;  2CRG A;  2ISZ A;  3WS5 A;  1F9I A;  3OYC A;  2J9O A;  3KO6 A;  3W2A A;  4XK4 A;  1HA8 A;  2A69 F;  1VB6 A;  2G7H A;  1ACF A;  5GHX A;  2VE9 A;  3MKY B;  3EGD C;  2DPD A;  1XGJ A;  4DYR A;  1MNE A;  3V4G A;  4DZP A;  4IUH A;  4DW6 A;  5CXA A;  3HJE A;  3LYX A;  5HW3 A;  1SVM A;  2DTR A;  2KKO A;  3K4M A;  3KP5 A;  5BPI A;  5K1Y A;  3G4P A;  4IHX A;  5EFW A;  1K25 A;  5H6Q A;  3U9G A;  3LE9 A;  3HBR A;  4MFE A;  4E3L A;  2IPQ X;  5EEA A;  3BQA A;  3WV3 A;  4HF1 A;  3VYT B;  4EFS A;  2HR3 A;  1BW5 A;  3WHB A;  4M9X A;  1BI1 A;  4IBX A;  2PFB A;  2R5Z A;  3F72 A;  2PN6 A;  1TWF J;  4LLN A;  4C3J J;  1V9Y A;  2H8R A;  4XT2 A;  4XT2 B;  1ETY A;  5BOY A;  2EX6 A;  3FM5 A;  3H35 A;