1ZS0A

Crystal structure of the complex between mmp-8 and a phosphonate inhibitor (s-enantiomer)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil collagenase
publication title Structural insight into the stereoselective inhibition of MMP-8 by enantiomeric sulfonamide phosphonates.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1zs0A00
1OM8A 1USNA 1BM6A 3Q2GA 2OI0A 4H49A 4L19A 1SU3A 5BPAA 3KECA 1SLNA 2OY2A 2XS3A 3HBVP 1SATA 3KEJA 2OXWA 1O0TA 1OMJA 1HFCA 3LJTA 1B3DA 4I35A 2KRJA 4IN9A 1SMPA 1JK3A 3LJZA 1CQRA 2TCLA 2ERPA 2W14A 2HU6A 2CKIA 5D7WA 2J83A 3ZVSA 1EB6A 1DTHA 2OW2A 1KBCA 4GR8A 3BA0A 3KMEA 3UVCA 1D8FA 1MNCA 1OS9A 1GE6A 4DD8A 1KUFA 1GKDA 1QIBA 2POJA 3L0VA 2DW1A 4WKEA 4R3VA 5I0LA 1BQOA 1C8TA 1EUBA 1AKLA 1Y8JA 4PKQA 4ILWD 4AIGA 1DMTA 3DPFA 5I4OA 4FXQA 5CZMA 1L6JA 3ELMA 2Z2DA 1JIZA 4WK7A 5I3MA 1BKCA 1GO7P 1HY7A 2JT6A 2JT5A 1XFVA 3RTSA 4Q1LA 1H71P 1R1IA 3G42A 3ZXHA 4AXQA 3DPEA 1IAEA 2X3CA 2MLSA 1JIWP 3AIGA 2DW0A 4ZR5A 1R55A 1XUCA 3F1AA 2Y6CA 1RM8A 1CIZA 1JAQA 1ROSA 2OY4A 2X3BA 2V4BA 3LK8A 2MZHA 1EAKA 3EHYA 1IAAA 1J7NA 5D3CA 4PKSA 1BQQM 4IUWA 1I73A 830CA 2J0TA 4DV8A 1UTTA 3HYGA 3LIKA 3EWJA 2FV9A 1XURA 1Y93A 3HB2P 1BIWA 1Y0VA 1AF0A 1QIAA 1KUKA 4PKRA 4PKWA 1K7IA 2L0RA 5L79A 3AYUA 3USNA 4H84A 3LIRA 4WKIA 3OHOA 1XFZA 2DW2A 4JP4A 4XM7A 1GO8P 1KAPP 1CAQA 3RTTA 1SRPA 2YB9A 2W0DA 3N2VA 2DDYA 1CGLA 1UMTA 1KUHA 3B92A 2O36A 3K7NA 1AYKA 3AYKA 3LEAA 5I12A 3EDIA 2D1OA 1IACA 2E3XA 1K7GA 2USNA 5B5OA 1BSWA 2N8RA 4GQLA 2X7MA 1GKCA 2ERQA 3F15A 1JH1A 1YP1A 3DWBA 3LILA 1JAOA 1HTDA 2X3AA 3LUNA 2RJQA 4A3WA 3KRYA 1O0QA 2MZIA 3TSKA 1KUGA 1HOVA 3LQBA 2K9CA 1I1IP 1CGFA 2DDFA 4XCTA 1XFWA 2A8HA 3LQ0A 3F19A 5D1UA 2OXUA 3F16A 4H2EA 1CGEA 5D1SA 4GF1A 1BKCE 1OM7A 1A85A 2OZRA 2W15A 1D7XA 3TVCA 1QUAA 4JPAA 1UTZA 4FVLA 2MLRA 1XFUA 1G4KA 1XFXA 1Z3JA 1JJ9A 3HY7A 3NX7A 4H1QA 2W13A 3KEKA 1S4BP 4JA1A 5B5PA 3EHXA 1G49A 3LE9A 2EROA 5D2BA 2OVXA 966CA 2AIGP 1ASTA 5D1TA 1Q3AA 3TT4A 1C3IA 3LJGA 4ON1A 4GR0A 3CKIA 3WV3A 4GUYA 1YCMA 5BOYA 1BZSA 3E8RA 3SHIA 1D8MA 3B8ZA 1PWPA 2MZEA 3B2ZA 4L63A 3F18A 5I43A 3HY9A 1JKYA 1G9KA 1ZVXA 2OW9A 4XM6A 2I47A 2JSDA 2SRTA 1BKCI 3LUMA 4EFSA 1R1JA 1G05A 1BUVM 2OW1A 3DSLA 5H8XA 2PJTA 3VI1A 2RJPA 2CLTA 1BUDA 2W12A 3O2XA 3F17A 5CUHA 3LKAA 3I7GA 2WO9A 4DPEA 1UMSA 3V96B 3L0TA 3HDAP 1ZP5A 3KHIA 1SLMA 4IJOA 4GWNA 1IADA 4AUOA 4G9LA 2D1NA 1ATLA 1PWUA 3N2UA 1A86A 3DNGA 2XS4A 4JQGA 1QJIA 1ND1A 4WZVA 4GWMA 1OO9A 2OVZA 3EDHA 1B8YA 3P1VA 4H82A 1D5JA 1R1HA 1FBLA 1CXVA 2JIHA 1MMPA 4I03A 4PKUA 1ZXCA 3P24A 1GE7A 3ZUKA 5BOTA 456CA 2K2GA 4HMAA 1MMQA 3HBUP 1GXDA 4H30A 1I76A 5CXAA 3GBOA 4XBHA 4PKVA 1YOUA 1GE5A 1RMZA 3LGPA 3LMCA 1FLSA 2O3EA 1HV5A 3TS4A 3EDGA 1XUDA 1HFSA 4FXYP 1PWQA 1OM6A 1JAPA 3G5CA 3KMCA 3HDBA 1C7KA 4FU4A 4H76A 1CK7A 1YQYA 2OXZA 5I2ZA 1UEAA 4H3XA 1KUIA 1FM1A 3VTGA 2JNPA 1ZS0A 2QPJA 4AYKA 4PKTA 2E2DA 4HX3A 4XM8A 4J4MA 1QICA 2AYKA 4JIJA 4L6TA 1ZTQA 2WOAA 2YIGA 1MMBA 2WO8A 3OHLA 5L7FA 1PWWA 2FV5A 4WF6A 3KWVC 4CTHA 5JMYA 3I7IA 4G0DA 3K7LA 3U1RA 3MA2A 1K7QA 3WV2A 1MMRA 5LABA 1PWVA 1OS2A 4A7BA 4QKZA 1G12A 2Y6DA 1JANA 3Q2HA 1ZXVA 1R54A 3EDZA 1IAGA 1QJJA 1IABA 3WV1A 3O64A 2OW0A 1WNIA 3DL1A 1XFYA 4GR3A 4DF9A
chains in the Genus database with same CATH superfamily
1OM8A 1USNA 1BM6A 3Q2GA 2OI0A 4H49A 4L19A 1SU3A 5BPAA 3KECA 1SLNA 2OY2A 2XS3A 3HBVP 1SATA 3KEJA 2OXWA 1O0TA 1OMJA 1HFCA 3LJTA 1B3DA 4I35A 2KRJA 4IN9A 1SMPA 1JK3A 3LJZA 1CQRA 2TCLA 2ERPA 2W14A 2HU6A 2CKIA 5D7WA 2J83A 3ZVSA 1EB6A 1DTHA 2OW2A 1KBCA 4GR8A 3BA0A 3KMEA 3UVCA 1D8FA 1MNCA 1OS9A 1GE6A 4DD8A 1KUFA 1GKDA 1QIBA 2POJA 3L0VA 2DW1A 4WKEA 4R3VA 5I0LA 1BQOA 1C8TA 1EUBA 1AKLA 1Y8JA 4PKQA 4ILWD 4AIGA 1DMTA 3DPFA 5I4OA 4FXQA 5CZMA 1L6JA 3ELMA 2Z2DA 1JIZA 4WK7A 5I3MA 4L7AA 1BKCA 1GO7P 1HY7A 2JT6A 2JT5A 1XFVA 3RTSA 4Q1LA 1H71P 1R1IA 3G42A 3ZXHA 4AXQA 3DPEA 1IAEA 2X3CA 2MLSA 1JIWP 3AIGA 2DW0A 4ZR5A 1R55A 1XUCA 3F1AA 2Y6CA 1RM8A 1CIZA 1JAQA 1ROSA 2OY4A 2X3BA 2V4BA 3LK8A 2MZHA 1EAKA 3EHYA 1IAAA 1J7NA 5D3CA 4PKSA 1BQQM 4IUWA 1I73A 830CA 2J0TA 4DV8A 1UTTA 3HYGA 3LIKA 3EWJA 2FV9A 1XURA 1Y93A 3HB2P 1BIWA 1Y0VA 1AF0A 1QIAA 1KUKA 4PKRA 4PKWA 1K7IA 2L0RA 5L79A 3AYUA 3USNA 4H84A 3LIRA 4WKIA 3OHOA 1XFZA 2DW2A 4JP4A 4XM7A 1GO8P 1KAPP 1CAQA 3DTIA 3RTTA 1SRPA 2YB9A 2W0DA 3N2VA 2DDYA 1CGLA 1UMTA 1KUHA 3B92A 2O36A 3K7NA 1AYKA 3AYKA 3LEAA 5I12A 3EDIA 2D1OA 1IACA 2E3XA 1K7GA 2USNA 5B5OA 1BSWA 2N8RA 3DTEA 4GQLA 2X7MA 1GKCA 2ERQA 2YUFA 3F15A 1JH1A 1YP1A 3DWBA 3LILA 1JAOA 1HTDA 2X3AA 3LUNA 2RJQA 4A3WA 3KRYA 1O0QA 2MZIA 3TSKA 1KUGA 1HOVA 3LQBA 2K9CA 1I1IP 1CGFA 2DDFA 4XCTA 1XFWA 2A8HA 3LQ0A 3F19A 5D1UA 2OXUA 3F16A 4H2EA 1XM5A 1CGEA 5D1SA 4GF1A 1BKCE 1OM7A 1A85A 2OZRA 2W15A 1D7XA 3TVCA 1QUAA 4JPAA 1UTZA 4FVLA 2MLRA 1XFUA 1G4KA 1XFXA 1Z3JA 1JJ9A 3HY7A 3NX7A 4H1QA 2W13A 3KEKA 1S4BP 4JA1A 5B5PA 3EHXA 1G49A 3LE9A 2EROA 5D2BA 2OVXA 966CA 2AIGP 1ASTA 5D1TA 1Q3AA 3TT4A 1C3IA 3LJGA 4ON1A 4GR0A 3CKIA 3WV3A 1TVIA 4GUYA 1YCMA 3DTKA 5BOYA 1BZSA 3E8RA 3SHIA 1D8MA 3B8ZA 1PWPA 2MZEA 3B2ZA 4L63A 3F18A 5I43A 3HY9A 1JKYA 1G9KA 1ZVXA 2OW9A 4XM6A 2I47A 2JSDA 2SRTA 1BKCI 3LUMA 4EFSA 1R1JA 1G05A 1BUVM 2OW1A 3DSLA 5H8XA 2PJTA 3VI1A 2RJPA 2CLTA 1BUDA 2W12A 3O2XA 3F17A 5CUHA 3LKAA 3I7GA 2WO9A 4DPEA 1UMSA 3V96B 3L0TA 3HDAP 1ZP5A 3KHIA 1SLMA 4IJOA 4GWNA 1IADA 4AUOA 4G9LA 2D1NA 1ATLA 1PWUA 3N2UA 1A86A 3DNGA 2XS4A 4JQGA 1QJIA 1ND1A 4WZVA 4GWMA 1OO9A 2OVZA 3EDHA 1B8YA 3P1VA 4H82A 1D5JA 1R1HA 1FBLA 1CXVA 2JIHA 1MMPA 4I03A 4PKUA 1ZXCA 3P24A 1GE7A 3ZUKA 5BOTA 456CA 2K2GA 4HMAA 1MMQA 3HBUP 1GXDA 4H30A 1I76A 5CXAA 3GBOA 4XBHA 4PKVA 1YOUA 1GE5A 1RMZA 3LGPA 3LMCA 1FLSA 2O3EA 1HV5A 3TS4A 3EDGA 1XUDA 1HFSA 4FXYP 1PWQA 1OM6A 1JAPA 3G5CA 3KMCA 3HDBA 1C7KA 1OZ9A 4FU4A 4H76A 1CK7A 1YQYA 2OXZA 5I2ZA 1UEAA 4H3XA 1KUIA 1FM1A 3VTGA 2JNPA 1ZS0A 2QPJA 4AYKA 4PKTA 2E2DA 4HX3A 4XM8A 4J4MA 1QICA 2AYKA 4JIJA 4L6TA 1ZTQA 2WOAA 2YIGA 1MMBA 2WO8A 3OHLA 5L7FA 1PWWA 2FV5A 4WF6A 3KWVC 4CTHA 5JMYA 3I7IA 4G0DA 3K7LA 3U1RA 3MA2A 1K7QA 3WV2A 1MMRA 5LABA 1PWVA 1OS2A 4A7BA 4QKZA 1G12A 2Y6DA 1JANA 3Q2HA 1ZXVA 1R54A 1XAXA 3EDZA 1IAGA 1QJJA 1IABA 3WV1A 3O64A 2OW0A 1WNIA 3DL1A 1XFYA 4GR3A 4DF9A
chains in the Genus database with same CATH topology
1OM8A 1USNA 1BM6A 3Q2GA 2OI0A 4H49A 4L19A 1SU3A 5BPAA 3KECA 1SLNA 2OY2A 2XS3A 3HBVP 1SATA 3KEJA 2OXWA 1O0TA 1OMJA 1HFCA 3LJTA 1B3DA 4I35A 2KRJA 4IN9A 1SMPA 1JK3A 3LJZA 1CQRA 2TCLA 2ERPA 2W14A 2HU6A 2CKIA 5D7WA 2J83A 3ZVSA 1EB6A 1DTHA 2OW2A 1KBCA 4GR8A 3BA0A 3KMEA 3UVCA 1D8FA 1MNCA 1OS9A 1GE6A 4DD8A 1KUFA 1GKDA 1QIBA 2POJA 3L0VA 2DW1A 4WKEA 4R3VA 5I0LA 1BQOA 1C8TA 1EUBA 1AKLA 1Y8JA 4PKQA 4ILWD 4AIGA 1DMTA 3DPFA 5I4OA 4FXQA 5CZMA 1L6JA 3ELMA 2Z2DA 1JIZA 4WK7A 5I3MA 4L7AA 1BKCA 1GO7P 1HY7A 2JT6A 2JT5A 1XFVA 3RTSA 4Q1LA 1H71P 1R1IA 3G42A 3ZXHA 4AXQA 3DPEA 1IAEA 2X3CA 2MLSA 1JIWP 3AIGA 2DW0A 4ZR5A 1R55A 1XUCA 3F1AA 2Y6CA 1RM8A 1CIZA 1JAQA 1ROSA 2OY4A 2X3BA 2V4BA 3LK8A 2MZHA 1EAKA 3EHYA 1IAAA 1J7NA 5D3CA 4PKSA 1BQQM 4IUWA 1I73A 830CA 2J0TA 4DV8A 1UTTA 3HYGA 3LIKA 3EWJA 2FV9A 1XURA 1Y93A 3HB2P 1BIWA 1Y0VA 1AF0A 1QIAA 1KUKA 4PKRA 4PKWA 1K7IA 2L0RA 5L79A 3AYUA 3USNA 4H84A 3LIRA 4WKIA 3OHOA 1XFZA 2DW2A 4JP4A 4XM7A 1GO8P 1KAPP 1CAQA 3DTIA 3RTTA 1SRPA 2YB9A 2W0DA 3N2VA 2DDYA 1CGLA 1UMTA 1KUHA 3B92A 2O36A 3K7NA 1AYKA 3AYKA 3LEAA 5I12A 3EDIA 2D1OA 1IACA 2E3XA 1K7GA 2USNA 5B5OA 1BSWA 2N8RA 3DTEA 4GQLA 2X7MA 1GKCA 2ERQA 2YUFA 3F15A 1JH1A 1YP1A 3DWBA 3LILA 1JAOA 1HTDA 2X3AA 3LUNA 2RJQA 4A3WA 3KRYA 1O0QA 2MZIA 3TSKA 1KUGA 1HOVA 3LQBA 2K9CA 1I1IP 1CGFA 2DDFA 4XCTA 1XFWA 2A8HA 3LQ0A 3F19A 5D1UA 2OXUA 3F16A 4H2EA 1CGEA 5D1SA 4GF1A 1BKCE 1OM7A 1A85A 2OZRA 2W15A 1D7XA 3TVCA 1QUAA 4JPAA 1UTZA 4FVLA 2MLRA 1XFUA 1G4KA 1XFXA 1Z3JA 1JJ9A 3HY7A 3NX7A 4H1QA 2W13A 3KEKA 1S4BP 4JA1A 5B5PA 3EHXA 1G49A 3LE9A 2EROA 5D2BA 2OVXA 966CA 2AIGP 1ASTA 5D1TA 1Q3AA 3TT4A 1C3IA 3LJGA 4ON1A 4GR0A 3CKIA 3WV3A 4GUYA 1YCMA 3DTKA 5BOYA 1BZSA 3E8RA 3SHIA 1D8MA 3B8ZA 1PWPA 2MZEA 3B2ZA 4L63A 3F18A 5I43A 3HY9A 1JKYA 1G9KA 1ZVXA 2OW9A 4XM6A 2I47A 2JSDA 2SRTA 1BKCI 3LUMA 4EFSA 1R1JA 1G05A 1BUVM 2OW1A 3DSLA 5H8XA 2PJTA 3VI1A 2RJPA 2CLTA 1BUDA 2W12A 3O2XA 3F17A 5CUHA 3LKAA 3I7GA 2WO9A 4DPEA 1UMSA 3V96B 3L0TA 3HDAP 1ZP5A 3KHIA 1SLMA 4IJOA 4GWNA 1IADA 4AUOA 4G9LA 2D1NA 1ATLA 1PWUA 3N2UA 1A86A 3DNGA 2XS4A 4JQGA 1QJIA 1ND1A 4WZVA 4GWMA 1OO9A 2OVZA 3EDHA 1B8YA 3P1VA 4H82A 1D5JA 1R1HA 1FBLA 1CXVA 2JIHA 1MMPA 4I03A 4PKUA 1ZXCA 3P24A 1GE7A 3ZUKA 5BOTA 456CA 2K2GA 4HMAA 1MMQA 3HBUP 1GXDA 4H30A 1I76A 5CXAA 3GBOA 4XBHA 4PKVA 1YOUA 1GE5A 1RMZA 3LGPA 3LMCA 1FLSA 2O3EA 1HV5A 3TS4A 3EDGA 1XUDA 1HFSA 4FXYP 1PWQA 1OM6A 1JAPA 3G5CA 3KMCA 3HDBA 1C7KA 4FU4A 4H76A 1CK7A 1YQYA 2OXZA 5I2ZA 1UEAA 4H3XA 1KUIA 1FM1A 3VTGA 2JNPA 1ZS0A 2QPJA 4AYKA 4PKTA 2E2DA 4HX3A 4XM8A 4J4MA 1QICA 2AYKA 4JIJA 4L6TA 1ZTQA 2WOAA 2YIGA 1MMBA 2WO8A 3OHLA 5L7FA 1PWWA 2FV5A 4WF6A 3KWVC 4CTHA 5JMYA 3I7IA 4G0DA 3K7LA 3U1RA 3MA2A 1K7QA 3WV2A 1MMRA 5LABA 1PWVA 1OS2A 4A7BA 4QKZA 1G12A 2Y6DA 1JANA 3Q2HA 1ZXVA 1R54A 3EDZA 1IAGA 1QJJA 1IABA 3WV1A 3O64A 2OW0A 1WNIA 3DL1A 1XFYA 4GR3A 4DF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM8 A;  1USN A;  1BM6 A;  3Q2G A;  2OI0 A;  4H49 A;  4L19 A;  1SU3 A;  5BPA A;  3KEC A;  1SLN A;  2OY2 A;  2XS3 A;  3HBV P;  1SAT A;  3KEJ A;  2OXW A;  1O0T A;  1OMJ A;  1HFC A;  3LJT A;  1B3D A;  4I35 A;  2KRJ A;  4IN9 A;  1SMP A;  1JK3 A;  3LJZ A;  1CQR A;  2TCL A;  2ERP A;  2W14 A;  2HU6 A;  2CKI A;  5D7W A;  2J83 A;  3ZVS A;  1EB6 A;  1DTH A;  2OW2 A;  1KBC A;  4GR8 A;  3BA0 A;  3KME A;  3UVC A;  1D8F A;  1MNC A;  1OS9 A;  1GE6 A;  4DD8 A;  1KUF A;  1GKD A;  1QIB A;  2POJ A;  3L0V A;  2DW1 A;  4WKE A;  4R3V A;  5I0L A;  1BQO A;  1C8T A;  1EUB A;  1AKL A;  1Y8J A;  4PKQ A;  4ILW D;  4AIG A;  1DMT A;  3DPF A;  5I4O A;  4FXQ A;  5CZM A;  1L6J A;  3ELM A;  2Z2D A;  1JIZ A;  4WK7 A;  5I3M A;  1BKC A;  1GO7 P;  1HY7 A;  2JT6 A;  2JT5 A;  1XFV A;  3RTS A;  4Q1L A;  1H71 P;  1R1I A;  3G42 A;  3ZXH A;  4AXQ A;  3DPE A;  1IAE A;  2X3C A;  2MLS A;  1JIW P;  3AIG A;  2DW0 A;  4ZR5 A;  1R55 A;  1XUC A;  3F1A A;  2Y6C A;  1RM8 A;  1CIZ A;  1JAQ A;  1ROS A;  2OY4 A;  2X3B A;  2V4B A;  3LK8 A;  2MZH A;  1EAK A;  3EHY A;  1IAA A;  1J7N A;  5D3C A;  4PKS A;  1BQQ M;  4IUW A;  1I73 A;  830C A;  2J0T A;  4DV8 A;  1UTT A;  3HYG A;  3LIK A;  3EWJ A;  2FV9 A;  1XUR A;  1Y93 A;  3HB2 P;  1BIW A;  1Y0V A;  1AF0 A;  1QIA A;  1KUK A;  4PKR A;  4PKW A;  1K7I A;  2L0R A;  5L79 A;  3AYU A;  3USN A;  4H84 A;  3LIR A;  4WKI A;  3OHO A;  1XFZ A;  2DW2 A;  4JP4 A;  4XM7 A;  1GO8 P;  1KAP P;  1CAQ A;  3RTT A;  1SRP A;  2YB9 A;  2W0D A;  3N2V A;  2DDY A;  1CGL A;  1UMT A;  1KUH A;  3B92 A;  2O36 A;  3K7N A;  1AYK A;  3AYK A;  3LEA A;  5I12 A;  3EDI A;  2D1O A;  1IAC A;  2E3X A;  1K7G A;  2USN A;  5B5O A;  1BSW A;  2N8R A;  4GQL A;  2X7M A;  1GKC A;  2ERQ A;  3F15 A;  1JH1 A;  1YP1 A;  3DWB A;  3LIL A;  1JAO A;  1HTD A;  2X3A A;  3LUN A;  2RJQ A;  4A3W A;  3KRY A;  1O0Q A;  2MZI A;  3TSK A;  1KUG A;  1HOV A;  3LQB A;  2K9C A;  1I1I P;  1CGF A;  2DDF A;  4XCT A;  1XFW A;  2A8H A;  3LQ0 A;  3F19 A;  5D1U A;  2OXU A;  3F16 A;  4H2E A;  1CGE A;  5D1S A;  4GF1 A;  1BKC E;  1OM7 A;  1A85 A;  2OZR A;  2W15 A;  1D7X A;  3TVC A;  1QUA A;  4JPA A;  1UTZ A;  4FVL A;  2MLR A;  1XFU A;  1G4K A;  1XFX A;  1Z3J A;  1JJ9 A;  3HY7 A;  3NX7 A;  4H1Q A;  2W13 A;  3KEK A;  1S4B P;  4JA1 A;  5B5P A;  3EHX A;  1G49 A;  3LE9 A;  2ERO A;  5D2B A;  2OVX A;  966C A;  2AIG P;  1AST A;  5D1T A;  1Q3A A;  3TT4 A;  1C3I A;  3LJG A;  4ON1 A;  4GR0 A;  3CKI A;  3WV3 A;  4GUY A;  1YCM A;  5BOY A;  1BZS A;  3E8R A;  3SHI A;  1D8M A;  3B8Z A;  1PWP A;  2MZE A;  3B2Z A;  4L63 A;  3F18 A;  5I43 A;  3HY9 A;  1JKY A;  1G9K A;  1ZVX A;  2OW9 A;  4XM6 A;  2I47 A;  2JSD A;  2SRT A;  1BKC I;  3LUM A;  4EFS A;  1R1J A;  1G05 A;  1BUV M;  2OW1 A;  3DSL A;  5H8X A;  2PJT A;  3VI1 A;  2RJP A;  2CLT A;  1BUD A;  2W12 A;  3O2X A;  3F17 A;  5CUH A;  3LKA A;  3I7G A;  2WO9 A;  4DPE A;  1UMS A;  3V96 B;  3L0T A;  3HDA P;  1ZP5 A;  3KHI A;  1SLM A;  4IJO A;  4GWN A;  1IAD A;  4AUO A;  4G9L A;  2D1N A;  1ATL A;  1PWU A;  3N2U A;  1A86 A;  3DNG A;  2XS4 A;  4JQG A;  1QJI A;  1ND1 A;  4WZV A;  4GWM A;  1OO9 A;  2OVZ A;  3EDH A;  1B8Y A;  3P1V A;  4H82 A;  1D5J A;  1R1H A;  1FBL A;  1CXV A;  2JIH A;  1MMP A;  4I03 A;  4PKU A;  1ZXC A;  3P24 A;  1GE7 A;  3ZUK A;  5BOT A;  456C A;  2K2G A;  4HMA A;  1MMQ A;  3HBU P;  1GXD A;  4H30 A;  1I76 A;  5CXA A;  3GBO A;  4XBH A;  4PKV A;  1YOU A;  1GE5 A;  1RMZ A;  3LGP A;  3LMC A;  1FLS A;  2O3E A;  1HV5 A;  3TS4 A;  3EDG A;  1XUD A;  1HFS A;  4FXY P;  1PWQ A;  1OM6 A;  1JAP A;  3G5C A;  3KMC A;  3HDB A;  1C7K A;  4FU4 A;  4H76 A;  1CK7 A;  1YQY A;  2OXZ A;  5I2Z A;  1UEA A;  4H3X A;  1KUI A;  1FM1 A;  3VTG A;  2JNP A;  1ZS0 A;  2QPJ A;  4AYK A;  4PKT A;  2E2D A;  4HX3 A;  4XM8 A;  4J4M A;  1QIC A;  2AYK A;  4JIJ A;  4L6T A;  1ZTQ A;  2WOA A;  2YIG A;  1MMB A;  2WO8 A;  3OHL A;  5L7F A;  1PWW A;  2FV5 A;  4WF6 A;  3KWV C;  4CTH A;  5JMY A;  3I7I A;  4G0D A;  3K7L A;  3U1R A;  3MA2 A;  1K7Q A;  3WV2 A;  1MMR A;  5LAB A;  1PWV A;  1OS2 A;  4A7B A;  4QKZ A;  1G12 A;  2Y6D A;  1JAN A;  3Q2H A;  1ZXV A;  1R54 A;  3EDZ A;  1IAG A;  1QJJ A;  1IAB A;  3WV1 A;  3O64 A;  2OW0 A;  1WNI A;  3DL1 A;  1XFY A;  4GR3 A;  4DF9 A; 
#chains in the Genus database with same CATH topology
 1OM8 A;  1USN A;  1BM6 A;  3Q2G A;  2OI0 A;  4H49 A;  4L19 A;  1SU3 A;  5BPA A;  3KEC A;  1SLN A;  2OY2 A;  2XS3 A;  3HBV P;  1SAT A;  3KEJ A;  2OXW A;  1O0T A;  1OMJ A;  1HFC A;  3LJT A;  1B3D A;  4I35 A;  2KRJ A;  4IN9 A;  1SMP A;  1JK3 A;  3LJZ A;  1CQR A;  2TCL A;  2ERP A;  2W14 A;  2HU6 A;  2CKI A;  5D7W A;  2J83 A;  3ZVS A;  1EB6 A;  1DTH A;  2OW2 A;  1KBC A;  4GR8 A;  3BA0 A;  3KME A;  3UVC A;  1D8F A;  1MNC A;  1OS9 A;  1GE6 A;  4DD8 A;  1KUF A;  1GKD A;  1QIB A;  2POJ A;  3L0V A;  2DW1 A;  4WKE A;  4R3V A;  5I0L A;  1BQO A;  1C8T A;  1EUB A;  1AKL A;  1Y8J A;  4PKQ A;  4ILW D;  4AIG A;  1DMT A;  3DPF A;  5I4O A;  4FXQ A;  5CZM A;  1L6J A;  3ELM A;  2Z2D A;  1JIZ A;  4WK7 A;  5I3M A;  4L7A A;  1BKC A;  1GO7 P;  1HY7 A;  2JT6 A;  2JT5 A;  1XFV A;  3RTS A;  4Q1L A;  1H71 P;  1R1I A;  3G42 A;  3ZXH A;  4AXQ A;  3DPE A;  1IAE A;  2X3C A;  2MLS A;  1JIW P;  3AIG A;  2DW0 A;  4ZR5 A;  1R55 A;  1XUC A;  3F1A A;  2Y6C A;  1RM8 A;  1CIZ A;  1JAQ A;  1ROS A;  2OY4 A;  2X3B A;  2V4B A;  3LK8 A;  2MZH A;  1EAK A;  3EHY A;  1IAA A;  1J7N A;  5D3C A;  4PKS A;  1BQQ M;  4IUW A;  1I73 A;  830C A;  2J0T A;  4DV8 A;  1UTT A;  3HYG A;  3LIK A;  3EWJ A;  2FV9 A;  1XUR A;  1Y93 A;  3HB2 P;  1BIW A;  1Y0V A;  1AF0 A;  1QIA A;  1KUK A;  4PKR A;  4PKW A;  1K7I A;  2L0R A;  5L79 A;  3AYU A;  3USN A;  4H84 A;  3LIR A;  4WKI A;  3OHO A;  1XFZ A;  2DW2 A;  4JP4 A;  4XM7 A;  1GO8 P;  1KAP P;  1CAQ A;  3DTI A;  3RTT A;  1SRP A;  2YB9 A;  2W0D A;  3N2V A;  2DDY A;  1CGL A;  1UMT A;  1KUH A;  3B92 A;  2O36 A;  3K7N A;  1AYK A;  3AYK A;  3LEA A;  5I12 A;  3EDI A;  2D1O A;  1IAC A;  2E3X A;  1K7G A;  2USN A;  5B5O A;  1BSW A;  2N8R A;  3DTE A;  4GQL A;  2X7M A;  1GKC A;  2ERQ A;  2YUF A;  3F15 A;  1JH1 A;  1YP1 A;  3DWB A;  3LIL A;  1JAO A;  1HTD A;  2X3A A;  3LUN A;  2RJQ A;  4A3W A;  3KRY A;  1O0Q A;  2MZI A;  3TSK A;  1KUG A;  1HOV A;  3LQB A;  2K9C A;  1I1I P;  1CGF A;  2DDF A;  4XCT A;  1XFW A;  2A8H A;  3LQ0 A;  3F19 A;  5D1U A;  2OXU A;  3F16 A;  4H2E A;  1XM5 A;  1CGE A;  5D1S A;  4GF1 A;  1BKC E;  1OM7 A;  1A85 A;  2OZR A;  2W15 A;  1D7X A;  3TVC A;  1QUA A;  4JPA A;  1UTZ A;  4FVL A;  2MLR A;  1XFU A;  1G4K A;  1XFX A;  1Z3J A;  1JJ9 A;  3HY7 A;  3NX7 A;  4H1Q A;  2W13 A;  3KEK A;  1S4B P;  4JA1 A;  5B5P A;  3EHX A;  1G49 A;  3LE9 A;  2ERO A;  5D2B A;  2OVX A;  966C A;  2AIG P;  1AST A;  5D1T A;  1Q3A A;  3TT4 A;  1C3I A;  3LJG A;  4ON1 A;  4GR0 A;  3CKI A;  3WV3 A;  1TVI A;  4GUY A;  1YCM A;  3DTK A;  5BOY A;  1BZS A;  3E8R A;  3SHI A;  1D8M A;  3B8Z A;  1PWP A;  2MZE A;  3B2Z A;  4L63 A;  3F18 A;  5I43 A;  3HY9 A;  1JKY A;  1G9K A;  1ZVX A;  2OW9 A;  4XM6 A;  2I47 A;  2JSD A;  2SRT A;  1BKC I;  3LUM A;  4EFS A;  1R1J A;  1G05 A;  1BUV M;  2OW1 A;  3DSL A;  5H8X A;  2PJT A;  3VI1 A;  2RJP A;  2CLT A;  1BUD A;  2W12 A;  3O2X A;  3F17 A;  5CUH A;  3LKA A;  3I7G A;  2WO9 A;  4DPE A;  1UMS A;  3V96 B;  3L0T A;  3HDA P;  1ZP5 A;  3KHI A;  1SLM A;  4IJO A;  4GWN A;  1IAD A;  4AUO A;  4G9L A;  2D1N A;  1ATL A;  1PWU A;  3N2U A;  1A86 A;  3DNG A;  2XS4 A;  4JQG A;  1QJI A;  1ND1 A;  4WZV A;  4GWM A;  1OO9 A;  2OVZ A;  3EDH A;  1B8Y A;  3P1V A;  4H82 A;  1D5J A;  1R1H A;  1FBL A;  1CXV A;  2JIH A;  1MMP A;  4I03 A;  4PKU A;  1ZXC A;  3P24 A;  1GE7 A;  3ZUK A;  5BOT A;  456C A;  2K2G A;  4HMA A;  1MMQ A;  3HBU P;  1GXD A;  4H30 A;  1I76 A;  5CXA A;  3GBO A;  4XBH A;  4PKV A;  1YOU A;  1GE5 A;  1RMZ A;  3LGP A;  3LMC A;  1FLS A;  2O3E A;  1HV5 A;  3TS4 A;  3EDG A;  1XUD A;  1HFS A;  4FXY P;  1PWQ A;  1OM6 A;  1JAP A;  3G5C A;  3KMC A;  3HDB A;  1C7K A;  1OZ9 A;  4FU4 A;  4H76 A;  1CK7 A;  1YQY A;  2OXZ A;  5I2Z A;  1UEA A;  4H3X A;  1KUI A;  1FM1 A;  3VTG A;  2JNP A;  1ZS0 A;  2QPJ A;  4AYK A;  4PKT A;  2E2D A;  4HX3 A;  4XM8 A;  4J4M A;  1QIC A;  2AYK A;  4JIJ A;  4L6T A;  1ZTQ A;  2WOA A;  2YIG A;  1MMB A;  2WO8 A;  3OHL A;  5L7F A;  1PWW A;  2FV5 A;  4WF6 A;  3KWV C;  4CTH A;  5JMY A;  3I7I A;  4G0D A;  3K7L A;  3U1R A;  3MA2 A;  1K7Q A;  3WV2 A;  1MMR A;  5LAB A;  1PWV A;  1OS2 A;  4A7B A;  4QKZ A;  1G12 A;  2Y6D A;  1JAN A;  3Q2H A;  1ZXV A;  1R54 A;  1XAX A;  3EDZ A;  1IAG A;  1QJJ A;  1IAB A;  3WV1 A;  3O64 A;  2OW0 A;  1WNI A;  3DL1 A;  1XFY A;  4GR3 A;  4DF9 A; 
#chains in the Genus database with same CATH homology
 1OM8 A;  1USN A;  1BM6 A;  3Q2G A;  2OI0 A;  4H49 A;  4L19 A;  1SU3 A;  5BPA A;  3KEC A;  1SLN A;  2OY2 A;  2XS3 A;  3HBV P;  1SAT A;  3KEJ A;  2OXW A;  1O0T A;  1OMJ A;  1HFC A;  3LJT A;  1B3D A;  4I35 A;  2KRJ A;  4IN9 A;  1SMP A;  1JK3 A;  3LJZ A;  1CQR A;  2TCL A;  2ERP A;  2W14 A;  2HU6 A;  2CKI A;  5D7W A;  2J83 A;  3ZVS A;  1EB6 A;  1DTH A;  2OW2 A;  1KBC A;  4GR8 A;  3BA0 A;  3KME A;  3UVC A;  1D8F A;  1MNC A;  1OS9 A;  1GE6 A;  4DD8 A;  1KUF A;  1GKD A;  1QIB A;  2POJ A;  3L0V A;  2DW1 A;  4WKE A;  4R3V A;  5I0L A;  1BQO A;  1C8T A;  1EUB A;  1AKL A;  1Y8J A;  4PKQ A;  4ILW D;  4AIG A;  1DMT A;  3DPF A;  5I4O A;  4FXQ A;  5CZM A;  1L6J A;  3ELM A;  2Z2D A;  1JIZ A;  4WK7 A;  5I3M A;  4L7A A;  1BKC A;  1GO7 P;  1HY7 A;  2JT6 A;  2JT5 A;  1XFV A;  3RTS A;  4Q1L A;  1H71 P;  1R1I A;  3G42 A;  3ZXH A;  4AXQ A;  3DPE A;  1IAE A;  2X3C A;  2MLS A;  1JIW P;  3AIG A;  2DW0 A;  4ZR5 A;  1R55 A;  1XUC A;  3F1A A;  2Y6C A;  1RM8 A;  1CIZ A;  1JAQ A;  1ROS A;  2OY4 A;  2X3B A;  2V4B A;  3LK8 A;  2MZH A;  1EAK A;  3EHY A;  1IAA A;  1J7N A;  5D3C A;  4PKS A;  1BQQ M;  4IUW A;  1I73 A;  830C A;  2J0T A;  4DV8 A;  1UTT A;  3HYG A;  3LIK A;  3EWJ A;  2FV9 A;  1XUR A;  1Y93 A;  3HB2 P;  1BIW A;  1Y0V A;  1AF0 A;  1QIA A;  1KUK A;  4PKR A;  4PKW A;  1K7I A;  2L0R A;  5L79 A;  3AYU A;  3USN A;  4H84 A;  3LIR A;  4WKI A;  3OHO A;  1XFZ A;  2DW2 A;  4JP4 A;  4XM7 A;  1GO8 P;  1KAP P;  1CAQ A;  3DTI A;  3RTT A;  1SRP A;  2YB9 A;  2W0D A;  3N2V A;  2DDY A;  1CGL A;  1UMT A;  1KUH A;  3B92 A;  2O36 A;  3K7N A;  1AYK A;  3AYK A;  3LEA A;  5I12 A;  3EDI A;  2D1O A;  1IAC A;  2E3X A;  1K7G A;  2USN A;  5B5O A;  1BSW A;  2N8R A;  3DTE A;  4GQL A;  2X7M A;  1GKC A;  2ERQ A;  2YUF A;  3F15 A;  1JH1 A;  1YP1 A;  3DWB A;  3LIL A;  1JAO A;  1HTD A;  2X3A A;  3LUN A;  2RJQ A;  4A3W A;  3KRY A;  1O0Q A;  2MZI A;  3TSK A;  1KUG A;  1HOV A;  3LQB A;  2K9C A;  1I1I P;  1CGF A;  2DDF A;  4XCT A;  1XFW A;  2A8H A;  3LQ0 A;  3F19 A;  5D1U A;  2OXU A;  3F16 A;  4H2E A;  1CGE A;  5D1S A;  4GF1 A;  1BKC E;  1OM7 A;  1A85 A;  2OZR A;  2W15 A;  1D7X A;  3TVC A;  1QUA A;  4JPA A;  1UTZ A;  4FVL A;  2MLR A;  1XFU A;  1G4K A;  1XFX A;  1Z3J A;  1JJ9 A;  3HY7 A;  3NX7 A;  4H1Q A;  2W13 A;  3KEK A;  1S4B P;  4JA1 A;  5B5P A;  3EHX A;  1G49 A;  3LE9 A;  2ERO A;  5D2B A;  2OVX A;  966C A;  2AIG P;  1AST A;  5D1T A;  1Q3A A;  3TT4 A;  1C3I A;  3LJG A;  4ON1 A;  4GR0 A;  3CKI A;  3WV3 A;  4GUY A;  1YCM A;  3DTK A;  5BOY A;  1BZS A;  3E8R A;  3SHI A;  1D8M A;  3B8Z A;  1PWP A;  2MZE A;  3B2Z A;  4L63 A;  3F18 A;  5I43 A;  3HY9 A;  1JKY A;  1G9K A;  1ZVX A;  2OW9 A;  4XM6 A;  2I47 A;  2JSD A;  2SRT A;  1BKC I;  3LUM A;  4EFS A;  1R1J A;  1G05 A;  1BUV M;  2OW1 A;  3DSL A;  5H8X A;  2PJT A;  3VI1 A;  2RJP A;  2CLT A;  1BUD A;  2W12 A;  3O2X A;  3F17 A;  5CUH A;  3LKA A;  3I7G A;  2WO9 A;  4DPE A;  1UMS A;  3V96 B;  3L0T A;  3HDA P;  1ZP5 A;  3KHI A;  1SLM A;  4IJO A;  4GWN A;  1IAD A;  4AUO A;  4G9L A;  2D1N A;  1ATL A;  1PWU A;  3N2U A;  1A86 A;  3DNG A;  2XS4 A;  4JQG A;  1QJI A;  1ND1 A;  4WZV A;  4GWM A;  1OO9 A;  2OVZ A;  3EDH A;  1B8Y A;  3P1V A;  4H82 A;  1D5J A;  1R1H A;  1FBL A;  1CXV A;  2JIH A;  1MMP A;  4I03 A;  4PKU A;  1ZXC A;  3P24 A;  1GE7 A;  3ZUK A;  5BOT A;  456C A;  2K2G A;  4HMA A;  1MMQ A;  3HBU P;  1GXD A;  4H30 A;  1I76 A;  5CXA A;  3GBO A;  4XBH A;  4PKV A;  1YOU A;  1GE5 A;  1RMZ A;  3LGP A;  3LMC A;  1FLS A;  2O3E A;  1HV5 A;  3TS4 A;  3EDG A;  1XUD A;  1HFS A;  4FXY P;  1PWQ A;  1OM6 A;  1JAP A;  3G5C A;  3KMC A;  3HDB A;  1C7K A;  4FU4 A;  4H76 A;  1CK7 A;  1YQY A;  2OXZ A;  5I2Z A;  1UEA A;  4H3X A;  1KUI A;  1FM1 A;  3VTG A;  2JNP A;  1ZS0 A;  2QPJ A;  4AYK A;  4PKT A;  2E2D A;  4HX3 A;  4XM8 A;  4J4M A;  1QIC A;  2AYK A;  4JIJ A;  4L6T A;  1ZTQ A;  2WOA A;  2YIG A;  1MMB A;  2WO8 A;  3OHL A;  5L7F A;  1PWW A;  2FV5 A;  4WF6 A;  3KWV C;  4CTH A;  5JMY A;  3I7I A;  4G0D A;  3K7L A;  3U1R A;  3MA2 A;  1K7Q A;  3WV2 A;  1MMR A;  5LAB A;  1PWV A;  1OS2 A;  4A7B A;  4QKZ A;  1G12 A;  2Y6D A;  1JAN A;  3Q2H A;  1ZXV A;  1R54 A;  3EDZ A;  1IAG A;  1QJJ A;  1IAB A;  3WV1 A;  3O64 A;  2OW0 A;  1WNI A;  3DL1 A;  1XFY A;  4GR3 A;  4DF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...