1GKDA

Mmp9 active site mutant-inhibitor complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
159
structure length
159
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 92 KDA TYPE IV COLLAGENASE
publication title Crystal Structure of Mmp9 in Complex with a Reverse Hydroxamate Inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gkdA00
4WKIA 1R1HA 1A85A 1YQYA 1G9KA 1SU3A 4WF6A 4GR3A 4IJOA 2MZIA 1BKCE 3TSKA 1JK3A 4CTHA 3EDHA 1PWWA 3U1RA 1UMSA 5BOYA 2W15A 4IUWA 1ZXVA 1O0TA 2Z2DA 1QJIA 3KWVC 3K7NA 1Y93A 3KRYA 3LIKA 3ZVSA 1C7KA 1CQRA 1BM6A 2WO9A 4GR8A 1D8FA 3DPFA 3WV3A 1JIWP 1QICA 4FU4A 5B5OA 2RJQA 4H82A 4H49A 1MMBA 2Y6CA 3E8RA 1QUAA 2E3XA 3LEAA 1GKCA 456CA 3SHIA 1XFYA 1G49A 2E2DA 4IN9A 1MMQA 4J4MA 3TS4A 1MMPA 4JQGA 3F19A 1FBLA 2MLRA 1DTHA 1R1IA 1OM8A 1OM6A 1QIAA 1XFWA 5I0LA 1ND1A 4XM7A 3RTTA 3AIGA 4ON1A 2KRJA 1UTZA 2JT6A 1XFVA 5L7FA 1MMRA 4I35A 4QKZA 3LQBA 3DNGA 4G0DA 2EROA 1OS2A 1PWVA 4WZVA 4XBHA 2ERPA 3DSLA 3K7LA 1OM7A 3MA2A 4GR0A 1D5JA 1BKCA 1ASTA 3KECA 5I2ZA 3CKIA 3AYUA 2JIHA 2K2GA 1Y0VA 3ZXHA 3LE9A 3N2VA 1PWPA 1IAAA 3RTSA 3KEKA 1KUKA 1D8MA 2W13A 2XS3A 4JA1A 4GWNA 1S4BP 3WV2A 2PJTA 1Q3AA 1FM1A 2MZHA 1B8YA 2D1NA 4H3XA 1BKCI 3KMCA 1SMPA 1PWQA 1HV5A 3VI1A 3HY9A 1IAGA 4HX3A 1GE7A 2WOAA 4GF1A 2ERQA 3G5CA 3OHOA 4A3WA 2DW2A 2OY2A 1RMZA 1JAPA 1JAQA 2AYKA 1I73A 1GO8P 3LQ0A 4PKVA 5I4OA 3LJTA 2FV5A 3P1VA 1CK7A 1GE5A 4DPEA 4JIJA 2DW1A 3DWBA 2OI0A 1JAOA 1XFUA 2X3CA 3LIRA 5BOTA 4ZR5A 1J7NA 1AF0A 1KBCA 1HY7A 2A8HA 3EHXA 4G9LA 1MNCA 3L0TA 1RM8A 1ZXCA 3N2UA 4AUOA 4R3VA 4PKTA 1UTTA 1JJ9A 5I3MA 2N8RA 2JSDA 1C8TA 5CUHA 1BSWA 3I7IA 5D7WA 3F15A 3EHYA 2AIGP 1Z3JA 1A86A 3G42A 3LK8A 1R54A 2OVZA 1CXVA 3LJGA 4ILWD 3USNA 3L0VA 4GWMA 3HDBA 5L79A 1WNIA 2DW0A 2X3AA 1IACA 2USNA 5CZMA 5D1SA 966CA 1G12A 2OXZA 2X7MA 1IABA 1ZVXA 2HU6A 2OXUA 1YOUA 1IADA 3LUMA 5JMYA 1UMTA 3HYGA 3O2XA 1B3DA 1HTDA 1KUHA 1EAKA 1C3IA 4JPAA 3NX7A 2XS4A 4DF9A 1SATA 1ZP5A 3BA0A 1CAQA 1ATLA 5D3CA 3DPEA 4L63A 1AKLA 2POJA 2OW2A 1XFXA 4EFSA 3HY7A 1EUBA 4PKRA 4FXYP 1CGFA 3WV1A 3KMEA 4L19A 1JIZA 5D1UA 1ZTQA 1KUIA 3LGPA 4AXQA 1XFZA 830CA 1HFSA 1DMTA 1K7IA 1GE6A 2DDFA 2X3BA 1OS9A 1L6JA 5D1TA 5B5PA 2YIGA 1SRPA 1QJJA 2FV9A 5H8XA 1GO7P 4DV8A 3EDZA 2OW9A 4AIGA 3DL1A 3HB2P 1EB6A 4XM6A 2YB9A 1GKDA 4H76A 3UVCA 2K9CA 4XCTA 1UEAA 3B2ZA 3HDAP 5I43A 1JANA 1KAPP 1ROSA 2TCLA 4H2EA 3TT4A 3F17A 1KUGA 4Q1LA 4H30A 4L6TA 2Y6DA 5BPAA 1OO9A 1R1JA 4DD8A 4WK7A 1USNA 4FVLA 3EWJA 2O3EA 4FXQA 3LILA 1SLMA 1I1IP 1KUFA 3LUNA 1YP1A 4PKSA 4PKUA 3B8ZA 2JNPA 1XURA 3P24A 3EDGA 1G05A 3O64A 4XM8A 2QPJA 2WO8A 2CKIA 1G4KA 5LABA 2CLTA 4AYKA 3ELMA 2OXWA 1FLSA 2RJPA 3V96B 4WKEA 1BQQM 5CXAA 1PWUA 4GQLA 3HBVP 2OZRA 5I12A 1XUDA 4I03A 3LKAA 2J0TA 2MLSA 1SLNA 1BUDA 2W14A 4JP4A 2JT5A 3EDIA 1BZSA 1OMJA 1YCMA 4HMAA 3OHLA 1I76A 1K7GA 4H84A 4GUYA 3TVCA 1D7XA 4PKWA 2V4BA 1R55A 2MZEA 2OVXA 4H1QA 1JKYA 3AYKA 1BQOA 1Y8JA 2OW0A 2I47A 3HBUP 1JH1A 1CGEA 3GBOA 1HFCA 1BUVM 2J83A 3KHIA 4PKQA 1ZS0A 2DDYA 3I7GA 3B92A 1CGLA 2O36A 4A7BA 1CIZA 1HOVA 2D1OA 3F1AA 2W0DA 3F18A 2W12A 3F16A 1BIWA 3KEJA 2OW1A 1XUCA 5D2BA 1GXDA 3LMCA 1QIBA 2SRTA 2OY4A 1H71P 1O0QA 3LJZA 3VTGA 1AYKA 1IAEA 1K7QA 3Q2HA 2L0RA 3Q2GA 3ZUKA
chains in the Genus database with same CATH superfamily
4WKIA 1R1HA 1A85A 1YQYA 1G9KA 1SU3A 4WF6A 4GR3A 4IJOA 3DTEA 2MZIA 1BKCE 3TSKA 1JK3A 4CTHA 3EDHA 1PWWA 3U1RA 1UMSA 5BOYA 2W15A 4IUWA 1ZXVA 1O0TA 2Z2DA 1QJIA 3KWVC 3K7NA 1Y93A 3KRYA 3LIKA 3ZVSA 1C7KA 1CQRA 1BM6A 2WO9A 4GR8A 1D8FA 3DPFA 3WV3A 1JIWP 1QICA 4FU4A 5B5OA 2RJQA 4H82A 4H49A 1MMBA 2Y6CA 3E8RA 1QUAA 2E3XA 3LEAA 1GKCA 456CA 3SHIA 1XFYA 1G49A 2E2DA 4IN9A 1MMQA 4J4MA 3TS4A 1MMPA 4JQGA 3F19A 1FBLA 2MLRA 1DTHA 1R1IA 1OM8A 1OM6A 1QIAA 1XFWA 5I0LA 1ND1A 4XM7A 3RTTA 3AIGA 4ON1A 2KRJA 1UTZA 2JT6A 1XFVA 5L7FA 1MMRA 4I35A 4QKZA 3LQBA 3DNGA 4G0DA 2EROA 1OS2A 1PWVA 4WZVA 4XBHA 2ERPA 3DSLA 3K7LA 1OM7A 3MA2A 4GR0A 1D5JA 1BKCA 1ASTA 3KECA 5I2ZA 3CKIA 3AYUA 2JIHA 2K2GA 1Y0VA 3ZXHA 3LE9A 3N2VA 1PWPA 1IAAA 3RTSA 3KEKA 1KUKA 1D8MA 1OZ9A 2W13A 2XS3A 4JA1A 4GWNA 1S4BP 3WV2A 2PJTA 1Q3AA 1FM1A 2MZHA 1B8YA 2D1NA 4H3XA 1BKCI 3KMCA 1SMPA 1PWQA 1HV5A 3VI1A 3HY9A 1IAGA 4HX3A 1GE7A 2WOAA 4GF1A 2ERQA 3G5CA 3OHOA 4A3WA 2DW2A 2OY2A 1RMZA 1JAPA 1JAQA 2AYKA 1I73A 1GO8P 3LQ0A 4PKVA 5I4OA 3LJTA 2FV5A 3P1VA 1CK7A 1GE5A 4DPEA 4JIJA 2DW1A 3DWBA 2OI0A 1JAOA 1XFUA 2X3CA 3LIRA 5BOTA 4ZR5A 1J7NA 1AF0A 1KBCA 1HY7A 2A8HA 3EHXA 4G9LA 1MNCA 3L0TA 1RM8A 1ZXCA 3N2UA 4AUOA 4R3VA 4PKTA 1UTTA 1JJ9A 5I3MA 2N8RA 2JSDA 1C8TA 5CUHA 1BSWA 3I7IA 5D7WA 3F15A 3EHYA 2AIGP 1Z3JA 1A86A 3G42A 3LK8A 1R54A 2OVZA 1CXVA 3LJGA 4ILWD 3USNA 3L0VA 4GWMA 3HDBA 5L79A 1WNIA 2DW0A 2X3AA 1IACA 2USNA 5CZMA 5D1SA 966CA 1G12A 2OXZA 2X7MA 1IABA 1ZVXA 2HU6A 2OXUA 1YOUA 1IADA 3LUMA 5JMYA 1UMTA 3HYGA 3O2XA 1B3DA 1HTDA 1KUHA 1EAKA 1C3IA 4JPAA 3NX7A 2XS4A 4DF9A 1XAXA 1SATA 1ZP5A 3BA0A 1CAQA 3DTIA 1ATLA 5D3CA 3DPEA 4L63A 1AKLA 3DTKA 2POJA 2OW2A 1XFXA 4EFSA 3HY7A 1EUBA 4PKRA 4FXYP 1CGFA 3WV1A 3KMEA 2YUFA 4L19A 1JIZA 5D1UA 1ZTQA 1KUIA 3LGPA 4AXQA 1XFZA 830CA 1HFSA 1DMTA 1K7IA 1GE6A 1XM5A 2DDFA 2X3BA 1OS9A 1L6JA 5D1TA 5B5PA 2YIGA 1SRPA 1QJJA 2FV9A 5H8XA 1GO7P 4DV8A 3EDZA 2OW9A 4AIGA 3DL1A 3HB2P 1EB6A 4XM6A 2YB9A 1GKDA 4H76A 3UVCA 2K9CA 4XCTA 1UEAA 3B2ZA 3HDAP 5I43A 1JANA 1KAPP 1ROSA 2TCLA 4H2EA 3TT4A 3F17A 1KUGA 4Q1LA 4H30A 4L6TA 2Y6DA 5BPAA 1OO9A 1R1JA 4DD8A 4WK7A 1USNA 4FVLA 3EWJA 2O3EA 4FXQA 3LILA 1SLMA 1I1IP 1KUFA 3LUNA 1YP1A 4PKSA 4PKUA 3B8ZA 2JNPA 1XURA 3P24A 3EDGA 1G05A 3O64A 4XM8A 2QPJA 2WO8A 2CKIA 1G4KA 5LABA 2CLTA 4AYKA 3ELMA 2OXWA 1FLSA 2RJPA 3V96B 4WKEA 1TVIA 1BQQM 5CXAA 1PWUA 4GQLA 3HBVP 2OZRA 5I12A 1XUDA 4I03A 3LKAA 2J0TA 2MLSA 1SLNA 1BUDA 2W14A 4JP4A 2JT5A 3EDIA 1BZSA 1OMJA 1YCMA 4HMAA 3OHLA 1I76A 1K7GA 4H84A 4GUYA 3TVCA 1D7XA 4PKWA 2V4BA 1R55A 2MZEA 2OVXA 4H1QA 1JKYA 3AYKA 1BQOA 1Y8JA 2OW0A 2I47A 3HBUP 1JH1A 1CGEA 3GBOA 1HFCA 1BUVM 2J83A 3KHIA 4PKQA 1ZS0A 2DDYA 3I7GA 3B92A 1CGLA 2O36A 4A7BA 4L7AA 1CIZA 1HOVA 2D1OA 3F1AA 2W0DA 3F18A 2W12A 3F16A 1BIWA 3KEJA 2OW1A 1XUCA 5D2BA 1GXDA 3LMCA 1QIBA 2SRTA 2OY4A 1H71P 1O0QA 3LJZA 3VTGA 1AYKA 1IAEA 1K7QA 3Q2HA 2L0RA 3Q2GA 3ZUKA
chains in the Genus database with same CATH topology
4WKIA 1R1HA 1A85A 1YQYA 1G9KA 1SU3A 4WF6A 4GR3A 4IJOA 3DTEA 2MZIA 1BKCE 3TSKA 1JK3A 4CTHA 3EDHA 1PWWA 3U1RA 1UMSA 5BOYA 2W15A 4IUWA 1ZXVA 1O0TA 2Z2DA 1QJIA 3KWVC 3K7NA 1Y93A 3KRYA 3LIKA 3ZVSA 1C7KA 1CQRA 1BM6A 2WO9A 4GR8A 1D8FA 3DPFA 3WV3A 1JIWP 1QICA 4FU4A 5B5OA 2RJQA 4H82A 4H49A 1MMBA 2Y6CA 3E8RA 1QUAA 2E3XA 3LEAA 1GKCA 456CA 3SHIA 1XFYA 1G49A 2E2DA 4IN9A 1MMQA 4J4MA 3TS4A 1MMPA 4JQGA 3F19A 1FBLA 2MLRA 1DTHA 1R1IA 1OM8A 1OM6A 1QIAA 1XFWA 5I0LA 1ND1A 4XM7A 3RTTA 3AIGA 4ON1A 2KRJA 1UTZA 2JT6A 1XFVA 5L7FA 1MMRA 4I35A 4QKZA 3LQBA 3DNGA 4G0DA 2EROA 1OS2A 1PWVA 4WZVA 4XBHA 2ERPA 3DSLA 3K7LA 1OM7A 3MA2A 4GR0A 1D5JA 1BKCA 1ASTA 3KECA 5I2ZA 3CKIA 3AYUA 2JIHA 2K2GA 1Y0VA 3ZXHA 3LE9A 3N2VA 1PWPA 1IAAA 3RTSA 3KEKA 1KUKA 1D8MA 2W13A 2XS3A 4JA1A 4GWNA 1S4BP 3WV2A 2PJTA 1Q3AA 1FM1A 2MZHA 1B8YA 2D1NA 4H3XA 1BKCI 3KMCA 1SMPA 1PWQA 1HV5A 3VI1A 3HY9A 1IAGA 4HX3A 1GE7A 2WOAA 4GF1A 2ERQA 3G5CA 3OHOA 4A3WA 2DW2A 2OY2A 1RMZA 1JAPA 1JAQA 2AYKA 1I73A 1GO8P 3LQ0A 4PKVA 5I4OA 3LJTA 2FV5A 3P1VA 1CK7A 1GE5A 4DPEA 4JIJA 2DW1A 3DWBA 2OI0A 1JAOA 1XFUA 2X3CA 3LIRA 5BOTA 4ZR5A 1J7NA 1AF0A 1KBCA 1HY7A 2A8HA 3EHXA 4G9LA 1MNCA 3L0TA 1RM8A 1ZXCA 3N2UA 4AUOA 4R3VA 4PKTA 1UTTA 1JJ9A 5I3MA 2N8RA 2JSDA 1C8TA 5CUHA 1BSWA 3I7IA 5D7WA 3F15A 3EHYA 2AIGP 1Z3JA 1A86A 3G42A 3LK8A 1R54A 2OVZA 1CXVA 3LJGA 4ILWD 3USNA 3L0VA 4GWMA 3HDBA 5L79A 1WNIA 2DW0A 2X3AA 1IACA 2USNA 5CZMA 5D1SA 966CA 1G12A 2OXZA 2X7MA 1IABA 1ZVXA 2HU6A 2OXUA 1YOUA 1IADA 3LUMA 5JMYA 1UMTA 3HYGA 3O2XA 1B3DA 1HTDA 1KUHA 1EAKA 1C3IA 4JPAA 3NX7A 2XS4A 4DF9A 1SATA 1ZP5A 3BA0A 1CAQA 3DTIA 1ATLA 5D3CA 3DPEA 4L63A 1AKLA 3DTKA 2POJA 2OW2A 1XFXA 4EFSA 3HY7A 1EUBA 4PKRA 4FXYP 1CGFA 3WV1A 3KMEA 2YUFA 4L19A 1JIZA 5D1UA 1ZTQA 1KUIA 3LGPA 4AXQA 1XFZA 830CA 1HFSA 1DMTA 1K7IA 1GE6A 2DDFA 2X3BA 1OS9A 1L6JA 5D1TA 5B5PA 2YIGA 1SRPA 1QJJA 2FV9A 5H8XA 1GO7P 4DV8A 3EDZA 2OW9A 4AIGA 3DL1A 3HB2P 1EB6A 4XM6A 2YB9A 1GKDA 4H76A 3UVCA 2K9CA 4XCTA 1UEAA 3B2ZA 3HDAP 5I43A 1JANA 1KAPP 1ROSA 2TCLA 4H2EA 3TT4A 3F17A 1KUGA 4Q1LA 4H30A 4L6TA 2Y6DA 5BPAA 1OO9A 1R1JA 4DD8A 4WK7A 1USNA 4FVLA 3EWJA 2O3EA 4FXQA 3LILA 1SLMA 1I1IP 1KUFA 3LUNA 1YP1A 4PKSA 4PKUA 3B8ZA 2JNPA 1XURA 3P24A 3EDGA 1G05A 3O64A 4XM8A 2QPJA 2WO8A 2CKIA 1G4KA 5LABA 2CLTA 4AYKA 3ELMA 2OXWA 1FLSA 2RJPA 3V96B 4WKEA 1BQQM 5CXAA 1PWUA 4GQLA 3HBVP 2OZRA 5I12A 1XUDA 4I03A 3LKAA 2J0TA 2MLSA 1SLNA 1BUDA 2W14A 4JP4A 2JT5A 3EDIA 1BZSA 1OMJA 1YCMA 4HMAA 3OHLA 1I76A 1K7GA 4H84A 4GUYA 3TVCA 1D7XA 4PKWA 2V4BA 1R55A 2MZEA 2OVXA 4H1QA 1JKYA 3AYKA 1BQOA 1Y8JA 2OW0A 2I47A 3HBUP 1JH1A 1CGEA 3GBOA 1HFCA 1BUVM 2J83A 3KHIA 4PKQA 1ZS0A 2DDYA 3I7GA 3B92A 1CGLA 2O36A 4A7BA 4L7AA 1CIZA 1HOVA 2D1OA 3F1AA 2W0DA 3F18A 2W12A 3F16A 1BIWA 3KEJA 2OW1A 1XUCA 5D2BA 1GXDA 3LMCA 1QIBA 2SRTA 2OY4A 1H71P 1O0QA 3LJZA 3VTGA 1AYKA 1IAEA 1K7QA 3Q2HA 2L0RA 3Q2GA 3ZUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKI A;  1R1H A;  1A85 A;  1YQY A;  1G9K A;  1SU3 A;  4WF6 A;  4GR3 A;  4IJO A;  2MZI A;  1BKC E;  3TSK A;  1JK3 A;  4CTH A;  3EDH A;  1PWW A;  3U1R A;  1UMS A;  5BOY A;  2W15 A;  4IUW A;  1ZXV A;  1O0T A;  2Z2D A;  1QJI A;  3KWV C;  3K7N A;  1Y93 A;  3KRY A;  3LIK A;  3ZVS A;  1C7K A;  1CQR A;  1BM6 A;  2WO9 A;  4GR8 A;  1D8F A;  3DPF A;  3WV3 A;  1JIW P;  1QIC A;  4FU4 A;  5B5O A;  2RJQ A;  4H82 A;  4H49 A;  1MMB A;  2Y6C A;  3E8R A;  1QUA A;  2E3X A;  3LEA A;  1GKC A;  456C A;  3SHI A;  1XFY A;  1G49 A;  2E2D A;  4IN9 A;  1MMQ A;  4J4M A;  3TS4 A;  1MMP A;  4JQG A;  3F19 A;  1FBL A;  2MLR A;  1DTH A;  1R1I A;  1OM8 A;  1OM6 A;  1QIA A;  1XFW A;  5I0L A;  1ND1 A;  4XM7 A;  3RTT A;  3AIG A;  4ON1 A;  2KRJ A;  1UTZ A;  2JT6 A;  1XFV A;  5L7F A;  1MMR A;  4I35 A;  4QKZ A;  3LQB A;  3DNG A;  4G0D A;  2ERO A;  1OS2 A;  1PWV A;  4WZV A;  4XBH A;  2ERP A;  3DSL A;  3K7L A;  1OM7 A;  3MA2 A;  4GR0 A;  1D5J A;  1BKC A;  1AST A;  3KEC A;  5I2Z A;  3CKI A;  3AYU A;  2JIH A;  2K2G A;  1Y0V A;  3ZXH A;  3LE9 A;  3N2V A;  1PWP A;  1IAA A;  3RTS A;  3KEK A;  1KUK A;  1D8M A;  2W13 A;  2XS3 A;  4JA1 A;  4GWN A;  1S4B P;  3WV2 A;  2PJT A;  1Q3A A;  1FM1 A;  2MZH A;  1B8Y A;  2D1N A;  4H3X A;  1BKC I;  3KMC A;  1SMP A;  1PWQ A;  1HV5 A;  3VI1 A;  3HY9 A;  1IAG A;  4HX3 A;  1GE7 A;  2WOA A;  4GF1 A;  2ERQ A;  3G5C A;  3OHO A;  4A3W A;  2DW2 A;  2OY2 A;  1RMZ A;  1JAP A;  1JAQ A;  2AYK A;  1I73 A;  1GO8 P;  3LQ0 A;  4PKV A;  5I4O A;  3LJT A;  2FV5 A;  3P1V A;  1CK7 A;  1GE5 A;  4DPE A;  4JIJ A;  2DW1 A;  3DWB A;  2OI0 A;  1JAO A;  1XFU A;  2X3C A;  3LIR A;  5BOT A;  4ZR5 A;  1J7N A;  1AF0 A;  1KBC A;  1HY7 A;  2A8H A;  3EHX A;  4G9L A;  1MNC A;  3L0T A;  1RM8 A;  1ZXC A;  3N2U A;  4AUO A;  4R3V A;  4PKT A;  1UTT A;  1JJ9 A;  5I3M A;  2N8R A;  2JSD A;  1C8T A;  5CUH A;  1BSW A;  3I7I A;  5D7W A;  3F15 A;  3EHY A;  2AIG P;  1Z3J A;  1A86 A;  3G42 A;  3LK8 A;  1R54 A;  2OVZ A;  1CXV A;  3LJG A;  4ILW D;  3USN A;  3L0V A;  4GWM A;  3HDB A;  5L79 A;  1WNI A;  2DW0 A;  2X3A A;  1IAC A;  2USN A;  5CZM A;  5D1S A;  966C A;  1G12 A;  2OXZ A;  2X7M A;  1IAB A;  1ZVX A;  2HU6 A;  2OXU A;  1YOU A;  1IAD A;  3LUM A;  5JMY A;  1UMT A;  3HYG A;  3O2X A;  1B3D A;  1HTD A;  1KUH A;  1EAK A;  1C3I A;  4JPA A;  3NX7 A;  2XS4 A;  4DF9 A;  1SAT A;  1ZP5 A;  3BA0 A;  1CAQ A;  1ATL A;  5D3C A;  3DPE A;  4L63 A;  1AKL A;  2POJ A;  2OW2 A;  1XFX A;  4EFS A;  3HY7 A;  1EUB A;  4PKR A;  4FXY P;  1CGF A;  3WV1 A;  3KME A;  4L19 A;  1JIZ A;  5D1U A;  1ZTQ A;  1KUI A;  3LGP A;  4AXQ A;  1XFZ A;  830C A;  1HFS A;  1DMT A;  1K7I A;  1GE6 A;  2DDF A;  2X3B A;  1OS9 A;  1L6J A;  5D1T A;  5B5P A;  2YIG A;  1SRP A;  1QJJ A;  2FV9 A;  5H8X A;  1GO7 P;  4DV8 A;  3EDZ A;  2OW9 A;  4AIG A;  3DL1 A;  3HB2 P;  1EB6 A;  4XM6 A;  2YB9 A;  1GKD A;  4H76 A;  3UVC A;  2K9C A;  4XCT A;  1UEA A;  3B2Z A;  3HDA P;  5I43 A;  1JAN A;  1KAP P;  1ROS A;  2TCL A;  4H2E A;  3TT4 A;  3F17 A;  1KUG A;  4Q1L A;  4H30 A;  4L6T A;  2Y6D A;  5BPA A;  1OO9 A;  1R1J A;  4DD8 A;  4WK7 A;  1USN A;  4FVL A;  3EWJ A;  2O3E A;  4FXQ A;  3LIL A;  1SLM A;  1I1I P;  1KUF A;  3LUN A;  1YP1 A;  4PKS A;  4PKU A;  3B8Z A;  2JNP A;  1XUR A;  3P24 A;  3EDG A;  1G05 A;  3O64 A;  4XM8 A;  2QPJ A;  2WO8 A;  2CKI A;  1G4K A;  5LAB A;  2CLT A;  4AYK A;  3ELM A;  2OXW A;  1FLS A;  2RJP A;  3V96 B;  4WKE A;  1BQQ M;  5CXA A;  1PWU A;  4GQL A;  3HBV P;  2OZR A;  5I12 A;  1XUD A;  4I03 A;  3LKA A;  2J0T A;  2MLS A;  1SLN A;  1BUD A;  2W14 A;  4JP4 A;  2JT5 A;  3EDI A;  1BZS A;  1OMJ A;  1YCM A;  4HMA A;  3OHL A;  1I76 A;  1K7G A;  4H84 A;  4GUY A;  3TVC A;  1D7X A;  4PKW A;  2V4B A;  1R55 A;  2MZE A;  2OVX A;  4H1Q A;  1JKY A;  3AYK A;  1BQO A;  1Y8J A;  2OW0 A;  2I47 A;  3HBU P;  1JH1 A;  1CGE A;  3GBO A;  1HFC A;  1BUV M;  2J83 A;  3KHI A;  4PKQ A;  1ZS0 A;  2DDY A;  3I7G A;  3B92 A;  1CGL A;  2O36 A;  4A7B A;  1CIZ A;  1HOV A;  2D1O A;  3F1A A;  2W0D A;  3F18 A;  2W12 A;  3F16 A;  1BIW A;  3KEJ A;  2OW1 A;  1XUC A;  5D2B A;  1GXD A;  3LMC A;  1QIB A;  2SRT A;  2OY4 A;  1H71 P;  1O0Q A;  3LJZ A;  3VTG A;  1AYK A;  1IAE A;  1K7Q A;  3Q2H A;  2L0R A;  3Q2G A;  3ZUK A; 
#chains in the Genus database with same CATH topology
 4WKI A;  1R1H A;  1A85 A;  1YQY A;  1G9K A;  1SU3 A;  4WF6 A;  4GR3 A;  4IJO A;  3DTE A;  2MZI A;  1BKC E;  3TSK A;  1JK3 A;  4CTH A;  3EDH A;  1PWW A;  3U1R A;  1UMS A;  5BOY A;  2W15 A;  4IUW A;  1ZXV A;  1O0T A;  2Z2D A;  1QJI A;  3KWV C;  3K7N A;  1Y93 A;  3KRY A;  3LIK A;  3ZVS A;  1C7K A;  1CQR A;  1BM6 A;  2WO9 A;  4GR8 A;  1D8F A;  3DPF A;  3WV3 A;  1JIW P;  1QIC A;  4FU4 A;  5B5O A;  2RJQ A;  4H82 A;  4H49 A;  1MMB A;  2Y6C A;  3E8R A;  1QUA A;  2E3X A;  3LEA A;  1GKC A;  456C A;  3SHI A;  1XFY A;  1G49 A;  2E2D A;  4IN9 A;  1MMQ A;  4J4M A;  3TS4 A;  1MMP A;  4JQG A;  3F19 A;  1FBL A;  2MLR A;  1DTH A;  1R1I A;  1OM8 A;  1OM6 A;  1QIA A;  1XFW A;  5I0L A;  1ND1 A;  4XM7 A;  3RTT A;  3AIG A;  4ON1 A;  2KRJ A;  1UTZ A;  2JT6 A;  1XFV A;  5L7F A;  1MMR A;  4I35 A;  4QKZ A;  3LQB A;  3DNG A;  4G0D A;  2ERO A;  1OS2 A;  1PWV A;  4WZV A;  4XBH A;  2ERP A;  3DSL A;  3K7L A;  1OM7 A;  3MA2 A;  4GR0 A;  1D5J A;  1BKC A;  1AST A;  3KEC A;  5I2Z A;  3CKI A;  3AYU A;  2JIH A;  2K2G A;  1Y0V A;  3ZXH A;  3LE9 A;  3N2V A;  1PWP A;  1IAA A;  3RTS A;  3KEK A;  1KUK A;  1D8M A;  1OZ9 A;  2W13 A;  2XS3 A;  4JA1 A;  4GWN A;  1S4B P;  3WV2 A;  2PJT A;  1Q3A A;  1FM1 A;  2MZH A;  1B8Y A;  2D1N A;  4H3X A;  1BKC I;  3KMC A;  1SMP A;  1PWQ A;  1HV5 A;  3VI1 A;  3HY9 A;  1IAG A;  4HX3 A;  1GE7 A;  2WOA A;  4GF1 A;  2ERQ A;  3G5C A;  3OHO A;  4A3W A;  2DW2 A;  2OY2 A;  1RMZ A;  1JAP A;  1JAQ A;  2AYK A;  1I73 A;  1GO8 P;  3LQ0 A;  4PKV A;  5I4O A;  3LJT A;  2FV5 A;  3P1V A;  1CK7 A;  1GE5 A;  4DPE A;  4JIJ A;  2DW1 A;  3DWB A;  2OI0 A;  1JAO A;  1XFU A;  2X3C A;  3LIR A;  5BOT A;  4ZR5 A;  1J7N A;  1AF0 A;  1KBC A;  1HY7 A;  2A8H A;  3EHX A;  4G9L A;  1MNC A;  3L0T A;  1RM8 A;  1ZXC A;  3N2U A;  4AUO A;  4R3V A;  4PKT A;  1UTT A;  1JJ9 A;  5I3M A;  2N8R A;  2JSD A;  1C8T A;  5CUH A;  1BSW A;  3I7I A;  5D7W A;  3F15 A;  3EHY A;  2AIG P;  1Z3J A;  1A86 A;  3G42 A;  3LK8 A;  1R54 A;  2OVZ A;  1CXV A;  3LJG A;  4ILW D;  3USN A;  3L0V A;  4GWM A;  3HDB A;  5L79 A;  1WNI A;  2DW0 A;  2X3A A;  1IAC A;  2USN A;  5CZM A;  5D1S A;  966C A;  1G12 A;  2OXZ A;  2X7M A;  1IAB A;  1ZVX A;  2HU6 A;  2OXU A;  1YOU A;  1IAD A;  3LUM A;  5JMY A;  1UMT A;  3HYG A;  3O2X A;  1B3D A;  1HTD A;  1KUH A;  1EAK A;  1C3I A;  4JPA A;  3NX7 A;  2XS4 A;  4DF9 A;  1XAX A;  1SAT A;  1ZP5 A;  3BA0 A;  1CAQ A;  3DTI A;  1ATL A;  5D3C A;  3DPE A;  4L63 A;  1AKL A;  3DTK A;  2POJ A;  2OW2 A;  1XFX A;  4EFS A;  3HY7 A;  1EUB A;  4PKR A;  4FXY P;  1CGF A;  3WV1 A;  3KME A;  2YUF A;  4L19 A;  1JIZ A;  5D1U A;  1ZTQ A;  1KUI A;  3LGP A;  4AXQ A;  1XFZ A;  830C A;  1HFS A;  1DMT A;  1K7I A;  1GE6 A;  1XM5 A;  2DDF A;  2X3B A;  1OS9 A;  1L6J A;  5D1T A;  5B5P A;  2YIG A;  1SRP A;  1QJJ A;  2FV9 A;  5H8X A;  1GO7 P;  4DV8 A;  3EDZ A;  2OW9 A;  4AIG A;  3DL1 A;  3HB2 P;  1EB6 A;  4XM6 A;  2YB9 A;  1GKD A;  4H76 A;  3UVC A;  2K9C A;  4XCT A;  1UEA A;  3B2Z A;  3HDA P;  5I43 A;  1JAN A;  1KAP P;  1ROS A;  2TCL A;  4H2E A;  3TT4 A;  3F17 A;  1KUG A;  4Q1L A;  4H30 A;  4L6T A;  2Y6D A;  5BPA A;  1OO9 A;  1R1J A;  4DD8 A;  4WK7 A;  1USN A;  4FVL A;  3EWJ A;  2O3E A;  4FXQ A;  3LIL A;  1SLM A;  1I1I P;  1KUF A;  3LUN A;  1YP1 A;  4PKS A;  4PKU A;  3B8Z A;  2JNP A;  1XUR A;  3P24 A;  3EDG A;  1G05 A;  3O64 A;  4XM8 A;  2QPJ A;  2WO8 A;  2CKI A;  1G4K A;  5LAB A;  2CLT A;  4AYK A;  3ELM A;  2OXW A;  1FLS A;  2RJP A;  3V96 B;  4WKE A;  1TVI A;  1BQQ M;  5CXA A;  1PWU A;  4GQL A;  3HBV P;  2OZR A;  5I12 A;  1XUD A;  4I03 A;  3LKA A;  2J0T A;  2MLS A;  1SLN A;  1BUD A;  2W14 A;  4JP4 A;  2JT5 A;  3EDI A;  1BZS A;  1OMJ A;  1YCM A;  4HMA A;  3OHL A;  1I76 A;  1K7G A;  4H84 A;  4GUY A;  3TVC A;  1D7X A;  4PKW A;  2V4B A;  1R55 A;  2MZE A;  2OVX A;  4H1Q A;  1JKY A;  3AYK A;  1BQO A;  1Y8J A;  2OW0 A;  2I47 A;  3HBU P;  1JH1 A;  1CGE A;  3GBO A;  1HFC A;  1BUV M;  2J83 A;  3KHI A;  4PKQ A;  1ZS0 A;  2DDY A;  3I7G A;  3B92 A;  1CGL A;  2O36 A;  4A7B A;  4L7A A;  1CIZ A;  1HOV A;  2D1O A;  3F1A A;  2W0D A;  3F18 A;  2W12 A;  3F16 A;  1BIW A;  3KEJ A;  2OW1 A;  1XUC A;  5D2B A;  1GXD A;  3LMC A;  1QIB A;  2SRT A;  2OY4 A;  1H71 P;  1O0Q A;  3LJZ A;  3VTG A;  1AYK A;  1IAE A;  1K7Q A;  3Q2H A;  2L0R A;  3Q2G A;  3ZUK A; 
#chains in the Genus database with same CATH homology
 4WKI A;  1R1H A;  1A85 A;  1YQY A;  1G9K A;  1SU3 A;  4WF6 A;  4GR3 A;  4IJO A;  3DTE A;  2MZI A;  1BKC E;  3TSK A;  1JK3 A;  4CTH A;  3EDH A;  1PWW A;  3U1R A;  1UMS A;  5BOY A;  2W15 A;  4IUW A;  1ZXV A;  1O0T A;  2Z2D A;  1QJI A;  3KWV C;  3K7N A;  1Y93 A;  3KRY A;  3LIK A;  3ZVS A;  1C7K A;  1CQR A;  1BM6 A;  2WO9 A;  4GR8 A;  1D8F A;  3DPF A;  3WV3 A;  1JIW P;  1QIC A;  4FU4 A;  5B5O A;  2RJQ A;  4H82 A;  4H49 A;  1MMB A;  2Y6C A;  3E8R A;  1QUA A;  2E3X A;  3LEA A;  1GKC A;  456C A;  3SHI A;  1XFY A;  1G49 A;  2E2D A;  4IN9 A;  1MMQ A;  4J4M A;  3TS4 A;  1MMP A;  4JQG A;  3F19 A;  1FBL A;  2MLR A;  1DTH A;  1R1I A;  1OM8 A;  1OM6 A;  1QIA A;  1XFW A;  5I0L A;  1ND1 A;  4XM7 A;  3RTT A;  3AIG A;  4ON1 A;  2KRJ A;  1UTZ A;  2JT6 A;  1XFV A;  5L7F A;  1MMR A;  4I35 A;  4QKZ A;  3LQB A;  3DNG A;  4G0D A;  2ERO A;  1OS2 A;  1PWV A;  4WZV A;  4XBH A;  2ERP A;  3DSL A;  3K7L A;  1OM7 A;  3MA2 A;  4GR0 A;  1D5J A;  1BKC A;  1AST A;  3KEC A;  5I2Z A;  3CKI A;  3AYU A;  2JIH A;  2K2G A;  1Y0V A;  3ZXH A;  3LE9 A;  3N2V A;  1PWP A;  1IAA A;  3RTS A;  3KEK A;  1KUK A;  1D8M A;  2W13 A;  2XS3 A;  4JA1 A;  4GWN A;  1S4B P;  3WV2 A;  2PJT A;  1Q3A A;  1FM1 A;  2MZH A;  1B8Y A;  2D1N A;  4H3X A;  1BKC I;  3KMC A;  1SMP A;  1PWQ A;  1HV5 A;  3VI1 A;  3HY9 A;  1IAG A;  4HX3 A;  1GE7 A;  2WOA A;  4GF1 A;  2ERQ A;  3G5C A;  3OHO A;  4A3W A;  2DW2 A;  2OY2 A;  1RMZ A;  1JAP A;  1JAQ A;  2AYK A;  1I73 A;  1GO8 P;  3LQ0 A;  4PKV A;  5I4O A;  3LJT A;  2FV5 A;  3P1V A;  1CK7 A;  1GE5 A;  4DPE A;  4JIJ A;  2DW1 A;  3DWB A;  2OI0 A;  1JAO A;  1XFU A;  2X3C A;  3LIR A;  5BOT A;  4ZR5 A;  1J7N A;  1AF0 A;  1KBC A;  1HY7 A;  2A8H A;  3EHX A;  4G9L A;  1MNC A;  3L0T A;  1RM8 A;  1ZXC A;  3N2U A;  4AUO A;  4R3V A;  4PKT A;  1UTT A;  1JJ9 A;  5I3M A;  2N8R A;  2JSD A;  1C8T A;  5CUH A;  1BSW A;  3I7I A;  5D7W A;  3F15 A;  3EHY A;  2AIG P;  1Z3J A;  1A86 A;  3G42 A;  3LK8 A;  1R54 A;  2OVZ A;  1CXV A;  3LJG A;  4ILW D;  3USN A;  3L0V A;  4GWM A;  3HDB A;  5L79 A;  1WNI A;  2DW0 A;  2X3A A;  1IAC A;  2USN A;  5CZM A;  5D1S A;  966C A;  1G12 A;  2OXZ A;  2X7M A;  1IAB A;  1ZVX A;  2HU6 A;  2OXU A;  1YOU A;  1IAD A;  3LUM A;  5JMY A;  1UMT A;  3HYG A;  3O2X A;  1B3D A;  1HTD A;  1KUH A;  1EAK A;  1C3I A;  4JPA A;  3NX7 A;  2XS4 A;  4DF9 A;  1SAT A;  1ZP5 A;  3BA0 A;  1CAQ A;  3DTI A;  1ATL A;  5D3C A;  3DPE A;  4L63 A;  1AKL A;  3DTK A;  2POJ A;  2OW2 A;  1XFX A;  4EFS A;  3HY7 A;  1EUB A;  4PKR A;  4FXY P;  1CGF A;  3WV1 A;  3KME A;  2YUF A;  4L19 A;  1JIZ A;  5D1U A;  1ZTQ A;  1KUI A;  3LGP A;  4AXQ A;  1XFZ A;  830C A;  1HFS A;  1DMT A;  1K7I A;  1GE6 A;  2DDF A;  2X3B A;  1OS9 A;  1L6J A;  5D1T A;  5B5P A;  2YIG A;  1SRP A;  1QJJ A;  2FV9 A;  5H8X A;  1GO7 P;  4DV8 A;  3EDZ A;  2OW9 A;  4AIG A;  3DL1 A;  3HB2 P;  1EB6 A;  4XM6 A;  2YB9 A;  1GKD A;  4H76 A;  3UVC A;  2K9C A;  4XCT A;  1UEA A;  3B2Z A;  3HDA P;  5I43 A;  1JAN A;  1KAP P;  1ROS A;  2TCL A;  4H2E A;  3TT4 A;  3F17 A;  1KUG A;  4Q1L A;  4H30 A;  4L6T A;  2Y6D A;  5BPA A;  1OO9 A;  1R1J A;  4DD8 A;  4WK7 A;  1USN A;  4FVL A;  3EWJ A;  2O3E A;  4FXQ A;  3LIL A;  1SLM A;  1I1I P;  1KUF A;  3LUN A;  1YP1 A;  4PKS A;  4PKU A;  3B8Z A;  2JNP A;  1XUR A;  3P24 A;  3EDG A;  1G05 A;  3O64 A;  4XM8 A;  2QPJ A;  2WO8 A;  2CKI A;  1G4K A;  5LAB A;  2CLT A;  4AYK A;  3ELM A;  2OXW A;  1FLS A;  2RJP A;  3V96 B;  4WKE A;  1BQQ M;  5CXA A;  1PWU A;  4GQL A;  3HBV P;  2OZR A;  5I12 A;  1XUD A;  4I03 A;  3LKA A;  2J0T A;  2MLS A;  1SLN A;  1BUD A;  2W14 A;  4JP4 A;  2JT5 A;  3EDI A;  1BZS A;  1OMJ A;  1YCM A;  4HMA A;  3OHL A;  1I76 A;  1K7G A;  4H84 A;  4GUY A;  3TVC A;  1D7X A;  4PKW A;  2V4B A;  1R55 A;  2MZE A;  2OVX A;  4H1Q A;  1JKY A;  3AYK A;  1BQO A;  1Y8J A;  2OW0 A;  2I47 A;  3HBU P;  1JH1 A;  1CGE A;  3GBO A;  1HFC A;  1BUV M;  2J83 A;  3KHI A;  4PKQ A;  1ZS0 A;  2DDY A;  3I7G A;  3B92 A;  1CGL A;  2O36 A;  4A7B A;  4L7A A;  1CIZ A;  1HOV A;  2D1O A;  3F1A A;  2W0D A;  3F18 A;  2W12 A;  3F16 A;  1BIW A;  3KEJ A;  2OW1 A;  1XUC A;  5D2B A;  1GXD A;  3LMC A;  1QIB A;  2SRT A;  2OY4 A;  1H71 P;  1O0Q A;  3LJZ A;  3VTG A;  1AYK A;  1IAE A;  1K7Q A;  3Q2H A;  2L0R A;  3Q2G A;  3ZUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...