1D5JA

Crystal structure of mmp3 complexed with a thiazepine based inhibitor.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
169
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, and biological evaluation of potent thiazine- and thiazepine-based matrix metalloproteinase inhibitors.
pubmed doi rcsb
molecule keywords STROMELYSIN-1
molecule tags Hydrolase
source organism Homo sapiens
total genus 46
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1d5jA00
1HFCA 4XBHA 1YOUA 4HX3A 2Y6DA 1XFYA 1ZP5A 3LJGA 1JIWP 2W13A 1Y0VA 4IJOA 4JIJA 3ZVSA 3LEAA 1FM1A 3HBVP 5I4OA 1MMPA 1GE5A 1MNCA 2W15A 3P24A 4QKZA 4WF6A 3SHIA 2WO9A 5B5PA 3N2UA 1MMRA 3LKAA 3DPFA 3G42A 1HV5A 1R55A 2JT5A 3RTSA 1DTHA 3O64A 1OM6A 1GE7A 3LQBA 3HDBA 2DDFA 4H30A 1XFXA 5D1TA 2EROA 5BPAA 1HY7A 830CA 1XFUA 1S4BP 2I47A 1PWPA 2O36A 2JSDA 4GF1A 4HMAA 1UTTA 2WO8A 1BM6A 1R1JA 3L0VA 3USNA 1UMSA 3GBOA 3O2XA 5H8XA 4JA1A 4H82A 1KUGA 1K7GA 1QJJA 5D2BA 3N2VA 4PKVA 5L79A 4GWNA 1XFVA 4GR3A 1OM8A 2WOAA 1YP1A 1CGLA 3ZUKA 2ERPA 3RTTA 2MZHA 2HU6A 1CGFA 1A85A 4I03A 1QIBA 1CGEA 4GQLA 4XM6A 1JKYA 2D1NA 2W14A 1JK3A 1Y8JA 1UTZA 2MLRA 1OMJA 1R1HA 3VTGA 2X3AA 1EB6A 2K2GA 4L63A 4PKQA 1BQOA 2OVZA 1O0QA 3MA2A 4WKIA 1ZTQA 1AF0A 4WZVA 2XS4A 3DNGA 966CA 3OHOA 4Q1LA 3LIKA 3UVCA 2RJPA 3KWVC 2DDYA 1O0TA 1UMTA 2DW0A 2DW1A 4IUWA 2Y6CA 4AUOA 1GO7P 1YCMA 4PKUA 1IAEA 3TSKA 1C8TA 3HB2P 4R3VA 1QJIA 1GE6A 3HDAP 5CUHA 3K7LA 1IABA 1OS9A 3EDGA 3EDIA 3EHXA 3HY9A 1GKDA 2XS3A 4PKRA 4CTHA 4I35A 1I76A 1ZS0A 1G12A 2FV9A 3KEKA 5I0LA 1USNA 3B8ZA 2QPJA 2W12A 1HTDA 3DPEA 2JNPA 1D7XA 1XUDA 1I73A 1ATLA 2CKIA 4PKWA 4AXQA 3EHYA 2X7MA 1BKCA 2JIHA 1MMQA 3V96B 2OZRA 1BQQM 3B2ZA 1QIAA 4A3WA 1PWQA 3DL1A 1DMTA 1KUHA 1SRPA 1WNIA 1BUDA 3LIRA 4DD8A 4JPAA 4XCTA 4GUYA 2OY2A 4FXQA 1ND1A 1EUBA 4GWMA 1KUFA 4DV8A 2L0RA 4FXYP 3KRYA 4H1QA 5JMYA 3KMCA 2AIGP 2OXWA 1PWUA 1FLSA 1C3IA 2E3XA 2E2DA 5D1SA 1KBCA 1ZXCA 3DWBA 3F18A 4GR0A 1HFSA 1J7NA 1RMZA 1B3DA 1PWVA 3F19A 4H76A 1CXVA 2ERQA 1OO9A 3AIGA 1BSWA 4XM7A 4DF9A 1AYKA 2X3CA 1JJ9A 3LE9A 4FVLA 1R1IA 1KAPP 2OVXA 1B8YA 3ELMA 4G9LA 5D1UA 2OW9A 1QICA 1BIWA 3EDHA 2Z2DA 1SU3A 3E8RA 2PJTA 3G5CA 3LUMA 4ZR5A 3WV3A 3F16A 3WV2A 2N8RA 4H2EA 1G49A 1CQRA 4PKTA 2DW2A 1BUVM 2OW1A 5BOTA 5LABA 1YQYA 2OI0A 3EWJA 1JAQA 3ZXHA 3NX7A 2J0TA 2A8HA 1ZXVA 1SMPA 2V4BA 3F1AA 4WKEA 2JT6A 3I7GA 3TS4A 5I3MA 1K7IA 1JAOA 4H3XA 1H71P 5BOYA 3LILA 1C7KA 2OXUA 1HOVA 3LK8A 3K7NA 4G0DA 2YIGA 4H84A 1SLNA 3HBUP 4EFSA 1AKLA 2SRTA 1QUAA 5I43A 5D7WA 4ILWD 1EAKA 4AYKA 3WV1A 4JQGA 3OHLA 1D8MA 1XFWA 3KECA 1RM8A 3LMCA 1KUIA 3I7IA 1Q3AA 1G9KA 3EDZA 5L7FA 1ASTA 1JH1A 1KUKA 1GXDA 1IAAA 2RJQA 3LQ0A 3KMEA 3L0TA 5CXAA 2D1OA 3F17A 1I1IP 3KHIA 1SATA 2CLTA 2AYKA 3LJTA 3AYKA 4XM8A 3KEJA 2YB9A 5B5OA 2KRJA 2OW0A 5CZMA 3LUNA 3F15A 1MMBA 4WK7A 4JP4A 3Q2HA 4ON1A 2O3EA 2POJA 4A7BA 456CA 4FU4A 1ROSA 2MZEA 1D8FA 1XFZA 1UEAA 4PKSA 2MLSA 3LGPA 2OW2A 3U1RA 5I12A 3DSLA 1OS2A 2J83A 4L6TA 1K7QA 2USNA 1ZVXA 5I2ZA 3HY7A 1IADA 1R54A 3Q2GA 1G05A 3P1VA 1A86A 4H49A 1CAQA 2OXZA 1JANA 3LJZA 3VI1A 1XUCA 4AIGA 2OY4A 1BKCE 1IAGA 2K9CA 1XURA 3HYGA 1OM7A 3BA0A 3TVCA 2FV5A 1PWWA 1IACA 3TT4A 3B92A 1D5JA 1BKCI 1Z3JA 2TCLA 1JIZA 1GO8P 1L6JA 5D3CA 1JAPA 1G4KA 1CK7A 4J4MA 3CKIA 3AYUA 2MZIA 1FBLA 1Y93A 4DPEA 1CIZA 1GKCA 1BZSA 4IN9A 2X3BA 4GR8A 1SLMA 2W0DA 4L19A
chains in the Genus database with same CATH superfamily
1HFCA 4XBHA 1YOUA 4HX3A 2Y6DA 1XFYA 1ZP5A 3LJGA 1JIWP 2W13A 1Y0VA 4IJOA 4JIJA 3ZVSA 3LEAA 1FM1A 3HBVP 5I4OA 1MMPA 1GE5A 1MNCA 2W15A 3P24A 4QKZA 4WF6A 3SHIA 2WO9A 5B5PA 3N2UA 1MMRA 3LKAA 3DPFA 3G42A 1HV5A 1R55A 2JT5A 3RTSA 1DTHA 3O64A 1OM6A 1GE7A 3LQBA 3HDBA 2DDFA 1XAXA 4H30A 1XFXA 5D1TA 2EROA 5BPAA 1HY7A 830CA 1XFUA 1S4BP 2I47A 1PWPA 2O36A 2JSDA 4GF1A 4HMAA 1UTTA 2WO8A 1BM6A 1R1JA 3L0VA 3USNA 1UMSA 3GBOA 3O2XA 5H8XA 2YUFA 4JA1A 4H82A 1KUGA 1K7GA 1QJJA 5D2BA 3N2VA 4PKVA 5L79A 4GWNA 1XFVA 4GR3A 1OM8A 2WOAA 1YP1A 1CGLA 3ZUKA 2ERPA 3RTTA 2MZHA 2HU6A 1CGFA 1A85A 4I03A 1QIBA 1CGEA 4GQLA 4XM6A 1JKYA 2D1NA 2W14A 1JK3A 1Y8JA 1UTZA 2MLRA 1OMJA 1R1HA 3VTGA 2X3AA 1EB6A 2K2GA 4L63A 1XM5A 4PKQA 1BQOA 2OVZA 1O0QA 3MA2A 4WKIA 1ZTQA 1AF0A 4WZVA 2XS4A 3DNGA 966CA 3OHOA 4Q1LA 3LIKA 3UVCA 2RJPA 3KWVC 2DDYA 1O0TA 1UMTA 2DW0A 1OZ9A 2DW1A 4IUWA 2Y6CA 4AUOA 1GO7P 1YCMA 4PKUA 1IAEA 3TSKA 1C8TA 3HB2P 4R3VA 1QJIA 1GE6A 3HDAP 5CUHA 3K7LA 1IABA 1OS9A 3EDGA 3EDIA 3EHXA 3HY9A 1GKDA 2XS3A 4PKRA 4CTHA 4I35A 1I76A 1ZS0A 1G12A 2FV9A 3KEKA 5I0LA 1USNA 3B8ZA 2QPJA 2W12A 1HTDA 3DPEA 2JNPA 1D7XA 1XUDA 1I73A 1ATLA 2CKIA 4PKWA 4AXQA 3EHYA 2X7MA 1BKCA 2JIHA 1MMQA 3V96B 2OZRA 1BQQM 3B2ZA 1QIAA 4A3WA 1PWQA 3DL1A 1DMTA 1KUHA 1SRPA 1WNIA 1BUDA 3LIRA 4DD8A 4JPAA 4XCTA 4GUYA 2OY2A 4FXQA 1ND1A 1EUBA 4GWMA 1KUFA 4DV8A 2L0RA 4FXYP 3KRYA 4H1QA 5JMYA 3KMCA 2AIGP 2OXWA 1PWUA 3DTIA 1FLSA 1C3IA 2E3XA 2E2DA 3DTKA 5D1SA 1KBCA 1ZXCA 3DWBA 3F18A 4GR0A 1HFSA 1J7NA 1RMZA 1B3DA 1PWVA 3F19A 4H76A 1CXVA 2ERQA 1OO9A 3AIGA 1BSWA 4XM7A 4DF9A 1AYKA 2X3CA 1JJ9A 3LE9A 4FVLA 1R1IA 1KAPP 2OVXA 1B8YA 3ELMA 4G9LA 5D1UA 2OW9A 1QICA 1BIWA 3EDHA 2Z2DA 1SU3A 4L7AA 3E8RA 2PJTA 3G5CA 3LUMA 4ZR5A 3WV3A 3F16A 3WV2A 2N8RA 4H2EA 1G49A 1CQRA 4PKTA 2DW2A 1BUVM 2OW1A 5BOTA 5LABA 1YQYA 2OI0A 3EWJA 1JAQA 3ZXHA 3NX7A 2J0TA 2A8HA 1ZXVA 1SMPA 2V4BA 3F1AA 4WKEA 2JT6A 3DTEA 3I7GA 3TS4A 5I3MA 1K7IA 1JAOA 4H3XA 1H71P 5BOYA 3LILA 1C7KA 2OXUA 1HOVA 3LK8A 3K7NA 4G0DA 2YIGA 4H84A 1SLNA 3HBUP 4EFSA 1AKLA 2SRTA 1QUAA 5I43A 5D7WA 4ILWD 1EAKA 4AYKA 3WV1A 4JQGA 3OHLA 1D8MA 1XFWA 3KECA 1RM8A 3LMCA 1KUIA 3I7IA 1Q3AA 1G9KA 3EDZA 5L7FA 1ASTA 1JH1A 1KUKA 1GXDA 1IAAA 2RJQA 3LQ0A 3KMEA 3L0TA 5CXAA 2D1OA 3F17A 1I1IP 3KHIA 1SATA 2CLTA 2AYKA 3LJTA 3AYKA 4XM8A 3KEJA 2YB9A 5B5OA 2KRJA 2OW0A 5CZMA 3LUNA 3F15A 1MMBA 4WK7A 4JP4A 3Q2HA 4ON1A 2O3EA 2POJA 4A7BA 456CA 4FU4A 1ROSA 2MZEA 1D8FA 1XFZA 1UEAA 4PKSA 2MLSA 3LGPA 2OW2A 3U1RA 5I12A 3DSLA 1OS2A 2J83A 4L6TA 1K7QA 2USNA 1ZVXA 1TVIA 5I2ZA 3HY7A 1IADA 1R54A 3Q2GA 1G05A 3P1VA 1A86A 4H49A 1CAQA 2OXZA 1JANA 3LJZA 3VI1A 1XUCA 4AIGA 2OY4A 1BKCE 1IAGA 2K9CA 1XURA 3HYGA 1OM7A 3BA0A 3TVCA 2FV5A 1PWWA 1IACA 3TT4A 3B92A 1D5JA 1BKCI 1Z3JA 2TCLA 1JIZA 1GO8P 1L6JA 5D3CA 1JAPA 1G4KA 1CK7A 4J4MA 3CKIA 3AYUA 2MZIA 1FBLA 1Y93A 4DPEA 1CIZA 1GKCA 1BZSA 4IN9A 2X3BA 4GR8A 1SLMA 2W0DA 4L19A
chains in the Genus database with same CATH topology
1HFCA 4XBHA 1YOUA 4HX3A 2Y6DA 1XFYA 1ZP5A 3LJGA 1JIWP 2W13A 1Y0VA 4IJOA 4JIJA 3ZVSA 3LEAA 1FM1A 3HBVP 5I4OA 1MMPA 1GE5A 1MNCA 2W15A 3P24A 4QKZA 4WF6A 3SHIA 2WO9A 5B5PA 3N2UA 1MMRA 3LKAA 3DPFA 3G42A 1HV5A 1R55A 2JT5A 3RTSA 1DTHA 3O64A 1OM6A 1GE7A 3LQBA 3HDBA 2DDFA 4H30A 1XFXA 5D1TA 2EROA 5BPAA 1HY7A 830CA 1XFUA 1S4BP 2I47A 1PWPA 2O36A 2JSDA 4GF1A 4HMAA 1UTTA 2WO8A 1BM6A 1R1JA 3L0VA 3USNA 1UMSA 3GBOA 3O2XA 5H8XA 2YUFA 4JA1A 4H82A 1KUGA 1K7GA 1QJJA 5D2BA 3N2VA 4PKVA 5L79A 4GWNA 1XFVA 4GR3A 1OM8A 2WOAA 1YP1A 1CGLA 3ZUKA 2ERPA 3RTTA 2MZHA 2HU6A 1CGFA 1A85A 4I03A 1QIBA 1CGEA 4GQLA 4XM6A 1JKYA 2D1NA 2W14A 1JK3A 1Y8JA 1UTZA 2MLRA 1OMJA 1R1HA 3VTGA 2X3AA 1EB6A 2K2GA 4L63A 4PKQA 1BQOA 2OVZA 1O0QA 3MA2A 4WKIA 1ZTQA 1AF0A 4WZVA 2XS4A 3DNGA 966CA 3OHOA 4Q1LA 3LIKA 3UVCA 2RJPA 3KWVC 2DDYA 1O0TA 1UMTA 2DW0A 2DW1A 4IUWA 2Y6CA 4AUOA 1GO7P 1YCMA 4PKUA 1IAEA 3TSKA 1C8TA 3HB2P 4R3VA 1QJIA 1GE6A 3HDAP 5CUHA 3K7LA 1IABA 1OS9A 3EDGA 3EDIA 3EHXA 3HY9A 1GKDA 2XS3A 4PKRA 4CTHA 4I35A 1I76A 1ZS0A 1G12A 2FV9A 3KEKA 5I0LA 1USNA 3B8ZA 2QPJA 2W12A 1HTDA 3DPEA 2JNPA 1D7XA 1XUDA 1I73A 1ATLA 2CKIA 4PKWA 4AXQA 3EHYA 2X7MA 1BKCA 2JIHA 1MMQA 3V96B 2OZRA 1BQQM 3B2ZA 1QIAA 4A3WA 1PWQA 3DL1A 1DMTA 1KUHA 1SRPA 1WNIA 1BUDA 3LIRA 4DD8A 4JPAA 4XCTA 4GUYA 2OY2A 4FXQA 1ND1A 1EUBA 4GWMA 1KUFA 4DV8A 2L0RA 4FXYP 3KRYA 4H1QA 5JMYA 3KMCA 2AIGP 2OXWA 1PWUA 3DTIA 1FLSA 1C3IA 2E3XA 2E2DA 3DTKA 5D1SA 1KBCA 1ZXCA 3DWBA 3F18A 4GR0A 1HFSA 1J7NA 1RMZA 1B3DA 1PWVA 3F19A 4H76A 1CXVA 2ERQA 1OO9A 3AIGA 1BSWA 4XM7A 4DF9A 1AYKA 2X3CA 1JJ9A 3LE9A 4FVLA 1R1IA 1KAPP 2OVXA 1B8YA 3ELMA 4G9LA 5D1UA 2OW9A 1QICA 1BIWA 3EDHA 2Z2DA 1SU3A 4L7AA 3E8RA 2PJTA 3G5CA 3LUMA 4ZR5A 3WV3A 3F16A 3WV2A 2N8RA 4H2EA 1G49A 1CQRA 4PKTA 2DW2A 1BUVM 2OW1A 5BOTA 5LABA 1YQYA 2OI0A 3EWJA 1JAQA 3ZXHA 3NX7A 2J0TA 2A8HA 1ZXVA 1SMPA 2V4BA 3F1AA 4WKEA 2JT6A 3DTEA 3I7GA 3TS4A 5I3MA 1K7IA 1JAOA 4H3XA 1H71P 5BOYA 3LILA 1C7KA 2OXUA 1HOVA 3LK8A 3K7NA 4G0DA 2YIGA 4H84A 1SLNA 3HBUP 4EFSA 1AKLA 2SRTA 1QUAA 5I43A 5D7WA 4ILWD 1EAKA 4AYKA 3WV1A 4JQGA 3OHLA 1D8MA 1XFWA 3KECA 1RM8A 3LMCA 1KUIA 3I7IA 1Q3AA 1G9KA 3EDZA 5L7FA 1ASTA 1JH1A 1KUKA 1GXDA 1IAAA 2RJQA 3LQ0A 3KMEA 3L0TA 5CXAA 2D1OA 3F17A 1I1IP 3KHIA 1SATA 2CLTA 2AYKA 3LJTA 3AYKA 4XM8A 3KEJA 2YB9A 5B5OA 2KRJA 2OW0A 5CZMA 3LUNA 3F15A 1MMBA 4WK7A 4JP4A 3Q2HA 4ON1A 2O3EA 2POJA 4A7BA 456CA 4FU4A 1ROSA 2MZEA 1D8FA 1XFZA 1UEAA 4PKSA 2MLSA 3LGPA 2OW2A 3U1RA 5I12A 3DSLA 1OS2A 2J83A 4L6TA 1K7QA 2USNA 1ZVXA 5I2ZA 3HY7A 1IADA 1R54A 3Q2GA 1G05A 3P1VA 1A86A 4H49A 1CAQA 2OXZA 1JANA 3LJZA 3VI1A 1XUCA 4AIGA 2OY4A 1BKCE 1IAGA 2K9CA 1XURA 3HYGA 1OM7A 3BA0A 3TVCA 2FV5A 1PWWA 1IACA 3TT4A 3B92A 1D5JA 1BKCI 1Z3JA 2TCLA 1JIZA 1GO8P 1L6JA 5D3CA 1JAPA 1G4KA 1CK7A 4J4MA 3CKIA 3AYUA 2MZIA 1FBLA 1Y93A 4DPEA 1CIZA 1GKCA 1BZSA 4IN9A 2X3BA 4GR8A 1SLMA 2W0DA 4L19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFC A;  4XBH A;  1YOU A;  4HX3 A;  2Y6D A;  1XFY A;  1ZP5 A;  3LJG A;  1JIW P;  2W13 A;  1Y0V A;  4IJO A;  4JIJ A;  3ZVS A;  3LEA A;  1FM1 A;  3HBV P;  5I4O A;  1MMP A;  1GE5 A;  1MNC A;  2W15 A;  3P24 A;  4QKZ A;  4WF6 A;  3SHI A;  2WO9 A;  5B5P A;  3N2U A;  1MMR A;  3LKA A;  3DPF A;  3G42 A;  1HV5 A;  1R55 A;  2JT5 A;  3RTS A;  1DTH A;  3O64 A;  1OM6 A;  1GE7 A;  3LQB A;  3HDB A;  2DDF A;  4H30 A;  1XFX A;  5D1T A;  2ERO A;  5BPA A;  1HY7 A;  830C A;  1XFU A;  1S4B P;  2I47 A;  1PWP A;  2O36 A;  2JSD A;  4GF1 A;  4HMA A;  1UTT A;  2WO8 A;  1BM6 A;  1R1J A;  3L0V A;  3USN A;  1UMS A;  3GBO A;  3O2X A;  5H8X A;  4JA1 A;  4H82 A;  1KUG A;  1K7G A;  1QJJ A;  5D2B A;  3N2V A;  4PKV A;  5L79 A;  4GWN A;  1XFV A;  4GR3 A;  1OM8 A;  2WOA A;  1YP1 A;  1CGL A;  3ZUK A;  2ERP A;  3RTT A;  2MZH A;  2HU6 A;  1CGF A;  1A85 A;  4I03 A;  1QIB A;  1CGE A;  4GQL A;  4XM6 A;  1JKY A;  2D1N A;  2W14 A;  1JK3 A;  1Y8J A;  1UTZ A;  2MLR A;  1OMJ A;  1R1H A;  3VTG A;  2X3A A;  1EB6 A;  2K2G A;  4L63 A;  4PKQ A;  1BQO A;  2OVZ A;  1O0Q A;  3MA2 A;  4WKI A;  1ZTQ A;  1AF0 A;  4WZV A;  2XS4 A;  3DNG A;  966C A;  3OHO A;  4Q1L A;  3LIK A;  3UVC A;  2RJP A;  3KWV C;  2DDY A;  1O0T A;  1UMT A;  2DW0 A;  2DW1 A;  4IUW A;  2Y6C A;  4AUO A;  1GO7 P;  1YCM A;  4PKU A;  1IAE A;  3TSK A;  1C8T A;  3HB2 P;  4R3V A;  1QJI A;  1GE6 A;  3HDA P;  5CUH A;  3K7L A;  1IAB A;  1OS9 A;  3EDG A;  3EDI A;  3EHX A;  3HY9 A;  1GKD A;  2XS3 A;  4PKR A;  4CTH A;  4I35 A;  1I76 A;  1ZS0 A;  1G12 A;  2FV9 A;  3KEK A;  5I0L A;  1USN A;  3B8Z A;  2QPJ A;  2W12 A;  1HTD A;  3DPE A;  2JNP A;  1D7X A;  1XUD A;  1I73 A;  1ATL A;  2CKI A;  4PKW A;  4AXQ A;  3EHY A;  2X7M A;  1BKC A;  2JIH A;  1MMQ A;  3V96 B;  2OZR A;  1BQQ M;  3B2Z A;  1QIA A;  4A3W A;  1PWQ A;  3DL1 A;  1DMT A;  1KUH A;  1SRP A;  1WNI A;  1BUD A;  3LIR A;  4DD8 A;  4JPA A;  4XCT A;  4GUY A;  2OY2 A;  4FXQ A;  1ND1 A;  1EUB A;  4GWM A;  1KUF A;  4DV8 A;  2L0R A;  4FXY P;  3KRY A;  4H1Q A;  5JMY A;  3KMC A;  2AIG P;  2OXW A;  1PWU A;  1FLS A;  1C3I A;  2E3X A;  2E2D A;  5D1S A;  1KBC A;  1ZXC A;  3DWB A;  3F18 A;  4GR0 A;  1HFS A;  1J7N A;  1RMZ A;  1B3D A;  1PWV A;  3F19 A;  4H76 A;  1CXV A;  2ERQ A;  1OO9 A;  3AIG A;  1BSW A;  4XM7 A;  4DF9 A;  1AYK A;  2X3C A;  1JJ9 A;  3LE9 A;  4FVL A;  1R1I A;  1KAP P;  2OVX A;  1B8Y A;  3ELM A;  4G9L A;  5D1U A;  2OW9 A;  1QIC A;  1BIW A;  3EDH A;  2Z2D A;  1SU3 A;  3E8R A;  2PJT A;  3G5C A;  3LUM A;  4ZR5 A;  3WV3 A;  3F16 A;  3WV2 A;  2N8R A;  4H2E A;  1G49 A;  1CQR A;  4PKT A;  2DW2 A;  1BUV M;  2OW1 A;  5BOT A;  5LAB A;  1YQY A;  2OI0 A;  3EWJ A;  1JAQ A;  3ZXH A;  3NX7 A;  2J0T A;  2A8H A;  1ZXV A;  1SMP A;  2V4B A;  3F1A A;  4WKE A;  2JT6 A;  3I7G A;  3TS4 A;  5I3M A;  1K7I A;  1JAO A;  4H3X A;  1H71 P;  5BOY A;  3LIL A;  1C7K A;  2OXU A;  1HOV A;  3LK8 A;  3K7N A;  4G0D A;  2YIG A;  4H84 A;  1SLN A;  3HBU P;  4EFS A;  1AKL A;  2SRT A;  1QUA A;  5I43 A;  5D7W A;  4ILW D;  1EAK A;  4AYK A;  3WV1 A;  4JQG A;  3OHL A;  1D8M A;  1XFW A;  3KEC A;  1RM8 A;  3LMC A;  1KUI A;  3I7I A;  1Q3A A;  1G9K A;  3EDZ A;  5L7F A;  1AST A;  1JH1 A;  1KUK A;  1GXD A;  1IAA A;  2RJQ A;  3LQ0 A;  3KME A;  3L0T A;  5CXA A;  2D1O A;  3F17 A;  1I1I P;  3KHI A;  1SAT A;  2CLT A;  2AYK A;  3LJT A;  3AYK A;  4XM8 A;  3KEJ A;  2YB9 A;  5B5O A;  2KRJ A;  2OW0 A;  5CZM A;  3LUN A;  3F15 A;  1MMB A;  4WK7 A;  4JP4 A;  3Q2H A;  4ON1 A;  2O3E A;  2POJ A;  4A7B A;  456C A;  4FU4 A;  1ROS A;  2MZE A;  1D8F A;  1XFZ A;  1UEA A;  4PKS A;  2MLS A;  3LGP A;  2OW2 A;  3U1R A;  5I12 A;  3DSL A;  1OS2 A;  2J83 A;  4L6T A;  1K7Q A;  2USN A;  1ZVX A;  5I2Z A;  3HY7 A;  1IAD A;  1R54 A;  3Q2G A;  1G05 A;  3P1V A;  1A86 A;  4H49 A;  1CAQ A;  2OXZ A;  1JAN A;  3LJZ A;  3VI1 A;  1XUC A;  4AIG A;  2OY4 A;  1BKC E;  1IAG A;  2K9C A;  1XUR A;  3HYG A;  1OM7 A;  3BA0 A;  3TVC A;  2FV5 A;  1PWW A;  1IAC A;  3TT4 A;  3B92 A;  1D5J A;  1BKC I;  1Z3J A;  2TCL A;  1JIZ A;  1GO8 P;  1L6J A;  5D3C A;  1JAP A;  1G4K A;  1CK7 A;  4J4M A;  3CKI A;  3AYU A;  2MZI A;  1FBL A;  1Y93 A;  4DPE A;  1CIZ A;  1GKC A;  1BZS A;  4IN9 A;  2X3B A;  4GR8 A;  1SLM A;  2W0D A;  4L19 A; 
#chains in the Genus database with same CATH topology
 1HFC A;  4XBH A;  1YOU A;  4HX3 A;  2Y6D A;  1XFY A;  1ZP5 A;  3LJG A;  1JIW P;  2W13 A;  1Y0V A;  4IJO A;  4JIJ A;  3ZVS A;  3LEA A;  1FM1 A;  3HBV P;  5I4O A;  1MMP A;  1GE5 A;  1MNC A;  2W15 A;  3P24 A;  4QKZ A;  4WF6 A;  3SHI A;  2WO9 A;  5B5P A;  3N2U A;  1MMR A;  3LKA A;  3DPF A;  3G42 A;  1HV5 A;  1R55 A;  2JT5 A;  3RTS A;  1DTH A;  3O64 A;  1OM6 A;  1GE7 A;  3LQB A;  3HDB A;  2DDF A;  1XAX A;  4H30 A;  1XFX A;  5D1T A;  2ERO A;  5BPA A;  1HY7 A;  830C A;  1XFU A;  1S4B P;  2I47 A;  1PWP A;  2O36 A;  2JSD A;  4GF1 A;  4HMA A;  1UTT A;  2WO8 A;  1BM6 A;  1R1J A;  3L0V A;  3USN A;  1UMS A;  3GBO A;  3O2X A;  5H8X A;  2YUF A;  4JA1 A;  4H82 A;  1KUG A;  1K7G A;  1QJJ A;  5D2B A;  3N2V A;  4PKV A;  5L79 A;  4GWN A;  1XFV A;  4GR3 A;  1OM8 A;  2WOA A;  1YP1 A;  1CGL A;  3ZUK A;  2ERP A;  3RTT A;  2MZH A;  2HU6 A;  1CGF A;  1A85 A;  4I03 A;  1QIB A;  1CGE A;  4GQL A;  4XM6 A;  1JKY A;  2D1N A;  2W14 A;  1JK3 A;  1Y8J A;  1UTZ A;  2MLR A;  1OMJ A;  1R1H A;  3VTG A;  2X3A A;  1EB6 A;  2K2G A;  4L63 A;  1XM5 A;  4PKQ A;  1BQO A;  2OVZ A;  1O0Q A;  3MA2 A;  4WKI A;  1ZTQ A;  1AF0 A;  4WZV A;  2XS4 A;  3DNG A;  966C A;  3OHO A;  4Q1L A;  3LIK A;  3UVC A;  2RJP A;  3KWV C;  2DDY A;  1O0T A;  1UMT A;  2DW0 A;  1OZ9 A;  2DW1 A;  4IUW A;  2Y6C A;  4AUO A;  1GO7 P;  1YCM A;  4PKU A;  1IAE A;  3TSK A;  1C8T A;  3HB2 P;  4R3V A;  1QJI A;  1GE6 A;  3HDA P;  5CUH A;  3K7L A;  1IAB A;  1OS9 A;  3EDG A;  3EDI A;  3EHX A;  3HY9 A;  1GKD A;  2XS3 A;  4PKR A;  4CTH A;  4I35 A;  1I76 A;  1ZS0 A;  1G12 A;  2FV9 A;  3KEK A;  5I0L A;  1USN A;  3B8Z A;  2QPJ A;  2W12 A;  1HTD A;  3DPE A;  2JNP A;  1D7X A;  1XUD A;  1I73 A;  1ATL A;  2CKI A;  4PKW A;  4AXQ A;  3EHY A;  2X7M A;  1BKC A;  2JIH A;  1MMQ A;  3V96 B;  2OZR A;  1BQQ M;  3B2Z A;  1QIA A;  4A3W A;  1PWQ A;  3DL1 A;  1DMT A;  1KUH A;  1SRP A;  1WNI A;  1BUD A;  3LIR A;  4DD8 A;  4JPA A;  4XCT A;  4GUY A;  2OY2 A;  4FXQ A;  1ND1 A;  1EUB A;  4GWM A;  1KUF A;  4DV8 A;  2L0R A;  4FXY P;  3KRY A;  4H1Q A;  5JMY A;  3KMC A;  2AIG P;  2OXW A;  1PWU A;  3DTI A;  1FLS A;  1C3I A;  2E3X A;  2E2D A;  3DTK A;  5D1S A;  1KBC A;  1ZXC A;  3DWB A;  3F18 A;  4GR0 A;  1HFS A;  1J7N A;  1RMZ A;  1B3D A;  1PWV A;  3F19 A;  4H76 A;  1CXV A;  2ERQ A;  1OO9 A;  3AIG A;  1BSW A;  4XM7 A;  4DF9 A;  1AYK A;  2X3C A;  1JJ9 A;  3LE9 A;  4FVL A;  1R1I A;  1KAP P;  2OVX A;  1B8Y A;  3ELM A;  4G9L A;  5D1U A;  2OW9 A;  1QIC A;  1BIW A;  3EDH A;  2Z2D A;  1SU3 A;  4L7A A;  3E8R A;  2PJT A;  3G5C A;  3LUM A;  4ZR5 A;  3WV3 A;  3F16 A;  3WV2 A;  2N8R A;  4H2E A;  1G49 A;  1CQR A;  4PKT A;  2DW2 A;  1BUV M;  2OW1 A;  5BOT A;  5LAB A;  1YQY A;  2OI0 A;  3EWJ A;  1JAQ A;  3ZXH A;  3NX7 A;  2J0T A;  2A8H A;  1ZXV A;  1SMP A;  2V4B A;  3F1A A;  4WKE A;  2JT6 A;  3DTE A;  3I7G A;  3TS4 A;  5I3M A;  1K7I A;  1JAO A;  4H3X A;  1H71 P;  5BOY A;  3LIL A;  1C7K A;  2OXU A;  1HOV A;  3LK8 A;  3K7N A;  4G0D A;  2YIG A;  4H84 A;  1SLN A;  3HBU P;  4EFS A;  1AKL A;  2SRT A;  1QUA A;  5I43 A;  5D7W A;  4ILW D;  1EAK A;  4AYK A;  3WV1 A;  4JQG A;  3OHL A;  1D8M A;  1XFW A;  3KEC A;  1RM8 A;  3LMC A;  1KUI A;  3I7I A;  1Q3A A;  1G9K A;  3EDZ A;  5L7F A;  1AST A;  1JH1 A;  1KUK A;  1GXD A;  1IAA A;  2RJQ A;  3LQ0 A;  3KME A;  3L0T A;  5CXA A;  2D1O A;  3F17 A;  1I1I P;  3KHI A;  1SAT A;  2CLT A;  2AYK A;  3LJT A;  3AYK A;  4XM8 A;  3KEJ A;  2YB9 A;  5B5O A;  2KRJ A;  2OW0 A;  5CZM A;  3LUN A;  3F15 A;  1MMB A;  4WK7 A;  4JP4 A;  3Q2H A;  4ON1 A;  2O3E A;  2POJ A;  4A7B A;  456C A;  4FU4 A;  1ROS A;  2MZE A;  1D8F A;  1XFZ A;  1UEA A;  4PKS A;  2MLS A;  3LGP A;  2OW2 A;  3U1R A;  5I12 A;  3DSL A;  1OS2 A;  2J83 A;  4L6T A;  1K7Q A;  2USN A;  1ZVX A;  1TVI A;  5I2Z A;  3HY7 A;  1IAD A;  1R54 A;  3Q2G A;  1G05 A;  3P1V A;  1A86 A;  4H49 A;  1CAQ A;  2OXZ A;  1JAN A;  3LJZ A;  3VI1 A;  1XUC A;  4AIG A;  2OY4 A;  1BKC E;  1IAG A;  2K9C A;  1XUR A;  3HYG A;  1OM7 A;  3BA0 A;  3TVC A;  2FV5 A;  1PWW A;  1IAC A;  3TT4 A;  3B92 A;  1D5J A;  1BKC I;  1Z3J A;  2TCL A;  1JIZ A;  1GO8 P;  1L6J A;  5D3C A;  1JAP A;  1G4K A;  1CK7 A;  4J4M A;  3CKI A;  3AYU A;  2MZI A;  1FBL A;  1Y93 A;  4DPE A;  1CIZ A;  1GKC A;  1BZS A;  4IN9 A;  2X3B A;  4GR8 A;  1SLM A;  2W0D A;  4L19 A; 
#chains in the Genus database with same CATH homology
 1HFC A;  4XBH A;  1YOU A;  4HX3 A;  2Y6D A;  1XFY A;  1ZP5 A;  3LJG A;  1JIW P;  2W13 A;  1Y0V A;  4IJO A;  4JIJ A;  3ZVS A;  3LEA A;  1FM1 A;  3HBV P;  5I4O A;  1MMP A;  1GE5 A;  1MNC A;  2W15 A;  3P24 A;  4QKZ A;  4WF6 A;  3SHI A;  2WO9 A;  5B5P A;  3N2U A;  1MMR A;  3LKA A;  3DPF A;  3G42 A;  1HV5 A;  1R55 A;  2JT5 A;  3RTS A;  1DTH A;  3O64 A;  1OM6 A;  1GE7 A;  3LQB A;  3HDB A;  2DDF A;  4H30 A;  1XFX A;  5D1T A;  2ERO A;  5BPA A;  1HY7 A;  830C A;  1XFU A;  1S4B P;  2I47 A;  1PWP A;  2O36 A;  2JSD A;  4GF1 A;  4HMA A;  1UTT A;  2WO8 A;  1BM6 A;  1R1J A;  3L0V A;  3USN A;  1UMS A;  3GBO A;  3O2X A;  5H8X A;  2YUF A;  4JA1 A;  4H82 A;  1KUG A;  1K7G A;  1QJJ A;  5D2B A;  3N2V A;  4PKV A;  5L79 A;  4GWN A;  1XFV A;  4GR3 A;  1OM8 A;  2WOA A;  1YP1 A;  1CGL A;  3ZUK A;  2ERP A;  3RTT A;  2MZH A;  2HU6 A;  1CGF A;  1A85 A;  4I03 A;  1QIB A;  1CGE A;  4GQL A;  4XM6 A;  1JKY A;  2D1N A;  2W14 A;  1JK3 A;  1Y8J A;  1UTZ A;  2MLR A;  1OMJ A;  1R1H A;  3VTG A;  2X3A A;  1EB6 A;  2K2G A;  4L63 A;  4PKQ A;  1BQO A;  2OVZ A;  1O0Q A;  3MA2 A;  4WKI A;  1ZTQ A;  1AF0 A;  4WZV A;  2XS4 A;  3DNG A;  966C A;  3OHO A;  4Q1L A;  3LIK A;  3UVC A;  2RJP A;  3KWV C;  2DDY A;  1O0T A;  1UMT A;  2DW0 A;  2DW1 A;  4IUW A;  2Y6C A;  4AUO A;  1GO7 P;  1YCM A;  4PKU A;  1IAE A;  3TSK A;  1C8T A;  3HB2 P;  4R3V A;  1QJI A;  1GE6 A;  3HDA P;  5CUH A;  3K7L A;  1IAB A;  1OS9 A;  3EDG A;  3EDI A;  3EHX A;  3HY9 A;  1GKD A;  2XS3 A;  4PKR A;  4CTH A;  4I35 A;  1I76 A;  1ZS0 A;  1G12 A;  2FV9 A;  3KEK A;  5I0L A;  1USN A;  3B8Z A;  2QPJ A;  2W12 A;  1HTD A;  3DPE A;  2JNP A;  1D7X A;  1XUD A;  1I73 A;  1ATL A;  2CKI A;  4PKW A;  4AXQ A;  3EHY A;  2X7M A;  1BKC A;  2JIH A;  1MMQ A;  3V96 B;  2OZR A;  1BQQ M;  3B2Z A;  1QIA A;  4A3W A;  1PWQ A;  3DL1 A;  1DMT A;  1KUH A;  1SRP A;  1WNI A;  1BUD A;  3LIR A;  4DD8 A;  4JPA A;  4XCT A;  4GUY A;  2OY2 A;  4FXQ A;  1ND1 A;  1EUB A;  4GWM A;  1KUF A;  4DV8 A;  2L0R A;  4FXY P;  3KRY A;  4H1Q A;  5JMY A;  3KMC A;  2AIG P;  2OXW A;  1PWU A;  3DTI A;  1FLS A;  1C3I A;  2E3X A;  2E2D A;  3DTK A;  5D1S A;  1KBC A;  1ZXC A;  3DWB A;  3F18 A;  4GR0 A;  1HFS A;  1J7N A;  1RMZ A;  1B3D A;  1PWV A;  3F19 A;  4H76 A;  1CXV A;  2ERQ A;  1OO9 A;  3AIG A;  1BSW A;  4XM7 A;  4DF9 A;  1AYK A;  2X3C A;  1JJ9 A;  3LE9 A;  4FVL A;  1R1I A;  1KAP P;  2OVX A;  1B8Y A;  3ELM A;  4G9L A;  5D1U A;  2OW9 A;  1QIC A;  1BIW A;  3EDH A;  2Z2D A;  1SU3 A;  4L7A A;  3E8R A;  2PJT A;  3G5C A;  3LUM A;  4ZR5 A;  3WV3 A;  3F16 A;  3WV2 A;  2N8R A;  4H2E A;  1G49 A;  1CQR A;  4PKT A;  2DW2 A;  1BUV M;  2OW1 A;  5BOT A;  5LAB A;  1YQY A;  2OI0 A;  3EWJ A;  1JAQ A;  3ZXH A;  3NX7 A;  2J0T A;  2A8H A;  1ZXV A;  1SMP A;  2V4B A;  3F1A A;  4WKE A;  2JT6 A;  3DTE A;  3I7G A;  3TS4 A;  5I3M A;  1K7I A;  1JAO A;  4H3X A;  1H71 P;  5BOY A;  3LIL A;  1C7K A;  2OXU A;  1HOV A;  3LK8 A;  3K7N A;  4G0D A;  2YIG A;  4H84 A;  1SLN A;  3HBU P;  4EFS A;  1AKL A;  2SRT A;  1QUA A;  5I43 A;  5D7W A;  4ILW D;  1EAK A;  4AYK A;  3WV1 A;  4JQG A;  3OHL A;  1D8M A;  1XFW A;  3KEC A;  1RM8 A;  3LMC A;  1KUI A;  3I7I A;  1Q3A A;  1G9K A;  3EDZ A;  5L7F A;  1AST A;  1JH1 A;  1KUK A;  1GXD A;  1IAA A;  2RJQ A;  3LQ0 A;  3KME A;  3L0T A;  5CXA A;  2D1O A;  3F17 A;  1I1I P;  3KHI A;  1SAT A;  2CLT A;  2AYK A;  3LJT A;  3AYK A;  4XM8 A;  3KEJ A;  2YB9 A;  5B5O A;  2KRJ A;  2OW0 A;  5CZM A;  3LUN A;  3F15 A;  1MMB A;  4WK7 A;  4JP4 A;  3Q2H A;  4ON1 A;  2O3E A;  2POJ A;  4A7B A;  456C A;  4FU4 A;  1ROS A;  2MZE A;  1D8F A;  1XFZ A;  1UEA A;  4PKS A;  2MLS A;  3LGP A;  2OW2 A;  3U1R A;  5I12 A;  3DSL A;  1OS2 A;  2J83 A;  4L6T A;  1K7Q A;  2USN A;  1ZVX A;  5I2Z A;  3HY7 A;  1IAD A;  1R54 A;  3Q2G A;  1G05 A;  3P1V A;  1A86 A;  4H49 A;  1CAQ A;  2OXZ A;  1JAN A;  3LJZ A;  3VI1 A;  1XUC A;  4AIG A;  2OY4 A;  1BKC E;  1IAG A;  2K9C A;  1XUR A;  3HYG A;  1OM7 A;  3BA0 A;  3TVC A;  2FV5 A;  1PWW A;  1IAC A;  3TT4 A;  3B92 A;  1D5J A;  1BKC I;  1Z3J A;  2TCL A;  1JIZ A;  1GO8 P;  1L6J A;  5D3C A;  1JAP A;  1G4K A;  1CK7 A;  4J4M A;  3CKI A;  3AYU A;  2MZI A;  1FBL A;  1Y93 A;  4DPE A;  1CIZ A;  1GKC A;  1BZS A;  4IN9 A;  2X3B A;  4GR8 A;  1SLM A;  2W0D A;  4L19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...