1BIWA

Design and synthesis of conformationally-constrained mmp inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
169
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of conformationally-constrained MMP inhibitors.
pubmed doi rcsb
molecule keywords PROTEIN (STROMELYSIN-1 COMPLEX)
molecule tags Hydrolase
source organism Homo sapiens
total genus 46
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1biwA00
3LEAA 3B92A 4AYKA 1CGFA 3KMEA 3ZXHA 1FLSA 1QICA 1OM7A 4A3WA 4PKSA 1ZXCA 2POJA 1MNCA 3L0VA 4Q1LA 1PWUA 1ZXVA 3DL1A 4ILWD 4WKIA 2MLRA 1GE6A 3L0TA 4DV8A 1D8MA 2X3AA 5D2BA 1O0QA 3EHYA 4JIJA 5I0LA 3USNA 1SLMA 1BSWA 1XUCA 3O64A 2K2GA 2XS4A 1FM1A 2DW1A 1XFZA 2O3EA 3LJTA 2DW0A 4IJOA 1JAOA 1H71P 1EB6A 1R55A 1GXDA 4L19A 3WV2A 1S4BP 4JPAA 3DNGA 1ASTA 2AIGP 1IAEA 4JP4A 4L63A 2WO8A 4PKVA 4IUWA 1YQYA 5I12A 2K9CA 1D7XA 2O36A 1UTZA 4XM6A 4G9LA 1MMQA 3KRYA 1B3DA 1KUKA 1QIBA 2OI0A 3N2VA 3GBOA 4GR3A 3AYKA 3LMCA 2W15A 4GF1A 1AYKA 5BPAA 1OM6A 4GUYA 2FV9A 4L6TA 2AYKA 2N8RA 1YOUA 1C8TA 1GKCA 3HB2P 1XURA 1R1IA 2ERPA 3P24A 3SHIA 1FBLA 4JQGA 3ZUKA 2FV5A 3F16A 1KUHA 5JMYA 1A85A 1KUIA 1BM6A 3EDIA 1Q3AA 4DPEA 4GR8A 2W13A 1SLNA 1Z3JA 1QIAA 3V96B 4JA1A 3LQ0A 3WV1A 2OXWA 1MMPA 1C3IA 1OO9A 1XUDA 1PWQA 5D3CA 3EHXA 3P1VA 2MZEA 3HY9A 3HBUP 5D7WA 3LK8A 3LJZA 1BUDA 1RMZA 1CK7A 4I35A 1IABA 1Y0VA 1JJ9A 2RJQA 1ND1A 2W0DA 1BKCI 2OW2A 3UVCA 2J0TA 1I1IP 1SATA 1I73A 2OY4A 4XM8A 1CGEA 1JANA 4HX3A 1KUFA 2WO9A 4H30A 3TVCA 3EDZA 1G9KA 1XFVA 1OM8A 1J7NA 4FXYP 3BA0A 4H82A 3HDAP 3LKAA 4GQLA 2I47A 4H3XA 1BKCE 1IADA 2EROA 1MMBA 1L6JA 1R1JA 2X7MA 1ROSA 3HYGA 3LE9A 4WF6A 1WNIA 1YP1A 2DDFA 1BZSA 3HY7A 3LUNA 3TS4A 1AF0A 1CXVA 4G0DA 1USNA 3KEJA 1AKLA 5LABA 2MZIA 1OS9A 1G12A 1KUGA 5I3MA 1JAPA 1QJIA 3RTSA 3Q2GA 4AUOA 1HOVA 5H8XA 4WKEA 2OXZA 1CGLA 2L0RA 2X3CA 3Q2HA 1BQQM 3LIKA 1JK3A 2USNA 3N2UA 1GO7P 1KAPP 1PWPA 4I03A 1SRPA 2HU6A 1MMRA 2DDYA 1CQRA 4IN9A 2Y6DA 4XBHA 1GO8P 5I43A 1UTTA 5BOYA 5I4OA 4H49A 1XFWA 2OW0A 3U1RA 1UMTA 2J83A 1A86A 5B5PA 3LGPA 1ZTQA 3AIGA 3LIRA 3KEKA 2OXUA 1GE7A 830CA 2WOAA 4ZR5A 4ON1A 2JNPA 1OS2A 2W14A 2YIGA 3OHLA 3B8ZA 5CZMA 1PWVA 4EFSA 4XM7A 2OVXA 4DF9A 1UEAA 1XFXA 4PKTA 5B5OA 2D1OA 3K7NA 1BUVM 3TSKA 4H2EA 4PKUA 4R3VA 1XFUA 2DW2A 1G05A 1G4KA 2PJTA 3EWJA 3KHIA 1HV5A 456CA 4H84A 2MZHA 1K7QA 2E3XA 1CIZA 5I2ZA 1R54A 1SU3A 1D8FA 3DWBA 1B8YA 4PKRA 1EAKA 2JT5A 4CTHA 5D1TA 2SRTA 3KECA 1K7GA 2CKIA 1OMJA 4HMAA 3LILA 2E2DA 4GWMA 2MLSA 1QJJA 2XS3A 4AXQA 4H1QA 1Y93A 3F1AA 3HBVP 4J4MA 2OY2A 2YB9A 4PKWA 2JSDA 4FU4A 1JIWP 3DSLA 4AIGA 1HFSA 3E8RA 4DD8A 1R1HA 5CXAA 3F18A 3DPFA 1JIZA 4GWNA 3AYUA 1K7IA 966CA 1XFYA 2X3BA 3DPEA 1Y8JA 2D1NA 3OHOA 1BQOA 3VI1A 3LJGA 2ERQA 2W12A 4FVLA 1GE5A 5BOTA 2OVZA 3LUMA 2Y6CA 3B2ZA 2Z2DA 3I7GA 3LQBA 3VTGA 3KWVC 1ATLA 3O2XA 1D5JA 1PWWA 1BKCA 1KBCA 3ZVSA 2OW1A 1HFCA 1IAGA 1JAQA 2CLTA 3F19A 3HDBA 4H76A 4WZVA 4QKZA 1BIWA 1UMSA 1ZS0A 1YCMA 1I76A 3F17A 1C7KA 4GR0A 4WK7A 3G42A 3K7LA 2JIHA 2JT6A 3G5CA 1DTHA 4FXQA 2KRJA 1RM8A 1JH1A 1HTDA 3WV3A 3EDHA 5L79A 3KMCA 1IAAA 2QPJA 1JKYA 2RJPA 2TCLA 5D1UA 2V4BA 1DMTA 1QUAA 4XCTA 5D1SA 1CAQA 3CKIA 3TT4A 3F15A 4A7BA 1HY7A 1O0TA 1SMPA 2OZRA 3MA2A 3EDGA 1IACA 1EUBA 3ELMA 2OW9A 5L7FA 1GKDA 3I7IA 1ZP5A 3RTTA 4PKQA 3NX7A 1ZVXA 5CUHA 1G49A 2A8HA
chains in the Genus database with same CATH superfamily
3LEAA 3B92A 4AYKA 1CGFA 3KMEA 4L7AA 1FLSA 3ZXHA 1QICA 1OM7A 4A3WA 4PKSA 1ZXCA 2POJA 1MNCA 3L0VA 4Q1LA 3DTKA 1PWUA 1ZXVA 3DL1A 4ILWD 4WKIA 2MLRA 1GE6A 3L0TA 4DV8A 1D8MA 2X3AA 5D2BA 1O0QA 3EHYA 4JIJA 5I0LA 3USNA 1SLMA 1BSWA 1XUCA 1TVIA 3O64A 2K2GA 2XS4A 1FM1A 2DW1A 1XFZA 2O3EA 3LJTA 2DW0A 1XM5A 4IJOA 1JAOA 1H71P 1EB6A 1R55A 1GXDA 4L19A 3WV2A 1S4BP 4JPAA 3DNGA 1ASTA 2AIGP 1IAEA 4JP4A 4L63A 2WO8A 4PKVA 4IUWA 1YQYA 5I12A 2K9CA 1D7XA 2O36A 1UTZA 4XM6A 4G9LA 1MMQA 3KRYA 1B3DA 1KUKA 1QIBA 2OI0A 3N2VA 3GBOA 4GR3A 3AYKA 3LMCA 2W15A 4GF1A 1AYKA 5BPAA 1OM6A 4GUYA 2FV9A 4L6TA 2AYKA 2N8RA 1YOUA 1C8TA 1GKCA 3HB2P 1XURA 1R1IA 2ERPA 3P24A 3SHIA 1FBLA 4JQGA 3ZUKA 2FV5A 3F16A 1KUHA 5JMYA 1A85A 1KUIA 1BM6A 3EDIA 1Q3AA 4DPEA 4GR8A 2W13A 1SLNA 1Z3JA 1QIAA 3V96B 4JA1A 3LQ0A 3WV1A 2OXWA 1MMPA 1C3IA 1OO9A 1XUDA 1PWQA 5D3CA 3EHXA 3P1VA 3DTEA 2MZEA 3DTIA 3HY9A 3HBUP 5D7WA 3LK8A 3LJZA 1BUDA 1RMZA 1CK7A 4I35A 1IABA 1Y0VA 1JJ9A 2RJQA 1ND1A 2W0DA 1BKCI 2OW2A 3UVCA 2J0TA 1I1IP 1SATA 1I73A 2OY4A 4XM8A 1CGEA 1JANA 4HX3A 1KUFA 2WO9A 4H30A 3TVCA 3EDZA 1G9KA 1XFVA 1OM8A 1J7NA 4FXYP 3BA0A 4H82A 3HDAP 3LKAA 4GQLA 2I47A 4H3XA 1BKCE 1IADA 2EROA 1MMBA 1L6JA 1R1JA 2X7MA 1ROSA 3HYGA 3LE9A 4WF6A 1WNIA 1YP1A 2DDFA 1BZSA 3HY7A 3LUNA 3TS4A 1AF0A 1CXVA 4G0DA 1USNA 3KEJA 1AKLA 5LABA 2MZIA 1OS9A 1G12A 1KUGA 5I3MA 1JAPA 1QJIA 3RTSA 3Q2GA 4AUOA 1HOVA 5H8XA 4WKEA 2OXZA 1CGLA 2L0RA 2X3CA 3Q2HA 1BQQM 3LIKA 1JK3A 2USNA 3N2UA 1GO7P 1KAPP 1PWPA 4I03A 1SRPA 2HU6A 1MMRA 2DDYA 1CQRA 4IN9A 2Y6DA 4XBHA 1GO8P 5I43A 1UTTA 5BOYA 5I4OA 4H49A 1XFWA 2OW0A 3U1RA 1UMTA 2J83A 1A86A 5B5PA 3LGPA 1ZTQA 3AIGA 3LIRA 3KEKA 2OXUA 1GE7A 830CA 2WOAA 4ZR5A 4ON1A 2JNPA 1OS2A 2W14A 2YIGA 3OHLA 3B8ZA 5CZMA 1PWVA 4EFSA 4XM7A 2OVXA 4DF9A 1UEAA 1XFXA 4PKTA 5B5OA 2D1OA 3K7NA 1BUVM 3TSKA 4H2EA 4PKUA 4R3VA 1XFUA 2DW2A 1G05A 1G4KA 2PJTA 3EWJA 3KHIA 1HV5A 456CA 4H84A 2MZHA 1K7QA 2E3XA 1CIZA 5I2ZA 1R54A 1SU3A 1D8FA 3DWBA 1B8YA 4PKRA 1EAKA 2JT5A 4CTHA 5D1TA 2SRTA 3KECA 1K7GA 2CKIA 1OMJA 4HMAA 3LILA 2E2DA 4GWMA 2MLSA 1QJJA 2XS3A 4AXQA 4H1QA 1Y93A 3F1AA 3HBVP 4J4MA 2OY2A 2YB9A 4PKWA 2JSDA 4FU4A 1JIWP 3DSLA 4AIGA 1HFSA 3E8RA 4DD8A 1R1HA 5CXAA 3F18A 3DPFA 1JIZA 4GWNA 3AYUA 1K7IA 966CA 1XFYA 2X3BA 3DPEA 1Y8JA 2D1NA 3OHOA 1BQOA 3VI1A 3LJGA 2ERQA 2W12A 4FVLA 1GE5A 5BOTA 2OVZA 3LUMA 2Y6CA 3B2ZA 2Z2DA 3I7GA 1XAXA 3LQBA 3VTGA 3KWVC 1ATLA 3O2XA 1D5JA 1PWWA 1BKCA 1KBCA 3ZVSA 2OW1A 1HFCA 1IAGA 1JAQA 2CLTA 3F19A 3HDBA 4H76A 4WZVA 4QKZA 1BIWA 1UMSA 1ZS0A 1YCMA 1I76A 3F17A 1C7KA 4GR0A 4WK7A 3G42A 2YUFA 3K7LA 2JIHA 2JT6A 3G5CA 1DTHA 4FXQA 2KRJA 1RM8A 1JH1A 1HTDA 3WV3A 3EDHA 5L79A 3KMCA 1IAAA 2QPJA 1JKYA 2RJPA 2TCLA 5D1UA 2V4BA 1DMTA 1QUAA 4XCTA 5D1SA 1CAQA 3CKIA 3TT4A 3F15A 4A7BA 1HY7A 1O0TA 1SMPA 2OZRA 3MA2A 3EDGA 1IACA 1EUBA 1OZ9A 3ELMA 2OW9A 5L7FA 1GKDA 3I7IA 1ZP5A 3RTTA 4PKQA 3NX7A 1ZVXA 5CUHA 1G49A 2A8HA
chains in the Genus database with same CATH topology
3LEAA 3B92A 4AYKA 1CGFA 3KMEA 4L7AA 1FLSA 3ZXHA 1QICA 1OM7A 4A3WA 4PKSA 1ZXCA 2POJA 1MNCA 3L0VA 4Q1LA 3DTKA 1PWUA 1ZXVA 3DL1A 4ILWD 4WKIA 2MLRA 1GE6A 3L0TA 4DV8A 1D8MA 2X3AA 5D2BA 1O0QA 3EHYA 4JIJA 5I0LA 3USNA 1SLMA 1BSWA 1XUCA 3O64A 2K2GA 2XS4A 1FM1A 2DW1A 1XFZA 2O3EA 3LJTA 2DW0A 4IJOA 1JAOA 1H71P 1EB6A 1R55A 1GXDA 4L19A 3WV2A 1S4BP 4JPAA 3DNGA 1ASTA 2AIGP 1IAEA 4JP4A 4L63A 2WO8A 4PKVA 4IUWA 1YQYA 5I12A 2K9CA 1D7XA 2O36A 1UTZA 4XM6A 4G9LA 1MMQA 3KRYA 1B3DA 1KUKA 1QIBA 2OI0A 3N2VA 3GBOA 4GR3A 3AYKA 3LMCA 2W15A 4GF1A 1AYKA 5BPAA 1OM6A 4GUYA 2FV9A 4L6TA 2AYKA 2N8RA 1YOUA 1C8TA 1GKCA 3HB2P 1XURA 1R1IA 2ERPA 3P24A 3SHIA 1FBLA 4JQGA 3ZUKA 2FV5A 3F16A 1KUHA 5JMYA 1A85A 1KUIA 1BM6A 3EDIA 1Q3AA 4DPEA 4GR8A 2W13A 1SLNA 1Z3JA 1QIAA 3V96B 4JA1A 3LQ0A 3WV1A 2OXWA 1MMPA 1C3IA 1OO9A 1XUDA 1PWQA 5D3CA 3EHXA 3P1VA 3DTEA 2MZEA 3DTIA 3HY9A 3HBUP 5D7WA 3LK8A 3LJZA 1BUDA 1RMZA 1CK7A 4I35A 1IABA 1Y0VA 1JJ9A 2RJQA 1ND1A 2W0DA 1BKCI 2OW2A 3UVCA 2J0TA 1I1IP 1SATA 1I73A 2OY4A 4XM8A 1CGEA 1JANA 4HX3A 1KUFA 2WO9A 4H30A 3TVCA 3EDZA 1G9KA 1XFVA 1OM8A 1J7NA 4FXYP 3BA0A 4H82A 3HDAP 3LKAA 4GQLA 2I47A 4H3XA 1BKCE 1IADA 2EROA 1MMBA 1L6JA 1R1JA 2X7MA 1ROSA 3HYGA 3LE9A 4WF6A 1WNIA 1YP1A 2DDFA 1BZSA 3HY7A 3LUNA 3TS4A 1AF0A 1CXVA 4G0DA 1USNA 3KEJA 1AKLA 5LABA 2MZIA 1OS9A 1G12A 1KUGA 5I3MA 1JAPA 1QJIA 3RTSA 3Q2GA 4AUOA 1HOVA 5H8XA 4WKEA 2OXZA 1CGLA 2L0RA 2X3CA 3Q2HA 1BQQM 3LIKA 1JK3A 2USNA 3N2UA 1GO7P 1KAPP 1PWPA 4I03A 1SRPA 2HU6A 1MMRA 2DDYA 1CQRA 4IN9A 2Y6DA 4XBHA 1GO8P 5I43A 1UTTA 5BOYA 5I4OA 4H49A 1XFWA 2OW0A 3U1RA 1UMTA 2J83A 1A86A 5B5PA 3LGPA 1ZTQA 3AIGA 3LIRA 3KEKA 2OXUA 1GE7A 830CA 2WOAA 4ZR5A 4ON1A 2JNPA 1OS2A 2W14A 2YIGA 3OHLA 3B8ZA 5CZMA 1PWVA 4EFSA 4XM7A 2OVXA 4DF9A 1UEAA 1XFXA 4PKTA 5B5OA 2D1OA 3K7NA 1BUVM 3TSKA 4H2EA 4PKUA 4R3VA 1XFUA 2DW2A 1G05A 1G4KA 2PJTA 3EWJA 3KHIA 1HV5A 456CA 4H84A 2MZHA 1K7QA 2E3XA 1CIZA 5I2ZA 1R54A 1SU3A 1D8FA 3DWBA 1B8YA 4PKRA 1EAKA 2JT5A 4CTHA 5D1TA 2SRTA 3KECA 1K7GA 2CKIA 1OMJA 4HMAA 3LILA 2E2DA 4GWMA 2MLSA 1QJJA 2XS3A 4AXQA 4H1QA 1Y93A 3F1AA 3HBVP 4J4MA 2OY2A 2YB9A 4PKWA 2JSDA 4FU4A 1JIWP 3DSLA 4AIGA 1HFSA 3E8RA 4DD8A 1R1HA 5CXAA 3F18A 3DPFA 1JIZA 4GWNA 3AYUA 1K7IA 966CA 1XFYA 2X3BA 3DPEA 1Y8JA 2D1NA 3OHOA 1BQOA 3VI1A 3LJGA 2ERQA 2W12A 4FVLA 1GE5A 5BOTA 2OVZA 3LUMA 2Y6CA 3B2ZA 2Z2DA 3I7GA 3LQBA 3VTGA 3KWVC 1ATLA 3O2XA 1D5JA 1PWWA 1BKCA 1KBCA 3ZVSA 2OW1A 1HFCA 1IAGA 1JAQA 2CLTA 3F19A 3HDBA 4H76A 4WZVA 4QKZA 1BIWA 1UMSA 1ZS0A 1YCMA 1I76A 3F17A 1C7KA 4GR0A 4WK7A 3G42A 2YUFA 3K7LA 2JIHA 2JT6A 3G5CA 1DTHA 4FXQA 2KRJA 1RM8A 1JH1A 1HTDA 3WV3A 3EDHA 5L79A 3KMCA 1IAAA 2QPJA 1JKYA 2RJPA 2TCLA 5D1UA 2V4BA 1DMTA 1QUAA 4XCTA 5D1SA 1CAQA 3CKIA 3TT4A 3F15A 4A7BA 1HY7A 1O0TA 1SMPA 2OZRA 3MA2A 3EDGA 1IACA 1EUBA 3ELMA 2OW9A 5L7FA 1GKDA 3I7IA 1ZP5A 3RTTA 4PKQA 3NX7A 1ZVXA 5CUHA 1G49A 2A8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEA A;  3B92 A;  4AYK A;  1CGF A;  3KME A;  3ZXH A;  1FLS A;  1QIC A;  1OM7 A;  4A3W A;  4PKS A;  1ZXC A;  2POJ A;  1MNC A;  3L0V A;  4Q1L A;  1PWU A;  1ZXV A;  3DL1 A;  4ILW D;  4WKI A;  2MLR A;  1GE6 A;  3L0T A;  4DV8 A;  1D8M A;  2X3A A;  5D2B A;  1O0Q A;  3EHY A;  4JIJ A;  5I0L A;  3USN A;  1SLM A;  1BSW A;  1XUC A;  3O64 A;  2K2G A;  2XS4 A;  1FM1 A;  2DW1 A;  1XFZ A;  2O3E A;  3LJT A;  2DW0 A;  4IJO A;  1JAO A;  1H71 P;  1EB6 A;  1R55 A;  1GXD A;  4L19 A;  3WV2 A;  1S4B P;  4JPA A;  3DNG A;  1AST A;  2AIG P;  1IAE A;  4JP4 A;  4L63 A;  2WO8 A;  4PKV A;  4IUW A;  1YQY A;  5I12 A;  2K9C A;  1D7X A;  2O36 A;  1UTZ A;  4XM6 A;  4G9L A;  1MMQ A;  3KRY A;  1B3D A;  1KUK A;  1QIB A;  2OI0 A;  3N2V A;  3GBO A;  4GR3 A;  3AYK A;  3LMC A;  2W15 A;  4GF1 A;  1AYK A;  5BPA A;  1OM6 A;  4GUY A;  2FV9 A;  4L6T A;  2AYK A;  2N8R A;  1YOU A;  1C8T A;  1GKC A;  3HB2 P;  1XUR A;  1R1I A;  2ERP A;  3P24 A;  3SHI A;  1FBL A;  4JQG A;  3ZUK A;  2FV5 A;  3F16 A;  1KUH A;  5JMY A;  1A85 A;  1KUI A;  1BM6 A;  3EDI A;  1Q3A A;  4DPE A;  4GR8 A;  2W13 A;  1SLN A;  1Z3J A;  1QIA A;  3V96 B;  4JA1 A;  3LQ0 A;  3WV1 A;  2OXW A;  1MMP A;  1C3I A;  1OO9 A;  1XUD A;  1PWQ A;  5D3C A;  3EHX A;  3P1V A;  2MZE A;  3HY9 A;  3HBU P;  5D7W A;  3LK8 A;  3LJZ A;  1BUD A;  1RMZ A;  1CK7 A;  4I35 A;  1IAB A;  1Y0V A;  1JJ9 A;  2RJQ A;  1ND1 A;  2W0D A;  1BKC I;  2OW2 A;  3UVC A;  2J0T A;  1I1I P;  1SAT A;  1I73 A;  2OY4 A;  4XM8 A;  1CGE A;  1JAN A;  4HX3 A;  1KUF A;  2WO9 A;  4H30 A;  3TVC A;  3EDZ A;  1G9K A;  1XFV A;  1OM8 A;  1J7N A;  4FXY P;  3BA0 A;  4H82 A;  3HDA P;  3LKA A;  4GQL A;  2I47 A;  4H3X A;  1BKC E;  1IAD A;  2ERO A;  1MMB A;  1L6J A;  1R1J A;  2X7M A;  1ROS A;  3HYG A;  3LE9 A;  4WF6 A;  1WNI A;  1YP1 A;  2DDF A;  1BZS A;  3HY7 A;  3LUN A;  3TS4 A;  1AF0 A;  1CXV A;  4G0D A;  1USN A;  3KEJ A;  1AKL A;  5LAB A;  2MZI A;  1OS9 A;  1G12 A;  1KUG A;  5I3M A;  1JAP A;  1QJI A;  3RTS A;  3Q2G A;  4AUO A;  1HOV A;  5H8X A;  4WKE A;  2OXZ A;  1CGL A;  2L0R A;  2X3C A;  3Q2H A;  1BQQ M;  3LIK A;  1JK3 A;  2USN A;  3N2U A;  1GO7 P;  1KAP P;  1PWP A;  4I03 A;  1SRP A;  2HU6 A;  1MMR A;  2DDY A;  1CQR A;  4IN9 A;  2Y6D A;  4XBH A;  1GO8 P;  5I43 A;  1UTT A;  5BOY A;  5I4O A;  4H49 A;  1XFW A;  2OW0 A;  3U1R A;  1UMT A;  2J83 A;  1A86 A;  5B5P A;  3LGP A;  1ZTQ A;  3AIG A;  3LIR A;  3KEK A;  2OXU A;  1GE7 A;  830C A;  2WOA A;  4ZR5 A;  4ON1 A;  2JNP A;  1OS2 A;  2W14 A;  2YIG A;  3OHL A;  3B8Z A;  5CZM A;  1PWV A;  4EFS A;  4XM7 A;  2OVX A;  4DF9 A;  1UEA A;  1XFX A;  4PKT A;  5B5O A;  2D1O A;  3K7N A;  1BUV M;  3TSK A;  4H2E A;  4PKU A;  4R3V A;  1XFU A;  2DW2 A;  1G05 A;  1G4K A;  2PJT A;  3EWJ A;  3KHI A;  1HV5 A;  456C A;  4H84 A;  2MZH A;  1K7Q A;  2E3X A;  1CIZ A;  5I2Z A;  1R54 A;  1SU3 A;  1D8F A;  3DWB A;  1B8Y A;  4PKR A;  1EAK A;  2JT5 A;  4CTH A;  5D1T A;  2SRT A;  3KEC A;  1K7G A;  2CKI A;  1OMJ A;  4HMA A;  3LIL A;  2E2D A;  4GWM A;  2MLS A;  1QJJ A;  2XS3 A;  4AXQ A;  4H1Q A;  1Y93 A;  3F1A A;  3HBV P;  4J4M A;  2OY2 A;  2YB9 A;  4PKW A;  2JSD A;  4FU4 A;  1JIW P;  3DSL A;  4AIG A;  1HFS A;  3E8R A;  4DD8 A;  1R1H A;  5CXA A;  3F18 A;  3DPF A;  1JIZ A;  4GWN A;  3AYU A;  1K7I A;  966C A;  1XFY A;  2X3B A;  3DPE A;  1Y8J A;  2D1N A;  3OHO A;  1BQO A;  3VI1 A;  3LJG A;  2ERQ A;  2W12 A;  4FVL A;  1GE5 A;  5BOT A;  2OVZ A;  3LUM A;  2Y6C A;  3B2Z A;  2Z2D A;  3I7G A;  3LQB A;  3VTG A;  3KWV C;  1ATL A;  3O2X A;  1D5J A;  1PWW A;  1BKC A;  1KBC A;  3ZVS A;  2OW1 A;  1HFC A;  1IAG A;  1JAQ A;  2CLT A;  3F19 A;  3HDB A;  4H76 A;  4WZV A;  4QKZ A;  1BIW A;  1UMS A;  1ZS0 A;  1YCM A;  1I76 A;  3F17 A;  1C7K A;  4GR0 A;  4WK7 A;  3G42 A;  3K7L A;  2JIH A;  2JT6 A;  3G5C A;  1DTH A;  4FXQ A;  2KRJ A;  1RM8 A;  1JH1 A;  1HTD A;  3WV3 A;  3EDH A;  5L79 A;  3KMC A;  1IAA A;  2QPJ A;  1JKY A;  2RJP A;  2TCL A;  5D1U A;  2V4B A;  1DMT A;  1QUA A;  4XCT A;  5D1S A;  1CAQ A;  3CKI A;  3TT4 A;  3F15 A;  4A7B A;  1HY7 A;  1O0T A;  1SMP A;  2OZR A;  3MA2 A;  3EDG A;  1IAC A;  1EUB A;  3ELM A;  2OW9 A;  5L7F A;  1GKD A;  3I7I A;  1ZP5 A;  3RTT A;  4PKQ A;  3NX7 A;  1ZVX A;  5CUH A;  1G49 A;  2A8H A; 
#chains in the Genus database with same CATH topology
 3LEA A;  3B92 A;  4AYK A;  1CGF A;  3KME A;  4L7A A;  1FLS A;  3ZXH A;  1QIC A;  1OM7 A;  4A3W A;  4PKS A;  1ZXC A;  2POJ A;  1MNC A;  3L0V A;  4Q1L A;  3DTK A;  1PWU A;  1ZXV A;  3DL1 A;  4ILW D;  4WKI A;  2MLR A;  1GE6 A;  3L0T A;  4DV8 A;  1D8M A;  2X3A A;  5D2B A;  1O0Q A;  3EHY A;  4JIJ A;  5I0L A;  3USN A;  1SLM A;  1BSW A;  1XUC A;  1TVI A;  3O64 A;  2K2G A;  2XS4 A;  1FM1 A;  2DW1 A;  1XFZ A;  2O3E A;  3LJT A;  2DW0 A;  1XM5 A;  4IJO A;  1JAO A;  1H71 P;  1EB6 A;  1R55 A;  1GXD A;  4L19 A;  3WV2 A;  1S4B P;  4JPA A;  3DNG A;  1AST A;  2AIG P;  1IAE A;  4JP4 A;  4L63 A;  2WO8 A;  4PKV A;  4IUW A;  1YQY A;  5I12 A;  2K9C A;  1D7X A;  2O36 A;  1UTZ A;  4XM6 A;  4G9L A;  1MMQ A;  3KRY A;  1B3D A;  1KUK A;  1QIB A;  2OI0 A;  3N2V A;  3GBO A;  4GR3 A;  3AYK A;  3LMC A;  2W15 A;  4GF1 A;  1AYK A;  5BPA A;  1OM6 A;  4GUY A;  2FV9 A;  4L6T A;  2AYK A;  2N8R A;  1YOU A;  1C8T A;  1GKC A;  3HB2 P;  1XUR A;  1R1I A;  2ERP A;  3P24 A;  3SHI A;  1FBL A;  4JQG A;  3ZUK A;  2FV5 A;  3F16 A;  1KUH A;  5JMY A;  1A85 A;  1KUI A;  1BM6 A;  3EDI A;  1Q3A A;  4DPE A;  4GR8 A;  2W13 A;  1SLN A;  1Z3J A;  1QIA A;  3V96 B;  4JA1 A;  3LQ0 A;  3WV1 A;  2OXW A;  1MMP A;  1C3I A;  1OO9 A;  1XUD A;  1PWQ A;  5D3C A;  3EHX A;  3P1V A;  3DTE A;  2MZE A;  3DTI A;  3HY9 A;  3HBU P;  5D7W A;  3LK8 A;  3LJZ A;  1BUD A;  1RMZ A;  1CK7 A;  4I35 A;  1IAB A;  1Y0V A;  1JJ9 A;  2RJQ A;  1ND1 A;  2W0D A;  1BKC I;  2OW2 A;  3UVC A;  2J0T A;  1I1I P;  1SAT A;  1I73 A;  2OY4 A;  4XM8 A;  1CGE A;  1JAN A;  4HX3 A;  1KUF A;  2WO9 A;  4H30 A;  3TVC A;  3EDZ A;  1G9K A;  1XFV A;  1OM8 A;  1J7N A;  4FXY P;  3BA0 A;  4H82 A;  3HDA P;  3LKA A;  4GQL A;  2I47 A;  4H3X A;  1BKC E;  1IAD A;  2ERO A;  1MMB A;  1L6J A;  1R1J A;  2X7M A;  1ROS A;  3HYG A;  3LE9 A;  4WF6 A;  1WNI A;  1YP1 A;  2DDF A;  1BZS A;  3HY7 A;  3LUN A;  3TS4 A;  1AF0 A;  1CXV A;  4G0D A;  1USN A;  3KEJ A;  1AKL A;  5LAB A;  2MZI A;  1OS9 A;  1G12 A;  1KUG A;  5I3M A;  1JAP A;  1QJI A;  3RTS A;  3Q2G A;  4AUO A;  1HOV A;  5H8X A;  4WKE A;  2OXZ A;  1CGL A;  2L0R A;  2X3C A;  3Q2H A;  1BQQ M;  3LIK A;  1JK3 A;  2USN A;  3N2U A;  1GO7 P;  1KAP P;  1PWP A;  4I03 A;  1SRP A;  2HU6 A;  1MMR A;  2DDY A;  1CQR A;  4IN9 A;  2Y6D A;  4XBH A;  1GO8 P;  5I43 A;  1UTT A;  5BOY A;  5I4O A;  4H49 A;  1XFW A;  2OW0 A;  3U1R A;  1UMT A;  2J83 A;  1A86 A;  5B5P A;  3LGP A;  1ZTQ A;  3AIG A;  3LIR A;  3KEK A;  2OXU A;  1GE7 A;  830C A;  2WOA A;  4ZR5 A;  4ON1 A;  2JNP A;  1OS2 A;  2W14 A;  2YIG A;  3OHL A;  3B8Z A;  5CZM A;  1PWV A;  4EFS A;  4XM7 A;  2OVX A;  4DF9 A;  1UEA A;  1XFX A;  4PKT A;  5B5O A;  2D1O A;  3K7N A;  1BUV M;  3TSK A;  4H2E A;  4PKU A;  4R3V A;  1XFU A;  2DW2 A;  1G05 A;  1G4K A;  2PJT A;  3EWJ A;  3KHI A;  1HV5 A;  456C A;  4H84 A;  2MZH A;  1K7Q A;  2E3X A;  1CIZ A;  5I2Z A;  1R54 A;  1SU3 A;  1D8F A;  3DWB A;  1B8Y A;  4PKR A;  1EAK A;  2JT5 A;  4CTH A;  5D1T A;  2SRT A;  3KEC A;  1K7G A;  2CKI A;  1OMJ A;  4HMA A;  3LIL A;  2E2D A;  4GWM A;  2MLS A;  1QJJ A;  2XS3 A;  4AXQ A;  4H1Q A;  1Y93 A;  3F1A A;  3HBV P;  4J4M A;  2OY2 A;  2YB9 A;  4PKW A;  2JSD A;  4FU4 A;  1JIW P;  3DSL A;  4AIG A;  1HFS A;  3E8R A;  4DD8 A;  1R1H A;  5CXA A;  3F18 A;  3DPF A;  1JIZ A;  4GWN A;  3AYU A;  1K7I A;  966C A;  1XFY A;  2X3B A;  3DPE A;  1Y8J A;  2D1N A;  3OHO A;  1BQO A;  3VI1 A;  3LJG A;  2ERQ A;  2W12 A;  4FVL A;  1GE5 A;  5BOT A;  2OVZ A;  3LUM A;  2Y6C A;  3B2Z A;  2Z2D A;  3I7G A;  1XAX A;  3LQB A;  3VTG A;  3KWV C;  1ATL A;  3O2X A;  1D5J A;  1PWW A;  1BKC A;  1KBC A;  3ZVS A;  2OW1 A;  1HFC A;  1IAG A;  1JAQ A;  2CLT A;  3F19 A;  3HDB A;  4H76 A;  4WZV A;  4QKZ A;  1BIW A;  1UMS A;  1ZS0 A;  1YCM A;  1I76 A;  3F17 A;  1C7K A;  4GR0 A;  4WK7 A;  3G42 A;  2YUF A;  3K7L A;  2JIH A;  2JT6 A;  3G5C A;  1DTH A;  4FXQ A;  2KRJ A;  1RM8 A;  1JH1 A;  1HTD A;  3WV3 A;  3EDH A;  5L79 A;  3KMC A;  1IAA A;  2QPJ A;  1JKY A;  2RJP A;  2TCL A;  5D1U A;  2V4B A;  1DMT A;  1QUA A;  4XCT A;  5D1S A;  1CAQ A;  3CKI A;  3TT4 A;  3F15 A;  4A7B A;  1HY7 A;  1O0T A;  1SMP A;  2OZR A;  3MA2 A;  3EDG A;  1IAC A;  1EUB A;  1OZ9 A;  3ELM A;  2OW9 A;  5L7F A;  1GKD A;  3I7I A;  1ZP5 A;  3RTT A;  4PKQ A;  3NX7 A;  1ZVX A;  5CUH A;  1G49 A;  2A8H A; 
#chains in the Genus database with same CATH homology
 3LEA A;  3B92 A;  4AYK A;  1CGF A;  3KME A;  4L7A A;  1FLS A;  3ZXH A;  1QIC A;  1OM7 A;  4A3W A;  4PKS A;  1ZXC A;  2POJ A;  1MNC A;  3L0V A;  4Q1L A;  3DTK A;  1PWU A;  1ZXV A;  3DL1 A;  4ILW D;  4WKI A;  2MLR A;  1GE6 A;  3L0T A;  4DV8 A;  1D8M A;  2X3A A;  5D2B A;  1O0Q A;  3EHY A;  4JIJ A;  5I0L A;  3USN A;  1SLM A;  1BSW A;  1XUC A;  3O64 A;  2K2G A;  2XS4 A;  1FM1 A;  2DW1 A;  1XFZ A;  2O3E A;  3LJT A;  2DW0 A;  4IJO A;  1JAO A;  1H71 P;  1EB6 A;  1R55 A;  1GXD A;  4L19 A;  3WV2 A;  1S4B P;  4JPA A;  3DNG A;  1AST A;  2AIG P;  1IAE A;  4JP4 A;  4L63 A;  2WO8 A;  4PKV A;  4IUW A;  1YQY A;  5I12 A;  2K9C A;  1D7X A;  2O36 A;  1UTZ A;  4XM6 A;  4G9L A;  1MMQ A;  3KRY A;  1B3D A;  1KUK A;  1QIB A;  2OI0 A;  3N2V A;  3GBO A;  4GR3 A;  3AYK A;  3LMC A;  2W15 A;  4GF1 A;  1AYK A;  5BPA A;  1OM6 A;  4GUY A;  2FV9 A;  4L6T A;  2AYK A;  2N8R A;  1YOU A;  1C8T A;  1GKC A;  3HB2 P;  1XUR A;  1R1I A;  2ERP A;  3P24 A;  3SHI A;  1FBL A;  4JQG A;  3ZUK A;  2FV5 A;  3F16 A;  1KUH A;  5JMY A;  1A85 A;  1KUI A;  1BM6 A;  3EDI A;  1Q3A A;  4DPE A;  4GR8 A;  2W13 A;  1SLN A;  1Z3J A;  1QIA A;  3V96 B;  4JA1 A;  3LQ0 A;  3WV1 A;  2OXW A;  1MMP A;  1C3I A;  1OO9 A;  1XUD A;  1PWQ A;  5D3C A;  3EHX A;  3P1V A;  3DTE A;  2MZE A;  3DTI A;  3HY9 A;  3HBU P;  5D7W A;  3LK8 A;  3LJZ A;  1BUD A;  1RMZ A;  1CK7 A;  4I35 A;  1IAB A;  1Y0V A;  1JJ9 A;  2RJQ A;  1ND1 A;  2W0D A;  1BKC I;  2OW2 A;  3UVC A;  2J0T A;  1I1I P;  1SAT A;  1I73 A;  2OY4 A;  4XM8 A;  1CGE A;  1JAN A;  4HX3 A;  1KUF A;  2WO9 A;  4H30 A;  3TVC A;  3EDZ A;  1G9K A;  1XFV A;  1OM8 A;  1J7N A;  4FXY P;  3BA0 A;  4H82 A;  3HDA P;  3LKA A;  4GQL A;  2I47 A;  4H3X A;  1BKC E;  1IAD A;  2ERO A;  1MMB A;  1L6J A;  1R1J A;  2X7M A;  1ROS A;  3HYG A;  3LE9 A;  4WF6 A;  1WNI A;  1YP1 A;  2DDF A;  1BZS A;  3HY7 A;  3LUN A;  3TS4 A;  1AF0 A;  1CXV A;  4G0D A;  1USN A;  3KEJ A;  1AKL A;  5LAB A;  2MZI A;  1OS9 A;  1G12 A;  1KUG A;  5I3M A;  1JAP A;  1QJI A;  3RTS A;  3Q2G A;  4AUO A;  1HOV A;  5H8X A;  4WKE A;  2OXZ A;  1CGL A;  2L0R A;  2X3C A;  3Q2H A;  1BQQ M;  3LIK A;  1JK3 A;  2USN A;  3N2U A;  1GO7 P;  1KAP P;  1PWP A;  4I03 A;  1SRP A;  2HU6 A;  1MMR A;  2DDY A;  1CQR A;  4IN9 A;  2Y6D A;  4XBH A;  1GO8 P;  5I43 A;  1UTT A;  5BOY A;  5I4O A;  4H49 A;  1XFW A;  2OW0 A;  3U1R A;  1UMT A;  2J83 A;  1A86 A;  5B5P A;  3LGP A;  1ZTQ A;  3AIG A;  3LIR A;  3KEK A;  2OXU A;  1GE7 A;  830C A;  2WOA A;  4ZR5 A;  4ON1 A;  2JNP A;  1OS2 A;  2W14 A;  2YIG A;  3OHL A;  3B8Z A;  5CZM A;  1PWV A;  4EFS A;  4XM7 A;  2OVX A;  4DF9 A;  1UEA A;  1XFX A;  4PKT A;  5B5O A;  2D1O A;  3K7N A;  1BUV M;  3TSK A;  4H2E A;  4PKU A;  4R3V A;  1XFU A;  2DW2 A;  1G05 A;  1G4K A;  2PJT A;  3EWJ A;  3KHI A;  1HV5 A;  456C A;  4H84 A;  2MZH A;  1K7Q A;  2E3X A;  1CIZ A;  5I2Z A;  1R54 A;  1SU3 A;  1D8F A;  3DWB A;  1B8Y A;  4PKR A;  1EAK A;  2JT5 A;  4CTH A;  5D1T A;  2SRT A;  3KEC A;  1K7G A;  2CKI A;  1OMJ A;  4HMA A;  3LIL A;  2E2D A;  4GWM A;  2MLS A;  1QJJ A;  2XS3 A;  4AXQ A;  4H1Q A;  1Y93 A;  3F1A A;  3HBV P;  4J4M A;  2OY2 A;  2YB9 A;  4PKW A;  2JSD A;  4FU4 A;  1JIW P;  3DSL A;  4AIG A;  1HFS A;  3E8R A;  4DD8 A;  1R1H A;  5CXA A;  3F18 A;  3DPF A;  1JIZ A;  4GWN A;  3AYU A;  1K7I A;  966C A;  1XFY A;  2X3B A;  3DPE A;  1Y8J A;  2D1N A;  3OHO A;  1BQO A;  3VI1 A;  3LJG A;  2ERQ A;  2W12 A;  4FVL A;  1GE5 A;  5BOT A;  2OVZ A;  3LUM A;  2Y6C A;  3B2Z A;  2Z2D A;  3I7G A;  3LQB A;  3VTG A;  3KWV C;  1ATL A;  3O2X A;  1D5J A;  1PWW A;  1BKC A;  1KBC A;  3ZVS A;  2OW1 A;  1HFC A;  1IAG A;  1JAQ A;  2CLT A;  3F19 A;  3HDB A;  4H76 A;  4WZV A;  4QKZ A;  1BIW A;  1UMS A;  1ZS0 A;  1YCM A;  1I76 A;  3F17 A;  1C7K A;  4GR0 A;  4WK7 A;  3G42 A;  2YUF A;  3K7L A;  2JIH A;  2JT6 A;  3G5C A;  1DTH A;  4FXQ A;  2KRJ A;  1RM8 A;  1JH1 A;  1HTD A;  3WV3 A;  3EDH A;  5L79 A;  3KMC A;  1IAA A;  2QPJ A;  1JKY A;  2RJP A;  2TCL A;  5D1U A;  2V4B A;  1DMT A;  1QUA A;  4XCT A;  5D1S A;  1CAQ A;  3CKI A;  3TT4 A;  3F15 A;  4A7B A;  1HY7 A;  1O0T A;  1SMP A;  2OZR A;  3MA2 A;  3EDG A;  1IAC A;  1EUB A;  3ELM A;  2OW9 A;  5L7F A;  1GKD A;  3I7I A;  1ZP5 A;  3RTT A;  4PKQ A;  3NX7 A;  1ZVX A;  5CUH A;  1G49 A;  2A8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...