3RTSA

Human mmp-12 catalytic domain in complex with*n*-hydroxy-2-(2-phenylethylsulfonamido)acetamide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Contribution of ligand free energy of solvation to design new potent MMPs inhibitors.
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3rtsA00
1L6JA 3DL1A 4GR3A 4PKWA 2EROA 1A85A 1UTTA 3HBVP 2X7MA 1JIWP 4L19A 1GO7P 1EB6A 4H49A 2WO8A 5BOYA 2OXUA 1USNA 3EWJA 1C8TA 1CK7A 1G9KA 2WO9A 5I2ZA 3LJGA 1IADA 1GXDA 2OY4A 4XM8A 2RJPA 1R55A 1BIWA 2XS4A 3LKAA 1Z3JA 1SLMA 4XM6A 1QUAA 2O3EA 1OO9A 2YIGA 1JKYA 1HFSA 4H84A 4AYKA 3EDHA 1GE7A 2JIHA 3E8RA 3K7LA 1MMPA 3KMEA 4GR0A 4ON1A 3EHXA 2TCLA 1QIBA 1OM7A 1CGEA 3DSLA 3HY9A 3LGPA 4H1QA 2DW0A 2AYKA 2DW1A 3ELMA 1KBCA 1I73A 2Z2DA 4GWMA 2DDFA 1XFUA 1IACA 3Q2GA 3LIKA 1MMRA 1CGFA 2E3XA 1IABA 1G12A 3LEAA 4L63A 1FBLA 5I3MA 3TS4A 1JK3A 1UTZA 4HX3A 4XCTA 4DF9A 1KUKA 3NX7A 1KUFA 1GE6A 3F15A 1ND1A 1HY7A 5D2BA 1ATLA 1Y8JA 3KECA 3L0TA 1KUIA 1MNCA 2CLTA 2DDYA 1AYKA 2PJTA 2D1NA 3KWVC 2Y6CA 2L0RA 2OVXA 3LIRA 4WZVA 1JAPA 3V96B 5L79A 3EDZA 1IAGA 2OVZA 1D5JA 1UMTA 3DNGA 4GR8A 5D1UA 1GKCA 1C3IA 1BKCA 3ZUKA 1GE5A 4FVLA 3F17A 4GF1A 2MLRA 4A7BA 1K7GA 1BUVM 5D3CA 1B8YA 1EAKA 1CIZA 1XFXA 1HFCA 2K2GA 2K9CA 2OXWA 2MZEA 3WV2A 3TVCA 3LQBA 4CTHA 3EDGA 3VI1A 1OMJA 2RJQA 4AUOA 3F18A 1G49A 3ZXHA 4PKQA 3HY7A 4PKUA 1HTDA 5D1TA 2N8RA 1XFWA 5CZMA 2JNPA 3EDIA 2OXZA 4PKTA 1UEAA 2POJA 1PWPA 1XFZA 3LMCA 1AF0A 2D1OA 1XUDA 1CGLA 1QJJA 1K7QA 1K7IA 1ZVXA 3LUMA 1RMZA 2J83A 2JT6A 2HU6A 1I76A 5B5PA 1BKCE 3GBOA 4AXQA 2DW2A 3MA2A 1HOVA 3I7IA 4FU4A 1SLNA 3ZVSA 3CKIA 1R1HA 1OS2A 3AIGA 5BPAA 3B2ZA 4JQGA 1HV5A 4GWNA 1G4KA 1DMTA 1FM1A 1D8FA 2OW1A 3F1AA 1MMQA 3KMCA 1BZSA 2JT5A 2W12A 1QJIA 3LUNA 2O36A 4Q1LA 1KUHA 1J7NA 1XURA 2OW0A 1ZTQA 4WKIA 1ZXCA 1GKDA 2X3AA 1Y93A 3HDBA 2FV9A 1AKLA 3Q2HA 1CAQA 4H3XA 5B5OA 4HMAA 4JPAA 3LK8A 4H30A 5H8XA 3KHIA 1EUBA 1UMSA 1RM8A 4DD8A 1JIZA 1R1JA 4DPEA 3USNA 1R1IA 3RTSA 3KEJA 3N2VA 1QIAA 4L6TA 4IUWA 4WKEA 3AYUA 5I4OA 1BQOA 1O0TA 1ASTA 1IAEA 3G42A 3B8ZA 1YP1A 1YOUA 3BA0A 3O2XA 4I35A 1CQRA 3WV1A 1PWQA 3P24A 3I7GA 3F16A 4FXQA 3HYGA 1O0QA 1MMBA 3KRYA 2OI0A 5BOTA 2OY2A 2J0TA 456CA 1FLSA 1OM6A 1G05A 3F19A 3HDAP 1D7XA 3LILA 4A3WA 3OHLA 1XUCA 1JAOA 1BM6A 1IAAA 3LJZA 1A86A 3N2UA 1PWWA 1KUGA 1JAQA 1JJ9A 5D1SA 4JP4A 2AIGP 1JANA 2JSDA 3L0VA 2X3CA 1BSWA 1QICA 3LJTA 2KRJA 4H2EA 1BQQM 4GUYA 1XFVA 4PKRA 4PKVA 830CA 3DWBA 2W15A 1YCMA 3UVCA 3WV3A 4ILWD 1ZP5A 3DPFA 3O64A 1SATA 3EHYA 2I47A 3K7NA 1DTHA 1XFYA 1D8MA 3RTTA 1OM8A 5CUHA 4H82A 1Y0VA 2A8HA 3U1RA 3TSKA 966CA 5L7FA 3KEKA 4DV8A 4JA1A 2XS3A 5JMYA 1PWUA 4WK7A 3DPEA 3LQ0A 4IN9A 1R54A 3OHOA 2W13A 1B3DA 4R3VA 2V4BA 1I1IP 4IJOA 2USNA 2OW2A 5CXAA 1ZXVA 1OS9A 1ZS0A 1BKCI 5LABA 2MZHA 2Y6DA 4I03A 2OZRA 1Q3AA 4AIGA 4QKZA 1SMPA 2W14A 3TT4A 1H71P 2QPJA 4G9LA 4XBHA 5I0LA 1C7KA 5I43A 3B92A 4GQLA 4WF6A 3LE9A 2SRTA 1SRPA 3HB2P 2CKIA 5I12A 1YQYA 3VTGA 3G5CA 4ZR5A 4FXYP 2WOAA 2OW9A 2MZIA 4H76A 2ERQA 4J4MA 4XM7A 1SU3A 3SHIA 2MLSA 1KAPP 1PWVA 3HBUP 2X3BA 2E2DA 1JH1A 5D7WA 2W0DA 1CXVA 1BUDA 3P1VA 1WNIA 4G0DA 3AYKA 1ROSA 4JIJA 2FV5A 1GO8P 4PKSA 2ERPA 4EFSA 2YB9A 1S4BP
chains in the Genus database with same CATH superfamily
1L6JA 3DL1A 4GR3A 4PKWA 2EROA 1A85A 1UTTA 3HBVP 2X7MA 1JIWP 4L19A 1GO7P 1EB6A 4H49A 2WO8A 5BOYA 2OXUA 1USNA 3EWJA 1C8TA 1CK7A 1G9KA 2WO9A 5I2ZA 3LJGA 1IADA 1GXDA 2OY4A 4XM8A 2RJPA 1R55A 1BIWA 2XS4A 3LKAA 1Z3JA 1SLMA 4XM6A 1QUAA 2O3EA 1OO9A 2YIGA 1JKYA 1HFSA 4H84A 4AYKA 2YUFA 3EDHA 1GE7A 2JIHA 3E8RA 3K7LA 1MMPA 3KMEA 4GR0A 4ON1A 3EHXA 2TCLA 1QIBA 1OM7A 1CGEA 3DSLA 3HY9A 3LGPA 4H1QA 2DW0A 2AYKA 2DW1A 3ELMA 1KBCA 1I73A 2Z2DA 4GWMA 2DDFA 1XFUA 1IACA 3Q2GA 3LIKA 1MMRA 1CGFA 2E3XA 1IABA 1G12A 3LEAA 4L63A 1FBLA 5I3MA 3TS4A 1JK3A 1UTZA 4HX3A 4XCTA 4DF9A 1TVIA 1KUKA 3NX7A 1KUFA 1GE6A 3F15A 1ND1A 3DTIA 1HY7A 5D2BA 1ATLA 1Y8JA 3KECA 3L0TA 1KUIA 1MNCA 2CLTA 2DDYA 1AYKA 2PJTA 2D1NA 3KWVC 2Y6CA 2L0RA 2OVXA 3LIRA 4WZVA 1JAPA 3V96B 5L79A 3EDZA 1IAGA 2OVZA 1D5JA 1UMTA 3DNGA 4GR8A 5D1UA 1GKCA 1C3IA 1BKCA 3ZUKA 1GE5A 4FVLA 3F17A 4GF1A 2MLRA 4A7BA 1K7GA 1BUVM 5D3CA 1B8YA 1EAKA 1CIZA 1XFXA 1HFCA 2K2GA 2K9CA 2OXWA 2MZEA 3WV2A 3TVCA 3LQBA 4CTHA 3EDGA 3VI1A 1OMJA 2RJQA 4AUOA 3F18A 1G49A 3ZXHA 4PKQA 3HY7A 4PKUA 1HTDA 5D1TA 2N8RA 1XM5A 1XFWA 5CZMA 2JNPA 3EDIA 2OXZA 4PKTA 1UEAA 2POJA 1PWPA 1XFZA 3LMCA 1AF0A 2D1OA 1XUDA 1CGLA 1QJJA 1K7QA 1K7IA 1ZVXA 3LUMA 1RMZA 2J83A 2JT6A 2HU6A 1I76A 5B5PA 1BKCE 3GBOA 4AXQA 2DW2A 3MA2A 1HOVA 3I7IA 4FU4A 1SLNA 3ZVSA 3CKIA 1R1HA 1OS2A 3AIGA 5BPAA 3B2ZA 4JQGA 1HV5A 4GWNA 1G4KA 1DMTA 1FM1A 1D8FA 2OW1A 3F1AA 1MMQA 3KMCA 1BZSA 2JT5A 2W12A 1QJIA 3LUNA 2O36A 4Q1LA 1KUHA 1J7NA 1XURA 2OW0A 1ZTQA 4WKIA 1ZXCA 1GKDA 1OZ9A 2X3AA 1Y93A 3HDBA 2FV9A 1AKLA 3Q2HA 1CAQA 4H3XA 5B5OA 4HMAA 4JPAA 3LK8A 4H30A 5H8XA 3KHIA 1EUBA 1UMSA 1RM8A 4DD8A 1JIZA 1R1JA 4DPEA 3USNA 1R1IA 3RTSA 3KEJA 3N2VA 1QIAA 4L6TA 4IUWA 4WKEA 3AYUA 5I4OA 1BQOA 1O0TA 1ASTA 1IAEA 3G42A 3B8ZA 1YP1A 1YOUA 3BA0A 3O2XA 4I35A 1CQRA 3WV1A 1PWQA 3P24A 3I7GA 3F16A 4FXQA 3HYGA 1O0QA 1MMBA 3KRYA 2OI0A 5BOTA 2OY2A 2J0TA 456CA 1FLSA 1OM6A 1G05A 3F19A 3HDAP 1D7XA 3LILA 4A3WA 3OHLA 1XUCA 1JAOA 1BM6A 1IAAA 3LJZA 1A86A 3N2UA 1PWWA 1KUGA 1JAQA 4L7AA 1JJ9A 5D1SA 4JP4A 2AIGP 1JANA 2JSDA 3L0VA 2X3CA 1BSWA 1QICA 3LJTA 2KRJA 4H2EA 1BQQM 4GUYA 1XFVA 4PKRA 4PKVA 830CA 3DWBA 2W15A 1YCMA 3UVCA 3WV3A 4ILWD 1ZP5A 3DPFA 3O64A 1SATA 3EHYA 2I47A 3K7NA 1DTHA 1XFYA 1D8MA 3RTTA 1OM8A 5CUHA 4H82A 1Y0VA 2A8HA 3U1RA 3TSKA 966CA 5L7FA 3KEKA 4DV8A 4JA1A 2XS3A 5JMYA 1PWUA 4WK7A 3DPEA 3LQ0A 4IN9A 1R54A 3OHOA 2W13A 1B3DA 4R3VA 2V4BA 1I1IP 4IJOA 3DTEA 2USNA 2OW2A 5CXAA 1ZXVA 1OS9A 1ZS0A 1BKCI 5LABA 2MZHA 2Y6DA 4I03A 2OZRA 1Q3AA 4AIGA 4QKZA 1SMPA 2W14A 3TT4A 1H71P 2QPJA 4G9LA 4XBHA 5I0LA 1C7KA 5I43A 3B92A 4GQLA 4WF6A 3LE9A 2SRTA 1SRPA 3HB2P 2CKIA 5I12A 1YQYA 3DTKA 3VTGA 3G5CA 4ZR5A 4FXYP 2WOAA 2OW9A 2MZIA 4H76A 2ERQA 4J4MA 4XM7A 1SU3A 3SHIA 2MLSA 1KAPP 1PWVA 3HBUP 2X3BA 2E2DA 1JH1A 5D7WA 2W0DA 1CXVA 1XAXA 1BUDA 3P1VA 1WNIA 4G0DA 3AYKA 1ROSA 4JIJA 2FV5A 1GO8P 4PKSA 2ERPA 4EFSA 2YB9A 1S4BP
chains in the Genus database with same CATH topology
1L6JA 3DL1A 4GR3A 4PKWA 2EROA 1A85A 1UTTA 3HBVP 2X7MA 1JIWP 4L19A 1GO7P 1EB6A 4H49A 2WO8A 5BOYA 2OXUA 1USNA 3EWJA 1C8TA 1CK7A 1G9KA 2WO9A 5I2ZA 3LJGA 1IADA 1GXDA 2OY4A 4XM8A 2RJPA 1R55A 1BIWA 2XS4A 3LKAA 1Z3JA 1SLMA 4XM6A 1QUAA 2O3EA 1OO9A 2YIGA 1JKYA 1HFSA 4H84A 4AYKA 2YUFA 3EDHA 1GE7A 2JIHA 3E8RA 3K7LA 1MMPA 3KMEA 4GR0A 4ON1A 3EHXA 2TCLA 1QIBA 1OM7A 1CGEA 3DSLA 3HY9A 3LGPA 4H1QA 2DW0A 2AYKA 2DW1A 3ELMA 1KBCA 1I73A 2Z2DA 4GWMA 2DDFA 1XFUA 1IACA 3Q2GA 3LIKA 1MMRA 1CGFA 2E3XA 1IABA 1G12A 3LEAA 4L63A 1FBLA 5I3MA 3TS4A 1JK3A 1UTZA 4HX3A 4XCTA 4DF9A 1KUKA 3NX7A 1KUFA 1GE6A 3F15A 1ND1A 3DTIA 1HY7A 5D2BA 1ATLA 1Y8JA 3KECA 3L0TA 1KUIA 1MNCA 2CLTA 2DDYA 1AYKA 2PJTA 2D1NA 3KWVC 2Y6CA 2L0RA 2OVXA 3LIRA 4WZVA 1JAPA 3V96B 5L79A 3EDZA 1IAGA 2OVZA 1D5JA 1UMTA 3DNGA 4GR8A 5D1UA 1GKCA 1C3IA 1BKCA 3ZUKA 1GE5A 4FVLA 3F17A 4GF1A 2MLRA 4A7BA 1K7GA 1BUVM 5D3CA 1B8YA 1EAKA 1CIZA 1XFXA 1HFCA 2K2GA 2K9CA 2OXWA 2MZEA 3WV2A 3TVCA 3LQBA 4CTHA 3EDGA 3VI1A 1OMJA 2RJQA 4AUOA 3F18A 1G49A 3ZXHA 4PKQA 3HY7A 4PKUA 1HTDA 5D1TA 2N8RA 1XFWA 5CZMA 2JNPA 3EDIA 2OXZA 4PKTA 1UEAA 2POJA 1PWPA 1XFZA 3LMCA 1AF0A 2D1OA 1XUDA 1CGLA 1QJJA 1K7QA 1K7IA 1ZVXA 3LUMA 1RMZA 2J83A 2JT6A 2HU6A 1I76A 5B5PA 1BKCE 3GBOA 4AXQA 2DW2A 3MA2A 1HOVA 3I7IA 4FU4A 1SLNA 3ZVSA 3CKIA 1R1HA 1OS2A 3AIGA 5BPAA 3B2ZA 4JQGA 1HV5A 4GWNA 1G4KA 1DMTA 1FM1A 1D8FA 2OW1A 3F1AA 1MMQA 3KMCA 1BZSA 2JT5A 2W12A 1QJIA 3LUNA 2O36A 4Q1LA 1KUHA 1J7NA 1XURA 2OW0A 1ZTQA 4WKIA 1ZXCA 1GKDA 2X3AA 1Y93A 3HDBA 2FV9A 1AKLA 3Q2HA 1CAQA 4H3XA 5B5OA 4HMAA 4JPAA 3LK8A 4H30A 5H8XA 3KHIA 1EUBA 1UMSA 1RM8A 4DD8A 1JIZA 1R1JA 4DPEA 3USNA 1R1IA 3RTSA 3KEJA 3N2VA 1QIAA 4L6TA 4IUWA 4WKEA 3AYUA 5I4OA 1BQOA 1O0TA 1ASTA 1IAEA 3G42A 3B8ZA 1YP1A 1YOUA 3BA0A 3O2XA 4I35A 1CQRA 3WV1A 1PWQA 3P24A 3I7GA 3F16A 4FXQA 3HYGA 1O0QA 1MMBA 3KRYA 2OI0A 5BOTA 2OY2A 2J0TA 456CA 1FLSA 1OM6A 1G05A 3F19A 3HDAP 1D7XA 3LILA 4A3WA 3OHLA 1XUCA 1JAOA 1BM6A 1IAAA 3LJZA 1A86A 3N2UA 1PWWA 1KUGA 1JAQA 4L7AA 1JJ9A 5D1SA 4JP4A 2AIGP 1JANA 2JSDA 3L0VA 2X3CA 1BSWA 1QICA 3LJTA 2KRJA 4H2EA 1BQQM 4GUYA 1XFVA 4PKRA 4PKVA 830CA 3DWBA 2W15A 1YCMA 3UVCA 3WV3A 4ILWD 1ZP5A 3DPFA 3O64A 1SATA 3EHYA 2I47A 3K7NA 1DTHA 1XFYA 1D8MA 3RTTA 1OM8A 5CUHA 4H82A 1Y0VA 2A8HA 3U1RA 3TSKA 966CA 5L7FA 3KEKA 4DV8A 4JA1A 2XS3A 5JMYA 1PWUA 4WK7A 3DPEA 3LQ0A 4IN9A 1R54A 3OHOA 2W13A 1B3DA 4R3VA 2V4BA 1I1IP 4IJOA 3DTEA 2USNA 2OW2A 5CXAA 1ZXVA 1OS9A 1ZS0A 1BKCI 5LABA 2MZHA 2Y6DA 4I03A 2OZRA 1Q3AA 4AIGA 4QKZA 1SMPA 2W14A 3TT4A 1H71P 2QPJA 4G9LA 4XBHA 5I0LA 1C7KA 5I43A 3B92A 4GQLA 4WF6A 3LE9A 2SRTA 1SRPA 3HB2P 2CKIA 5I12A 1YQYA 3DTKA 3VTGA 3G5CA 4ZR5A 4FXYP 2WOAA 2OW9A 2MZIA 4H76A 2ERQA 4J4MA 4XM7A 1SU3A 3SHIA 2MLSA 1KAPP 1PWVA 3HBUP 2X3BA 2E2DA 1JH1A 5D7WA 2W0DA 1CXVA 1BUDA 3P1VA 1WNIA 4G0DA 3AYKA 1ROSA 4JIJA 2FV5A 1GO8P 4PKSA 2ERPA 4EFSA 2YB9A 1S4BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6J A;  3DL1 A;  4GR3 A;  4PKW A;  2ERO A;  1A85 A;  1UTT A;  3HBV P;  2X7M A;  1JIW P;  4L19 A;  1GO7 P;  1EB6 A;  4H49 A;  2WO8 A;  5BOY A;  2OXU A;  1USN A;  3EWJ A;  1C8T A;  1CK7 A;  1G9K A;  2WO9 A;  5I2Z A;  3LJG A;  1IAD A;  1GXD A;  2OY4 A;  4XM8 A;  2RJP A;  1R55 A;  1BIW A;  2XS4 A;  3LKA A;  1Z3J A;  1SLM A;  4XM6 A;  1QUA A;  2O3E A;  1OO9 A;  2YIG A;  1JKY A;  1HFS A;  4H84 A;  4AYK A;  3EDH A;  1GE7 A;  2JIH A;  3E8R A;  3K7L A;  1MMP A;  3KME A;  4GR0 A;  4ON1 A;  3EHX A;  2TCL A;  1QIB A;  1OM7 A;  1CGE A;  3DSL A;  3HY9 A;  3LGP A;  4H1Q A;  2DW0 A;  2AYK A;  2DW1 A;  3ELM A;  1KBC A;  1I73 A;  2Z2D A;  4GWM A;  2DDF A;  1XFU A;  1IAC A;  3Q2G A;  3LIK A;  1MMR A;  1CGF A;  2E3X A;  1IAB A;  1G12 A;  3LEA A;  4L63 A;  1FBL A;  5I3M A;  3TS4 A;  1JK3 A;  1UTZ A;  4HX3 A;  4XCT A;  4DF9 A;  1KUK A;  3NX7 A;  1KUF A;  1GE6 A;  3F15 A;  1ND1 A;  1HY7 A;  5D2B A;  1ATL A;  1Y8J A;  3KEC A;  3L0T A;  1KUI A;  1MNC A;  2CLT A;  2DDY A;  1AYK A;  2PJT A;  2D1N A;  3KWV C;  2Y6C A;  2L0R A;  2OVX A;  3LIR A;  4WZV A;  1JAP A;  3V96 B;  5L79 A;  3EDZ A;  1IAG A;  2OVZ A;  1D5J A;  1UMT A;  3DNG A;  4GR8 A;  5D1U A;  1GKC A;  1C3I A;  1BKC A;  3ZUK A;  1GE5 A;  4FVL A;  3F17 A;  4GF1 A;  2MLR A;  4A7B A;  1K7G A;  1BUV M;  5D3C A;  1B8Y A;  1EAK A;  1CIZ A;  1XFX A;  1HFC A;  2K2G A;  2K9C A;  2OXW A;  2MZE A;  3WV2 A;  3TVC A;  3LQB A;  4CTH A;  3EDG A;  3VI1 A;  1OMJ A;  2RJQ A;  4AUO A;  3F18 A;  1G49 A;  3ZXH A;  4PKQ A;  3HY7 A;  4PKU A;  1HTD A;  5D1T A;  2N8R A;  1XFW A;  5CZM A;  2JNP A;  3EDI A;  2OXZ A;  4PKT A;  1UEA A;  2POJ A;  1PWP A;  1XFZ A;  3LMC A;  1AF0 A;  2D1O A;  1XUD A;  1CGL A;  1QJJ A;  1K7Q A;  1K7I A;  1ZVX A;  3LUM A;  1RMZ A;  2J83 A;  2JT6 A;  2HU6 A;  1I76 A;  5B5P A;  1BKC E;  3GBO A;  4AXQ A;  2DW2 A;  3MA2 A;  1HOV A;  3I7I A;  4FU4 A;  1SLN A;  3ZVS A;  3CKI A;  1R1H A;  1OS2 A;  3AIG A;  5BPA A;  3B2Z A;  4JQG A;  1HV5 A;  4GWN A;  1G4K A;  1DMT A;  1FM1 A;  1D8F A;  2OW1 A;  3F1A A;  1MMQ A;  3KMC A;  1BZS A;  2JT5 A;  2W12 A;  1QJI A;  3LUN A;  2O36 A;  4Q1L A;  1KUH A;  1J7N A;  1XUR A;  2OW0 A;  1ZTQ A;  4WKI A;  1ZXC A;  1GKD A;  2X3A A;  1Y93 A;  3HDB A;  2FV9 A;  1AKL A;  3Q2H A;  1CAQ A;  4H3X A;  5B5O A;  4HMA A;  4JPA A;  3LK8 A;  4H30 A;  5H8X A;  3KHI A;  1EUB A;  1UMS A;  1RM8 A;  4DD8 A;  1JIZ A;  1R1J A;  4DPE A;  3USN A;  1R1I A;  3RTS A;  3KEJ A;  3N2V A;  1QIA A;  4L6T A;  4IUW A;  4WKE A;  3AYU A;  5I4O A;  1BQO A;  1O0T A;  1AST A;  1IAE A;  3G42 A;  3B8Z A;  1YP1 A;  1YOU A;  3BA0 A;  3O2X A;  4I35 A;  1CQR A;  3WV1 A;  1PWQ A;  3P24 A;  3I7G A;  3F16 A;  4FXQ A;  3HYG A;  1O0Q A;  1MMB A;  3KRY A;  2OI0 A;  5BOT A;  2OY2 A;  2J0T A;  456C A;  1FLS A;  1OM6 A;  1G05 A;  3F19 A;  3HDA P;  1D7X A;  3LIL A;  4A3W A;  3OHL A;  1XUC A;  1JAO A;  1BM6 A;  1IAA A;  3LJZ A;  1A86 A;  3N2U A;  1PWW A;  1KUG A;  1JAQ A;  1JJ9 A;  5D1S A;  4JP4 A;  2AIG P;  1JAN A;  2JSD A;  3L0V A;  2X3C A;  1BSW A;  1QIC A;  3LJT A;  2KRJ A;  4H2E A;  1BQQ M;  4GUY A;  1XFV A;  4PKR A;  4PKV A;  830C A;  3DWB A;  2W15 A;  1YCM A;  3UVC A;  3WV3 A;  4ILW D;  1ZP5 A;  3DPF A;  3O64 A;  1SAT A;  3EHY A;  2I47 A;  3K7N A;  1DTH A;  1XFY A;  1D8M A;  3RTT A;  1OM8 A;  5CUH A;  4H82 A;  1Y0V A;  2A8H A;  3U1R A;  3TSK A;  966C A;  5L7F A;  3KEK A;  4DV8 A;  4JA1 A;  2XS3 A;  5JMY A;  1PWU A;  4WK7 A;  3DPE A;  3LQ0 A;  4IN9 A;  1R54 A;  3OHO A;  2W13 A;  1B3D A;  4R3V A;  2V4B A;  1I1I P;  4IJO A;  2USN A;  2OW2 A;  5CXA A;  1ZXV A;  1OS9 A;  1ZS0 A;  1BKC I;  5LAB A;  2MZH A;  2Y6D A;  4I03 A;  2OZR A;  1Q3A A;  4AIG A;  4QKZ A;  1SMP A;  2W14 A;  3TT4 A;  1H71 P;  2QPJ A;  4G9L A;  4XBH A;  5I0L A;  1C7K A;  5I43 A;  3B92 A;  4GQL A;  4WF6 A;  3LE9 A;  2SRT A;  1SRP A;  3HB2 P;  2CKI A;  5I12 A;  1YQY A;  3VTG A;  3G5C A;  4ZR5 A;  4FXY P;  2WOA A;  2OW9 A;  2MZI A;  4H76 A;  2ERQ A;  4J4M A;  4XM7 A;  1SU3 A;  3SHI A;  2MLS A;  1KAP P;  1PWV A;  3HBU P;  2X3B A;  2E2D A;  1JH1 A;  5D7W A;  2W0D A;  1CXV A;  1BUD A;  3P1V A;  1WNI A;  4G0D A;  3AYK A;  1ROS A;  4JIJ A;  2FV5 A;  1GO8 P;  4PKS A;  2ERP A;  4EFS A;  2YB9 A;  1S4B P; 
#chains in the Genus database with same CATH topology
 1L6J A;  3DL1 A;  4GR3 A;  4PKW A;  2ERO A;  1A85 A;  1UTT A;  3HBV P;  2X7M A;  1JIW P;  4L19 A;  1GO7 P;  1EB6 A;  4H49 A;  2WO8 A;  5BOY A;  2OXU A;  1USN A;  3EWJ A;  1C8T A;  1CK7 A;  1G9K A;  2WO9 A;  5I2Z A;  3LJG A;  1IAD A;  1GXD A;  2OY4 A;  4XM8 A;  2RJP A;  1R55 A;  1BIW A;  2XS4 A;  3LKA A;  1Z3J A;  1SLM A;  4XM6 A;  1QUA A;  2O3E A;  1OO9 A;  2YIG A;  1JKY A;  1HFS A;  4H84 A;  4AYK A;  2YUF A;  3EDH A;  1GE7 A;  2JIH A;  3E8R A;  3K7L A;  1MMP A;  3KME A;  4GR0 A;  4ON1 A;  3EHX A;  2TCL A;  1QIB A;  1OM7 A;  1CGE A;  3DSL A;  3HY9 A;  3LGP A;  4H1Q A;  2DW0 A;  2AYK A;  2DW1 A;  3ELM A;  1KBC A;  1I73 A;  2Z2D A;  4GWM A;  2DDF A;  1XFU A;  1IAC A;  3Q2G A;  3LIK A;  1MMR A;  1CGF A;  2E3X A;  1IAB A;  1G12 A;  3LEA A;  4L63 A;  1FBL A;  5I3M A;  3TS4 A;  1JK3 A;  1UTZ A;  4HX3 A;  4XCT A;  4DF9 A;  1TVI A;  1KUK A;  3NX7 A;  1KUF A;  1GE6 A;  3F15 A;  1ND1 A;  3DTI A;  1HY7 A;  5D2B A;  1ATL A;  1Y8J A;  3KEC A;  3L0T A;  1KUI A;  1MNC A;  2CLT A;  2DDY A;  1AYK A;  2PJT A;  2D1N A;  3KWV C;  2Y6C A;  2L0R A;  2OVX A;  3LIR A;  4WZV A;  1JAP A;  3V96 B;  5L79 A;  3EDZ A;  1IAG A;  2OVZ A;  1D5J A;  1UMT A;  3DNG A;  4GR8 A;  5D1U A;  1GKC A;  1C3I A;  1BKC A;  3ZUK A;  1GE5 A;  4FVL A;  3F17 A;  4GF1 A;  2MLR A;  4A7B A;  1K7G A;  1BUV M;  5D3C A;  1B8Y A;  1EAK A;  1CIZ A;  1XFX A;  1HFC A;  2K2G A;  2K9C A;  2OXW A;  2MZE A;  3WV2 A;  3TVC A;  3LQB A;  4CTH A;  3EDG A;  3VI1 A;  1OMJ A;  2RJQ A;  4AUO A;  3F18 A;  1G49 A;  3ZXH A;  4PKQ A;  3HY7 A;  4PKU A;  1HTD A;  5D1T A;  2N8R A;  1XM5 A;  1XFW A;  5CZM A;  2JNP A;  3EDI A;  2OXZ A;  4PKT A;  1UEA A;  2POJ A;  1PWP A;  1XFZ A;  3LMC A;  1AF0 A;  2D1O A;  1XUD A;  1CGL A;  1QJJ A;  1K7Q A;  1K7I A;  1ZVX A;  3LUM A;  1RMZ A;  2J83 A;  2JT6 A;  2HU6 A;  1I76 A;  5B5P A;  1BKC E;  3GBO A;  4AXQ A;  2DW2 A;  3MA2 A;  1HOV A;  3I7I A;  4FU4 A;  1SLN A;  3ZVS A;  3CKI A;  1R1H A;  1OS2 A;  3AIG A;  5BPA A;  3B2Z A;  4JQG A;  1HV5 A;  4GWN A;  1G4K A;  1DMT A;  1FM1 A;  1D8F A;  2OW1 A;  3F1A A;  1MMQ A;  3KMC A;  1BZS A;  2JT5 A;  2W12 A;  1QJI A;  3LUN A;  2O36 A;  4Q1L A;  1KUH A;  1J7N A;  1XUR A;  2OW0 A;  1ZTQ A;  4WKI A;  1ZXC A;  1GKD A;  1OZ9 A;  2X3A A;  1Y93 A;  3HDB A;  2FV9 A;  1AKL A;  3Q2H A;  1CAQ A;  4H3X A;  5B5O A;  4HMA A;  4JPA A;  3LK8 A;  4H30 A;  5H8X A;  3KHI A;  1EUB A;  1UMS A;  1RM8 A;  4DD8 A;  1JIZ A;  1R1J A;  4DPE A;  3USN A;  1R1I A;  3RTS A;  3KEJ A;  3N2V A;  1QIA A;  4L6T A;  4IUW A;  4WKE A;  3AYU A;  5I4O A;  1BQO A;  1O0T A;  1AST A;  1IAE A;  3G42 A;  3B8Z A;  1YP1 A;  1YOU A;  3BA0 A;  3O2X A;  4I35 A;  1CQR A;  3WV1 A;  1PWQ A;  3P24 A;  3I7G A;  3F16 A;  4FXQ A;  3HYG A;  1O0Q A;  1MMB A;  3KRY A;  2OI0 A;  5BOT A;  2OY2 A;  2J0T A;  456C A;  1FLS A;  1OM6 A;  1G05 A;  3F19 A;  3HDA P;  1D7X A;  3LIL A;  4A3W A;  3OHL A;  1XUC A;  1JAO A;  1BM6 A;  1IAA A;  3LJZ A;  1A86 A;  3N2U A;  1PWW A;  1KUG A;  1JAQ A;  4L7A A;  1JJ9 A;  5D1S A;  4JP4 A;  2AIG P;  1JAN A;  2JSD A;  3L0V A;  2X3C A;  1BSW A;  1QIC A;  3LJT A;  2KRJ A;  4H2E A;  1BQQ M;  4GUY A;  1XFV A;  4PKR A;  4PKV A;  830C A;  3DWB A;  2W15 A;  1YCM A;  3UVC A;  3WV3 A;  4ILW D;  1ZP5 A;  3DPF A;  3O64 A;  1SAT A;  3EHY A;  2I47 A;  3K7N A;  1DTH A;  1XFY A;  1D8M A;  3RTT A;  1OM8 A;  5CUH A;  4H82 A;  1Y0V A;  2A8H A;  3U1R A;  3TSK A;  966C A;  5L7F A;  3KEK A;  4DV8 A;  4JA1 A;  2XS3 A;  5JMY A;  1PWU A;  4WK7 A;  3DPE A;  3LQ0 A;  4IN9 A;  1R54 A;  3OHO A;  2W13 A;  1B3D A;  4R3V A;  2V4B A;  1I1I P;  4IJO A;  3DTE A;  2USN A;  2OW2 A;  5CXA A;  1ZXV A;  1OS9 A;  1ZS0 A;  1BKC I;  5LAB A;  2MZH A;  2Y6D A;  4I03 A;  2OZR A;  1Q3A A;  4AIG A;  4QKZ A;  1SMP A;  2W14 A;  3TT4 A;  1H71 P;  2QPJ A;  4G9L A;  4XBH A;  5I0L A;  1C7K A;  5I43 A;  3B92 A;  4GQL A;  4WF6 A;  3LE9 A;  2SRT A;  1SRP A;  3HB2 P;  2CKI A;  5I12 A;  1YQY A;  3DTK A;  3VTG A;  3G5C A;  4ZR5 A;  4FXY P;  2WOA A;  2OW9 A;  2MZI A;  4H76 A;  2ERQ A;  4J4M A;  4XM7 A;  1SU3 A;  3SHI A;  2MLS A;  1KAP P;  1PWV A;  3HBU P;  2X3B A;  2E2D A;  1JH1 A;  5D7W A;  2W0D A;  1CXV A;  1XAX A;  1BUD A;  3P1V A;  1WNI A;  4G0D A;  3AYK A;  1ROS A;  4JIJ A;  2FV5 A;  1GO8 P;  4PKS A;  2ERP A;  4EFS A;  2YB9 A;  1S4B P; 
#chains in the Genus database with same CATH homology
 1L6J A;  3DL1 A;  4GR3 A;  4PKW A;  2ERO A;  1A85 A;  1UTT A;  3HBV P;  2X7M A;  1JIW P;  4L19 A;  1GO7 P;  1EB6 A;  4H49 A;  2WO8 A;  5BOY A;  2OXU A;  1USN A;  3EWJ A;  1C8T A;  1CK7 A;  1G9K A;  2WO9 A;  5I2Z A;  3LJG A;  1IAD A;  1GXD A;  2OY4 A;  4XM8 A;  2RJP A;  1R55 A;  1BIW A;  2XS4 A;  3LKA A;  1Z3J A;  1SLM A;  4XM6 A;  1QUA A;  2O3E A;  1OO9 A;  2YIG A;  1JKY A;  1HFS A;  4H84 A;  4AYK A;  2YUF A;  3EDH A;  1GE7 A;  2JIH A;  3E8R A;  3K7L A;  1MMP A;  3KME A;  4GR0 A;  4ON1 A;  3EHX A;  2TCL A;  1QIB A;  1OM7 A;  1CGE A;  3DSL A;  3HY9 A;  3LGP A;  4H1Q A;  2DW0 A;  2AYK A;  2DW1 A;  3ELM A;  1KBC A;  1I73 A;  2Z2D A;  4GWM A;  2DDF A;  1XFU A;  1IAC A;  3Q2G A;  3LIK A;  1MMR A;  1CGF A;  2E3X A;  1IAB A;  1G12 A;  3LEA A;  4L63 A;  1FBL A;  5I3M A;  3TS4 A;  1JK3 A;  1UTZ A;  4HX3 A;  4XCT A;  4DF9 A;  1KUK A;  3NX7 A;  1KUF A;  1GE6 A;  3F15 A;  1ND1 A;  3DTI A;  1HY7 A;  5D2B A;  1ATL A;  1Y8J A;  3KEC A;  3L0T A;  1KUI A;  1MNC A;  2CLT A;  2DDY A;  1AYK A;  2PJT A;  2D1N A;  3KWV C;  2Y6C A;  2L0R A;  2OVX A;  3LIR A;  4WZV A;  1JAP A;  3V96 B;  5L79 A;  3EDZ A;  1IAG A;  2OVZ A;  1D5J A;  1UMT A;  3DNG A;  4GR8 A;  5D1U A;  1GKC A;  1C3I A;  1BKC A;  3ZUK A;  1GE5 A;  4FVL A;  3F17 A;  4GF1 A;  2MLR A;  4A7B A;  1K7G A;  1BUV M;  5D3C A;  1B8Y A;  1EAK A;  1CIZ A;  1XFX A;  1HFC A;  2K2G A;  2K9C A;  2OXW A;  2MZE A;  3WV2 A;  3TVC A;  3LQB A;  4CTH A;  3EDG A;  3VI1 A;  1OMJ A;  2RJQ A;  4AUO A;  3F18 A;  1G49 A;  3ZXH A;  4PKQ A;  3HY7 A;  4PKU A;  1HTD A;  5D1T A;  2N8R A;  1XFW A;  5CZM A;  2JNP A;  3EDI A;  2OXZ A;  4PKT A;  1UEA A;  2POJ A;  1PWP A;  1XFZ A;  3LMC A;  1AF0 A;  2D1O A;  1XUD A;  1CGL A;  1QJJ A;  1K7Q A;  1K7I A;  1ZVX A;  3LUM A;  1RMZ A;  2J83 A;  2JT6 A;  2HU6 A;  1I76 A;  5B5P A;  1BKC E;  3GBO A;  4AXQ A;  2DW2 A;  3MA2 A;  1HOV A;  3I7I A;  4FU4 A;  1SLN A;  3ZVS A;  3CKI A;  1R1H A;  1OS2 A;  3AIG A;  5BPA A;  3B2Z A;  4JQG A;  1HV5 A;  4GWN A;  1G4K A;  1DMT A;  1FM1 A;  1D8F A;  2OW1 A;  3F1A A;  1MMQ A;  3KMC A;  1BZS A;  2JT5 A;  2W12 A;  1QJI A;  3LUN A;  2O36 A;  4Q1L A;  1KUH A;  1J7N A;  1XUR A;  2OW0 A;  1ZTQ A;  4WKI A;  1ZXC A;  1GKD A;  2X3A A;  1Y93 A;  3HDB A;  2FV9 A;  1AKL A;  3Q2H A;  1CAQ A;  4H3X A;  5B5O A;  4HMA A;  4JPA A;  3LK8 A;  4H30 A;  5H8X A;  3KHI A;  1EUB A;  1UMS A;  1RM8 A;  4DD8 A;  1JIZ A;  1R1J A;  4DPE A;  3USN A;  1R1I A;  3RTS A;  3KEJ A;  3N2V A;  1QIA A;  4L6T A;  4IUW A;  4WKE A;  3AYU A;  5I4O A;  1BQO A;  1O0T A;  1AST A;  1IAE A;  3G42 A;  3B8Z A;  1YP1 A;  1YOU A;  3BA0 A;  3O2X A;  4I35 A;  1CQR A;  3WV1 A;  1PWQ A;  3P24 A;  3I7G A;  3F16 A;  4FXQ A;  3HYG A;  1O0Q A;  1MMB A;  3KRY A;  2OI0 A;  5BOT A;  2OY2 A;  2J0T A;  456C A;  1FLS A;  1OM6 A;  1G05 A;  3F19 A;  3HDA P;  1D7X A;  3LIL A;  4A3W A;  3OHL A;  1XUC A;  1JAO A;  1BM6 A;  1IAA A;  3LJZ A;  1A86 A;  3N2U A;  1PWW A;  1KUG A;  1JAQ A;  4L7A A;  1JJ9 A;  5D1S A;  4JP4 A;  2AIG P;  1JAN A;  2JSD A;  3L0V A;  2X3C A;  1BSW A;  1QIC A;  3LJT A;  2KRJ A;  4H2E A;  1BQQ M;  4GUY A;  1XFV A;  4PKR A;  4PKV A;  830C A;  3DWB A;  2W15 A;  1YCM A;  3UVC A;  3WV3 A;  4ILW D;  1ZP5 A;  3DPF A;  3O64 A;  1SAT A;  3EHY A;  2I47 A;  3K7N A;  1DTH A;  1XFY A;  1D8M A;  3RTT A;  1OM8 A;  5CUH A;  4H82 A;  1Y0V A;  2A8H A;  3U1R A;  3TSK A;  966C A;  5L7F A;  3KEK A;  4DV8 A;  4JA1 A;  2XS3 A;  5JMY A;  1PWU A;  4WK7 A;  3DPE A;  3LQ0 A;  4IN9 A;  1R54 A;  3OHO A;  2W13 A;  1B3D A;  4R3V A;  2V4B A;  1I1I P;  4IJO A;  3DTE A;  2USN A;  2OW2 A;  5CXA A;  1ZXV A;  1OS9 A;  1ZS0 A;  1BKC I;  5LAB A;  2MZH A;  2Y6D A;  4I03 A;  2OZR A;  1Q3A A;  4AIG A;  4QKZ A;  1SMP A;  2W14 A;  3TT4 A;  1H71 P;  2QPJ A;  4G9L A;  4XBH A;  5I0L A;  1C7K A;  5I43 A;  3B92 A;  4GQL A;  4WF6 A;  3LE9 A;  2SRT A;  1SRP A;  3HB2 P;  2CKI A;  5I12 A;  1YQY A;  3DTK A;  3VTG A;  3G5C A;  4ZR5 A;  4FXY P;  2WOA A;  2OW9 A;  2MZI A;  4H76 A;  2ERQ A;  4J4M A;  4XM7 A;  1SU3 A;  3SHI A;  2MLS A;  1KAP P;  1PWV A;  3HBU P;  2X3B A;  2E2D A;  1JH1 A;  5D7W A;  2W0D A;  1CXV A;  1BUD A;  3P1V A;  1WNI A;  4G0D A;  3AYK A;  1ROS A;  4JIJ A;  2FV5 A;  1GO8 P;  4PKS A;  2ERP A;  4EFS A;  2YB9 A;  1S4B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...