3RTSA

Human mmp-12 catalytic domain in complex with*n*-hydroxy-2-(2-phenylethylsulfonamido)acetamide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Contribution of ligand free energy of solvation to design new potent MMPs inhibitors.
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3rtsA00
3EHYA 1BIWA 1EAKA 4JPAA 1CK7A 2OXUA 4AUOA 4DPEA 5B5OA 1G12A 2WOAA 1KBCA 2I47A 2DW0A 1JANA 1D7XA 1BKCA 1R1HA 1DMTA 2J0TA 3CKIA 1YCMA 4I35A 2MZHA 1JAPA 2OW2A 1ASTA 1QJIA 1K7IA 456CA 3KEJA 1G05A 2OI0A 1CGFA 1SATA 2AIGP 3HDAP 4L6TA 1FM1A 1R1JA 1MMPA 3LE9A 1XURA 5CUHA 1R55A 1C8TA 2W15A 2QPJA 1KUIA 1CGLA 2Z2DA 1S4BP 4H82A 3K7LA 2OW0A 3TS4A 1RMZA 2MLSA 4GR3A 3I7IA 1PWPA 3EDZA 1PWVA 1OM6A 1C3IA 5LABA 1KUFA 3O64A 2JIHA 4WKEA 2USNA 3G5CA 4WZVA 4DV8A 3LMCA 1MMRA 3EDHA 1SLMA 5BPAA 4HMAA 1I1IP 1UEAA 3LIRA 3LQBA 2ERPA 1FBLA 2POJA 4JQGA 3HBUP 3EWJA 4IN9A 4XM6A 1RM8A 1MNCA 4AIGA 3HY7A 1UTZA 3HB2P 2E3XA 1A85A 3LJTA 2X3AA 4A3WA 5I3MA 3RTTA 3V96B 4G9LA 4QKZA 2PJTA 3G42A 1JKYA 3P1VA 1GO7P 2W14A 1Q3AA 4H2EA 3P24A 4HX3A 3ZVSA 3K7NA 5I4OA 4DD8A 3KEKA 3LILA 3B8ZA 3KHIA 3F15A 1BZSA 2W0DA 2DW1A 3I7GA 5BOTA 2X7MA 1K7GA 3BA0A 4L19A 1GXDA 1USNA 5H8XA 1XFUA 4XM7A 1GKCA 1AF0A 1OM7A 2AYKA 1KAPP 1XFYA 3HBVP 4XBHA 1ZP5A 5B5PA 3DPFA 3WV1A 1BUDA 1CGEA 1FLSA 1J7NA 2W13A 1Y0VA 3UVCA 4I03A 4JP4A 5CZMA 2DDFA 2K9CA 3TT4A 3EDGA 4ON1A 5I2ZA 1R1IA 3VI1A 1D5JA 1OS2A 1GKDA 1MMQA 2EROA 4AYKA 1SRPA 1CQRA 4FVLA 4WK7A 1QJJA 1JH1A 4ILWD 4PKRA 2K2GA 3ZXHA 966CA 2OVXA 2XS3A 2WO9A 2MZEA 1ND1A 1SLNA 1BSWA 3HY9A 4DF9A 3MA2A 3WV2A 3DPEA 1O0TA 1O0QA 3HYGA 3TVCA 1PWQA 1IABA 1PWUA 1L6JA 1HV5A 5CXAA 2D1OA 4H76A 3LIKA 1BKCI 1ZS0A 1XFXA 3OHOA 5L7FA 1BM6A 3KECA 1SMPA 4PKVA 4PKQA 1D8MA 1ZVXA 1I73A 2ERQA 4GUYA 4H84A 3ZUKA 2SRTA 5JMYA 1XFZA 3OHLA 2X3BA 2A8HA 3HDBA 1SU3A 3F16A 1EB6A 1OO9A 3WV3A 3L0VA 2JNPA 4XCTA 1XFWA 1K7QA 2OY4A 5D1TA 2OW1A 1HY7A 1XUCA 3LUMA 3E8RA 1HFSA 3AYUA 1JJ9A 4L63A 5BOYA 5I0LA 4A7BA 4GWNA 4FXQA 2CKIA 2MLRA 1A86A 2RJQA 3F1AA 3LJZA 1JAOA 5D1UA 5I43A 1Y8JA 3KMEA 1ZTQA 2WO8A 1OM8A 3LKAA 5D2BA 2J83A 3Q2HA 3ELMA 2HU6A 3VTGA 4J4MA 1YQYA 1BUVM 1YOUA 2MZIA 3KWVC 4PKWA 2JSDA 1G4KA 4GWMA 1MMBA 1CAQA 3Q2GA 2FV5A 4H49A 3N2VA 2N8RA 2DW2A 2OY2A 5D3CA 3TSKA 3LJGA 1KUHA 1IACA 3U1RA 4H1QA 4PKTA 3AIGA 1UTTA 3F17A 2TCLA 3DNGA 1ZXVA 2E2DA 2XS4A 1BQOA 4Q1LA 3EHXA 2W12A 1G49A 3LK8A 4PKUA 3SHIA 3AYKA 4JIJA 4XM8A 4G0DA 4AXQA 1DTHA 1CIZA 3LGPA 1Y93A 4IJOA 1C7KA 4GR0A 2O3EA 3KMCA 2YIGA 2L0RA 3RTSA 1QIAA 1QICA 1UMTA 4R3VA 4JA1A 2D1NA 1UMSA 1R54A 2Y6DA 1IAGA 3B2ZA 4H3XA 1HOVA 3F18A 1AYKA 1GE7A 1XUDA 2YB9A 1CXVA 2OVZA 4PKSA 1Z3JA 1EUBA 4GR8A 2RJPA 4CTHA 1OS9A 3L0TA 3LUNA 2DDYA 4EFSA 2O36A 4H30A 4WKIA 1ROSA 1KUGA 3N2UA 3DSLA 3NX7A 4ZR5A 1GE6A 1IAAA 1WNIA 3GBOA 1GE5A 2JT6A 3DWBA 2OXWA 2Y6CA 2X3CA 4IUWA 1AKLA 1JIWP 5D7WA 2OZRA 1JIZA 1JK3A 1PWWA 1XFVA 4WF6A 2KRJA 1OMJA 5D1SA 1BKCE 3EDIA 1HTDA 2JT5A 2CLTA 3USNA 3O2XA 1QIBA 3KRYA 1GO8P 830CA 1ATLA 3LQ0A 1B8YA 2OW9A 2V4BA 5L79A 1KUKA 1B3DA 1IAEA 1QUAA 4GF1A 4GQLA 1ZXCA 3LEAA 1JAQA 4FU4A 1D8FA 1I76A 5I12A 2FV9A 2OXZA 4FXYP 3B92A 1H71P 1IADA 1BQQM 1YP1A 3DL1A 1HFCA 1G9KA 3F19A
chains in the Genus database with same CATH superfamily
3EHYA 1BIWA 1EAKA 4JPAA 1CK7A 1OZ9A 2OXUA 4AUOA 4DPEA 5B5OA 1G12A 2WOAA 1KBCA 2I47A 2DW0A 1JANA 1D7XA 1BKCA 1R1HA 1DMTA 2J0TA 3CKIA 1YCMA 4I35A 2MZHA 1JAPA 2OW2A 1ASTA 1QJIA 1K7IA 456CA 3KEJA 1G05A 2OI0A 1CGFA 1SATA 2AIGP 3HDAP 4L6TA 1FM1A 1R1JA 1MMPA 3LE9A 1XURA 5CUHA 1R55A 1C8TA 2W15A 2QPJA 1KUIA 1CGLA 2Z2DA 1S4BP 4H82A 3K7LA 2OW0A 3TS4A 1RMZA 2MLSA 4GR3A 3I7IA 1PWPA 3EDZA 1PWVA 1OM6A 1C3IA 5LABA 1KUFA 3O64A 2JIHA 4WKEA 2USNA 3G5CA 4WZVA 4DV8A 3LMCA 1MMRA 3EDHA 1SLMA 5BPAA 4HMAA 1I1IP 1UEAA 3LIRA 3LQBA 2ERPA 1FBLA 2POJA 4JQGA 3HBUP 3EWJA 4IN9A 4XM6A 1RM8A 1MNCA 4AIGA 3HY7A 1UTZA 3HB2P 2E3XA 1A85A 3LJTA 2X3AA 4A3WA 5I3MA 3RTTA 3V96B 4G9LA 4QKZA 2PJTA 3G42A 1JKYA 3P1VA 1GO7P 2W14A 1Q3AA 4H2EA 3P24A 4HX3A 3ZVSA 3K7NA 5I4OA 4DD8A 3KEKA 3LILA 3B8ZA 3KHIA 3F15A 1BZSA 2W0DA 2DW1A 3I7GA 5BOTA 2X7MA 1K7GA 3DTIA 3BA0A 4L19A 1GXDA 1USNA 5H8XA 1XFUA 4XM7A 1GKCA 1AF0A 1OM7A 2AYKA 1KAPP 1XFYA 3HBVP 4XBHA 1ZP5A 5B5PA 3DPFA 3WV1A 1BUDA 1CGEA 1FLSA 1J7NA 2W13A 1Y0VA 3UVCA 4I03A 4JP4A 5CZMA 2DDFA 2K9CA 3TT4A 3EDGA 4ON1A 5I2ZA 1XAXA 1R1IA 3VI1A 1D5JA 1OS2A 1GKDA 1MMQA 2EROA 4AYKA 1SRPA 1CQRA 4FVLA 4WK7A 1QJJA 1JH1A 4ILWD 4PKRA 2K2GA 3ZXHA 966CA 2OVXA 2XS3A 2WO9A 2MZEA 1ND1A 1SLNA 1BSWA 3HY9A 4DF9A 3MA2A 3WV2A 3DPEA 1O0TA 1O0QA 3HYGA 3TVCA 1PWQA 1IABA 1PWUA 1L6JA 1HV5A 5CXAA 2D1OA 4H76A 3LIKA 1BKCI 1ZS0A 1XFXA 3OHOA 5L7FA 1BM6A 3KECA 1SMPA 4PKVA 4PKQA 1D8MA 1ZVXA 1I73A 2ERQA 4GUYA 4H84A 3ZUKA 2SRTA 5JMYA 1XFZA 3OHLA 4L7AA 2X3BA 2A8HA 3HDBA 1SU3A 3F16A 1EB6A 1OO9A 3WV3A 3L0VA 2JNPA 4XCTA 1XFWA 1K7QA 2OY4A 5D1TA 2OW1A 1HY7A 1XUCA 3LUMA 3DTEA 1HFSA 3AYUA 1JJ9A 3E8RA 4L63A 5BOYA 5I0LA 4A7BA 4GWNA 4FXQA 2CKIA 2MLRA 1A86A 2RJQA 3F1AA 3LJZA 1JAOA 5D1UA 5I43A 1Y8JA 3KMEA 1ZTQA 2WO8A 1OM8A 3LKAA 5D2BA 2J83A 3Q2HA 3ELMA 2HU6A 3VTGA 4J4MA 1YQYA 1BUVM 1YOUA 2MZIA 3KWVC 4PKWA 2JSDA 1G4KA 4GWMA 1MMBA 1CAQA 3Q2GA 2FV5A 4H49A 3N2VA 1XM5A 2N8RA 2DW2A 2OY2A 5D3CA 3TSKA 3LJGA 1KUHA 1IACA 3U1RA 4H1QA 4PKTA 3AIGA 1UTTA 3F17A 2TCLA 3DNGA 1ZXVA 2E2DA 2XS4A 1BQOA 4Q1LA 3EHXA 2W12A 1G49A 3LK8A 4PKUA 3SHIA 3DTKA 3AYKA 4JIJA 4XM8A 4G0DA 4AXQA 1DTHA 1CIZA 3LGPA 1Y93A 4IJOA 1C7KA 4GR0A 2O3EA 3KMCA 2YIGA 2L0RA 3RTSA 1QIAA 1QICA 1UMTA 4R3VA 4JA1A 2D1NA 1UMSA 1R54A 2Y6DA 1IAGA 3B2ZA 4H3XA 1HOVA 3F18A 1AYKA 1GE7A 2YUFA 1XUDA 2YB9A 1CXVA 2OVZA 4PKSA 1Z3JA 1EUBA 4GR8A 2RJPA 4CTHA 1OS9A 3L0TA 3LUNA 2DDYA 4EFSA 2O36A 4H30A 4WKIA 1ROSA 1KUGA 3N2UA 3DSLA 3NX7A 4ZR5A 1GE6A 1IAAA 1WNIA 3GBOA 1GE5A 2JT6A 3DWBA 2OXWA 2Y6CA 2X3CA 4IUWA 1TVIA 1AKLA 1JIWP 5D7WA 2OZRA 1JIZA 1JK3A 1PWWA 1XFVA 4WF6A 2KRJA 1OMJA 5D1SA 1BKCE 3EDIA 1HTDA 2JT5A 2CLTA 3USNA 3O2XA 1QIBA 3KRYA 1GO8P 830CA 1ATLA 3LQ0A 1B8YA 2OW9A 2V4BA 5L79A 1KUKA 1B3DA 1IAEA 1QUAA 4GF1A 4GQLA 1ZXCA 3LEAA 1JAQA 4FU4A 1D8FA 1I76A 5I12A 2FV9A 2OXZA 4FXYP 3B92A 1H71P 1IADA 1BQQM 1YP1A 3DL1A 1HFCA 1G9KA 3F19A
chains in the Genus database with same CATH topology
3EHYA 1BIWA 1EAKA 4JPAA 1CK7A 2OXUA 4AUOA 4DPEA 5B5OA 1G12A 2WOAA 1KBCA 2I47A 2DW0A 1JANA 1D7XA 1BKCA 1R1HA 1DMTA 2J0TA 3CKIA 1YCMA 4I35A 2MZHA 1JAPA 2OW2A 1ASTA 1QJIA 1K7IA 456CA 3KEJA 1G05A 2OI0A 1CGFA 1SATA 2AIGP 3HDAP 4L6TA 1FM1A 1R1JA 1MMPA 3LE9A 1XURA 5CUHA 1R55A 1C8TA 2W15A 2QPJA 1KUIA 1CGLA 2Z2DA 1S4BP 4H82A 3K7LA 2OW0A 3TS4A 1RMZA 2MLSA 4GR3A 3I7IA 1PWPA 3EDZA 1PWVA 1OM6A 1C3IA 5LABA 1KUFA 3O64A 2JIHA 4WKEA 2USNA 3G5CA 4WZVA 4DV8A 3LMCA 1MMRA 3EDHA 1SLMA 5BPAA 4HMAA 1I1IP 1UEAA 3LIRA 3LQBA 2ERPA 1FBLA 2POJA 4JQGA 3HBUP 3EWJA 4IN9A 4XM6A 1RM8A 1MNCA 4AIGA 3HY7A 1UTZA 3HB2P 2E3XA 1A85A 3LJTA 2X3AA 4A3WA 5I3MA 3RTTA 3V96B 4G9LA 4QKZA 2PJTA 3G42A 1JKYA 3P1VA 1GO7P 2W14A 1Q3AA 4H2EA 3P24A 4HX3A 3ZVSA 3K7NA 5I4OA 4DD8A 3KEKA 3LILA 3B8ZA 3KHIA 3F15A 1BZSA 2W0DA 2DW1A 3I7GA 5BOTA 2X7MA 1K7GA 3DTIA 3BA0A 4L19A 1GXDA 1USNA 5H8XA 1XFUA 4XM7A 1GKCA 1AF0A 1OM7A 2AYKA 1KAPP 1XFYA 3HBVP 4XBHA 1ZP5A 5B5PA 3DPFA 3WV1A 1BUDA 1CGEA 1FLSA 1J7NA 2W13A 1Y0VA 3UVCA 4I03A 4JP4A 5CZMA 2DDFA 2K9CA 3TT4A 3EDGA 4ON1A 5I2ZA 1R1IA 3VI1A 1D5JA 1OS2A 1GKDA 1MMQA 2EROA 4AYKA 1SRPA 1CQRA 4FVLA 4WK7A 1QJJA 1JH1A 4ILWD 4PKRA 2K2GA 3ZXHA 966CA 2OVXA 2XS3A 2WO9A 2MZEA 1ND1A 1SLNA 1BSWA 3HY9A 4DF9A 3MA2A 3WV2A 3DPEA 1O0TA 1O0QA 3HYGA 3TVCA 1PWQA 1IABA 1PWUA 1L6JA 1HV5A 5CXAA 2D1OA 4H76A 3LIKA 1BKCI 1ZS0A 1XFXA 3OHOA 5L7FA 1BM6A 3KECA 1SMPA 4PKVA 4PKQA 1D8MA 1ZVXA 1I73A 2ERQA 4GUYA 4H84A 3ZUKA 2SRTA 5JMYA 1XFZA 3OHLA 4L7AA 2X3BA 2A8HA 3HDBA 1SU3A 3F16A 1EB6A 1OO9A 3WV3A 3L0VA 2JNPA 4XCTA 1XFWA 1K7QA 2OY4A 5D1TA 2OW1A 1HY7A 1XUCA 3LUMA 3DTEA 1HFSA 3AYUA 1JJ9A 3E8RA 4L63A 5BOYA 5I0LA 4A7BA 4GWNA 4FXQA 2CKIA 2MLRA 1A86A 2RJQA 3F1AA 3LJZA 1JAOA 5D1UA 5I43A 1Y8JA 3KMEA 1ZTQA 2WO8A 1OM8A 3LKAA 5D2BA 2J83A 3Q2HA 3ELMA 2HU6A 3VTGA 4J4MA 1YQYA 1BUVM 1YOUA 2MZIA 3KWVC 4PKWA 2JSDA 1G4KA 4GWMA 1MMBA 1CAQA 3Q2GA 2FV5A 4H49A 3N2VA 2N8RA 2DW2A 2OY2A 5D3CA 3TSKA 3LJGA 1KUHA 1IACA 3U1RA 4H1QA 4PKTA 3AIGA 1UTTA 3F17A 2TCLA 3DNGA 1ZXVA 2E2DA 2XS4A 1BQOA 4Q1LA 3EHXA 2W12A 1G49A 3LK8A 4PKUA 3SHIA 3DTKA 3AYKA 4JIJA 4XM8A 4G0DA 4AXQA 1DTHA 1CIZA 3LGPA 1Y93A 4IJOA 1C7KA 4GR0A 2O3EA 3KMCA 2YIGA 2L0RA 3RTSA 1QIAA 1QICA 1UMTA 4R3VA 4JA1A 2D1NA 1UMSA 1R54A 2Y6DA 1IAGA 3B2ZA 4H3XA 1HOVA 3F18A 1AYKA 1GE7A 2YUFA 1XUDA 2YB9A 1CXVA 2OVZA 4PKSA 1Z3JA 1EUBA 4GR8A 2RJPA 4CTHA 1OS9A 3L0TA 3LUNA 2DDYA 4EFSA 2O36A 4H30A 4WKIA 1ROSA 1KUGA 3N2UA 3DSLA 3NX7A 4ZR5A 1GE6A 1IAAA 1WNIA 3GBOA 1GE5A 2JT6A 3DWBA 2OXWA 2Y6CA 2X3CA 4IUWA 1AKLA 1JIWP 5D7WA 2OZRA 1JIZA 1JK3A 1PWWA 1XFVA 4WF6A 2KRJA 1OMJA 5D1SA 1BKCE 3EDIA 1HTDA 2JT5A 2CLTA 3USNA 3O2XA 1QIBA 3KRYA 1GO8P 830CA 1ATLA 3LQ0A 1B8YA 2OW9A 2V4BA 5L79A 1KUKA 1B3DA 1IAEA 1QUAA 4GF1A 4GQLA 1ZXCA 3LEAA 1JAQA 4FU4A 1D8FA 1I76A 5I12A 2FV9A 2OXZA 4FXYP 3B92A 1H71P 1IADA 1BQQM 1YP1A 3DL1A 1HFCA 1G9KA 3F19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHY A;  1BIW A;  1EAK A;  4JPA A;  1CK7 A;  2OXU A;  4AUO A;  4DPE A;  5B5O A;  1G12 A;  2WOA A;  1KBC A;  2I47 A;  2DW0 A;  1JAN A;  1D7X A;  1BKC A;  1R1H A;  1DMT A;  2J0T A;  3CKI A;  1YCM A;  4I35 A;  2MZH A;  1JAP A;  2OW2 A;  1AST A;  1QJI A;  1K7I A;  456C A;  3KEJ A;  1G05 A;  2OI0 A;  1CGF A;  1SAT A;  2AIG P;  3HDA P;  4L6T A;  1FM1 A;  1R1J A;  1MMP A;  3LE9 A;  1XUR A;  5CUH A;  1R55 A;  1C8T A;  2W15 A;  2QPJ A;  1KUI A;  1CGL A;  2Z2D A;  1S4B P;  4H82 A;  3K7L A;  2OW0 A;  3TS4 A;  1RMZ A;  2MLS A;  4GR3 A;  3I7I A;  1PWP A;  3EDZ A;  1PWV A;  1OM6 A;  1C3I A;  5LAB A;  1KUF A;  3O64 A;  2JIH A;  4WKE A;  2USN A;  3G5C A;  4WZV A;  4DV8 A;  3LMC A;  1MMR A;  3EDH A;  1SLM A;  5BPA A;  4HMA A;  1I1I P;  1UEA A;  3LIR A;  3LQB A;  2ERP A;  1FBL A;  2POJ A;  4JQG A;  3HBU P;  3EWJ A;  4IN9 A;  4XM6 A;  1RM8 A;  1MNC A;  4AIG A;  3HY7 A;  1UTZ A;  3HB2 P;  2E3X A;  1A85 A;  3LJT A;  2X3A A;  4A3W A;  5I3M A;  3RTT A;  3V96 B;  4G9L A;  4QKZ A;  2PJT A;  3G42 A;  1JKY A;  3P1V A;  1GO7 P;  2W14 A;  1Q3A A;  4H2E A;  3P24 A;  4HX3 A;  3ZVS A;  3K7N A;  5I4O A;  4DD8 A;  3KEK A;  3LIL A;  3B8Z A;  3KHI A;  3F15 A;  1BZS A;  2W0D A;  2DW1 A;  3I7G A;  5BOT A;  2X7M A;  1K7G A;  3BA0 A;  4L19 A;  1GXD A;  1USN A;  5H8X A;  1XFU A;  4XM7 A;  1GKC A;  1AF0 A;  1OM7 A;  2AYK A;  1KAP P;  1XFY A;  3HBV P;  4XBH A;  1ZP5 A;  5B5P A;  3DPF A;  3WV1 A;  1BUD A;  1CGE A;  1FLS A;  1J7N A;  2W13 A;  1Y0V A;  3UVC A;  4I03 A;  4JP4 A;  5CZM A;  2DDF A;  2K9C A;  3TT4 A;  3EDG A;  4ON1 A;  5I2Z A;  1R1I A;  3VI1 A;  1D5J A;  1OS2 A;  1GKD A;  1MMQ A;  2ERO A;  4AYK A;  1SRP A;  1CQR A;  4FVL A;  4WK7 A;  1QJJ A;  1JH1 A;  4ILW D;  4PKR A;  2K2G A;  3ZXH A;  966C A;  2OVX A;  2XS3 A;  2WO9 A;  2MZE A;  1ND1 A;  1SLN A;  1BSW A;  3HY9 A;  4DF9 A;  3MA2 A;  3WV2 A;  3DPE A;  1O0T A;  1O0Q A;  3HYG A;  3TVC A;  1PWQ A;  1IAB A;  1PWU A;  1L6J A;  1HV5 A;  5CXA A;  2D1O A;  4H76 A;  3LIK A;  1BKC I;  1ZS0 A;  1XFX A;  3OHO A;  5L7F A;  1BM6 A;  3KEC A;  1SMP A;  4PKV A;  4PKQ A;  1D8M A;  1ZVX A;  1I73 A;  2ERQ A;  4GUY A;  4H84 A;  3ZUK A;  2SRT A;  5JMY A;  1XFZ A;  3OHL A;  2X3B A;  2A8H A;  3HDB A;  1SU3 A;  3F16 A;  1EB6 A;  1OO9 A;  3WV3 A;  3L0V A;  2JNP A;  4XCT A;  1XFW A;  1K7Q A;  2OY4 A;  5D1T A;  2OW1 A;  1HY7 A;  1XUC A;  3LUM A;  3E8R A;  1HFS A;  3AYU A;  1JJ9 A;  4L63 A;  5BOY A;  5I0L A;  4A7B A;  4GWN A;  4FXQ A;  2CKI A;  2MLR A;  1A86 A;  2RJQ A;  3F1A A;  3LJZ A;  1JAO A;  5D1U A;  5I43 A;  1Y8J A;  3KME A;  1ZTQ A;  2WO8 A;  1OM8 A;  3LKA A;  5D2B A;  2J83 A;  3Q2H A;  3ELM A;  2HU6 A;  3VTG A;  4J4M A;  1YQY A;  1BUV M;  1YOU A;  2MZI A;  3KWV C;  4PKW A;  2JSD A;  1G4K A;  4GWM A;  1MMB A;  1CAQ A;  3Q2G A;  2FV5 A;  4H49 A;  3N2V A;  2N8R A;  2DW2 A;  2OY2 A;  5D3C A;  3TSK A;  3LJG A;  1KUH A;  1IAC A;  3U1R A;  4H1Q A;  4PKT A;  3AIG A;  1UTT A;  3F17 A;  2TCL A;  3DNG A;  1ZXV A;  2E2D A;  2XS4 A;  1BQO A;  4Q1L A;  3EHX A;  2W12 A;  1G49 A;  3LK8 A;  4PKU A;  3SHI A;  3AYK A;  4JIJ A;  4XM8 A;  4G0D A;  4AXQ A;  1DTH A;  1CIZ A;  3LGP A;  1Y93 A;  4IJO A;  1C7K A;  4GR0 A;  2O3E A;  3KMC A;  2YIG A;  2L0R A;  3RTS A;  1QIA A;  1QIC A;  1UMT A;  4R3V A;  4JA1 A;  2D1N A;  1UMS A;  1R54 A;  2Y6D A;  1IAG A;  3B2Z A;  4H3X A;  1HOV A;  3F18 A;  1AYK A;  1GE7 A;  1XUD A;  2YB9 A;  1CXV A;  2OVZ A;  4PKS A;  1Z3J A;  1EUB A;  4GR8 A;  2RJP A;  4CTH A;  1OS9 A;  3L0T A;  3LUN A;  2DDY A;  4EFS A;  2O36 A;  4H30 A;  4WKI A;  1ROS A;  1KUG A;  3N2U A;  3DSL A;  3NX7 A;  4ZR5 A;  1GE6 A;  1IAA A;  1WNI A;  3GBO A;  1GE5 A;  2JT6 A;  3DWB A;  2OXW A;  2Y6C A;  2X3C A;  4IUW A;  1AKL A;  1JIW P;  5D7W A;  2OZR A;  1JIZ A;  1JK3 A;  1PWW A;  1XFV A;  4WF6 A;  2KRJ A;  1OMJ A;  5D1S A;  1BKC E;  3EDI A;  1HTD A;  2JT5 A;  2CLT A;  3USN A;  3O2X A;  1QIB A;  3KRY A;  1GO8 P;  830C A;  1ATL A;  3LQ0 A;  1B8Y A;  2OW9 A;  2V4B A;  5L79 A;  1KUK A;  1B3D A;  1IAE A;  1QUA A;  4GF1 A;  4GQL A;  1ZXC A;  3LEA A;  1JAQ A;  4FU4 A;  1D8F A;  1I76 A;  5I12 A;  2FV9 A;  2OXZ A;  4FXY P;  3B92 A;  1H71 P;  1IAD A;  1BQQ M;  1YP1 A;  3DL1 A;  1HFC A;  1G9K A;  3F19 A; 
#chains in the Genus database with same CATH topology
 3EHY A;  1BIW A;  1EAK A;  4JPA A;  1CK7 A;  1OZ9 A;  2OXU A;  4AUO A;  4DPE A;  5B5O A;  1G12 A;  2WOA A;  1KBC A;  2I47 A;  2DW0 A;  1JAN A;  1D7X A;  1BKC A;  1R1H A;  1DMT A;  2J0T A;  3CKI A;  1YCM A;  4I35 A;  2MZH A;  1JAP A;  2OW2 A;  1AST A;  1QJI A;  1K7I A;  456C A;  3KEJ A;  1G05 A;  2OI0 A;  1CGF A;  1SAT A;  2AIG P;  3HDA P;  4L6T A;  1FM1 A;  1R1J A;  1MMP A;  3LE9 A;  1XUR A;  5CUH A;  1R55 A;  1C8T A;  2W15 A;  2QPJ A;  1KUI A;  1CGL A;  2Z2D A;  1S4B P;  4H82 A;  3K7L A;  2OW0 A;  3TS4 A;  1RMZ A;  2MLS A;  4GR3 A;  3I7I A;  1PWP A;  3EDZ A;  1PWV A;  1OM6 A;  1C3I A;  5LAB A;  1KUF A;  3O64 A;  2JIH A;  4WKE A;  2USN A;  3G5C A;  4WZV A;  4DV8 A;  3LMC A;  1MMR A;  3EDH A;  1SLM A;  5BPA A;  4HMA A;  1I1I P;  1UEA A;  3LIR A;  3LQB A;  2ERP A;  1FBL A;  2POJ A;  4JQG A;  3HBU P;  3EWJ A;  4IN9 A;  4XM6 A;  1RM8 A;  1MNC A;  4AIG A;  3HY7 A;  1UTZ A;  3HB2 P;  2E3X A;  1A85 A;  3LJT A;  2X3A A;  4A3W A;  5I3M A;  3RTT A;  3V96 B;  4G9L A;  4QKZ A;  2PJT A;  3G42 A;  1JKY A;  3P1V A;  1GO7 P;  2W14 A;  1Q3A A;  4H2E A;  3P24 A;  4HX3 A;  3ZVS A;  3K7N A;  5I4O A;  4DD8 A;  3KEK A;  3LIL A;  3B8Z A;  3KHI A;  3F15 A;  1BZS A;  2W0D A;  2DW1 A;  3I7G A;  5BOT A;  2X7M A;  1K7G A;  3DTI A;  3BA0 A;  4L19 A;  1GXD A;  1USN A;  5H8X A;  1XFU A;  4XM7 A;  1GKC A;  1AF0 A;  1OM7 A;  2AYK A;  1KAP P;  1XFY A;  3HBV P;  4XBH A;  1ZP5 A;  5B5P A;  3DPF A;  3WV1 A;  1BUD A;  1CGE A;  1FLS A;  1J7N A;  2W13 A;  1Y0V A;  3UVC A;  4I03 A;  4JP4 A;  5CZM A;  2DDF A;  2K9C A;  3TT4 A;  3EDG A;  4ON1 A;  5I2Z A;  1XAX A;  1R1I A;  3VI1 A;  1D5J A;  1OS2 A;  1GKD A;  1MMQ A;  2ERO A;  4AYK A;  1SRP A;  1CQR A;  4FVL A;  4WK7 A;  1QJJ A;  1JH1 A;  4ILW D;  4PKR A;  2K2G A;  3ZXH A;  966C A;  2OVX A;  2XS3 A;  2WO9 A;  2MZE A;  1ND1 A;  1SLN A;  1BSW A;  3HY9 A;  4DF9 A;  3MA2 A;  3WV2 A;  3DPE A;  1O0T A;  1O0Q A;  3HYG A;  3TVC A;  1PWQ A;  1IAB A;  1PWU A;  1L6J A;  1HV5 A;  5CXA A;  2D1O A;  4H76 A;  3LIK A;  1BKC I;  1ZS0 A;  1XFX A;  3OHO A;  5L7F A;  1BM6 A;  3KEC A;  1SMP A;  4PKV A;  4PKQ A;  1D8M A;  1ZVX A;  1I73 A;  2ERQ A;  4GUY A;  4H84 A;  3ZUK A;  2SRT A;  5JMY A;  1XFZ A;  3OHL A;  4L7A A;  2X3B A;  2A8H A;  3HDB A;  1SU3 A;  3F16 A;  1EB6 A;  1OO9 A;  3WV3 A;  3L0V A;  2JNP A;  4XCT A;  1XFW A;  1K7Q A;  2OY4 A;  5D1T A;  2OW1 A;  1HY7 A;  1XUC A;  3LUM A;  3DTE A;  1HFS A;  3AYU A;  1JJ9 A;  3E8R A;  4L63 A;  5BOY A;  5I0L A;  4A7B A;  4GWN A;  4FXQ A;  2CKI A;  2MLR A;  1A86 A;  2RJQ A;  3F1A A;  3LJZ A;  1JAO A;  5D1U A;  5I43 A;  1Y8J A;  3KME A;  1ZTQ A;  2WO8 A;  1OM8 A;  3LKA A;  5D2B A;  2J83 A;  3Q2H A;  3ELM A;  2HU6 A;  3VTG A;  4J4M A;  1YQY A;  1BUV M;  1YOU A;  2MZI A;  3KWV C;  4PKW A;  2JSD A;  1G4K A;  4GWM A;  1MMB A;  1CAQ A;  3Q2G A;  2FV5 A;  4H49 A;  3N2V A;  1XM5 A;  2N8R A;  2DW2 A;  2OY2 A;  5D3C A;  3TSK A;  3LJG A;  1KUH A;  1IAC A;  3U1R A;  4H1Q A;  4PKT A;  3AIG A;  1UTT A;  3F17 A;  2TCL A;  3DNG A;  1ZXV A;  2E2D A;  2XS4 A;  1BQO A;  4Q1L A;  3EHX A;  2W12 A;  1G49 A;  3LK8 A;  4PKU A;  3SHI A;  3DTK A;  3AYK A;  4JIJ A;  4XM8 A;  4G0D A;  4AXQ A;  1DTH A;  1CIZ A;  3LGP A;  1Y93 A;  4IJO A;  1C7K A;  4GR0 A;  2O3E A;  3KMC A;  2YIG A;  2L0R A;  3RTS A;  1QIA A;  1QIC A;  1UMT A;  4R3V A;  4JA1 A;  2D1N A;  1UMS A;  1R54 A;  2Y6D A;  1IAG A;  3B2Z A;  4H3X A;  1HOV A;  3F18 A;  1AYK A;  1GE7 A;  2YUF A;  1XUD A;  2YB9 A;  1CXV A;  2OVZ A;  4PKS A;  1Z3J A;  1EUB A;  4GR8 A;  2RJP A;  4CTH A;  1OS9 A;  3L0T A;  3LUN A;  2DDY A;  4EFS A;  2O36 A;  4H30 A;  4WKI A;  1ROS A;  1KUG A;  3N2U A;  3DSL A;  3NX7 A;  4ZR5 A;  1GE6 A;  1IAA A;  1WNI A;  3GBO A;  1GE5 A;  2JT6 A;  3DWB A;  2OXW A;  2Y6C A;  2X3C A;  4IUW A;  1TVI A;  1AKL A;  1JIW P;  5D7W A;  2OZR A;  1JIZ A;  1JK3 A;  1PWW A;  1XFV A;  4WF6 A;  2KRJ A;  1OMJ A;  5D1S A;  1BKC E;  3EDI A;  1HTD A;  2JT5 A;  2CLT A;  3USN A;  3O2X A;  1QIB A;  3KRY A;  1GO8 P;  830C A;  1ATL A;  3LQ0 A;  1B8Y A;  2OW9 A;  2V4B A;  5L79 A;  1KUK A;  1B3D A;  1IAE A;  1QUA A;  4GF1 A;  4GQL A;  1ZXC A;  3LEA A;  1JAQ A;  4FU4 A;  1D8F A;  1I76 A;  5I12 A;  2FV9 A;  2OXZ A;  4FXY P;  3B92 A;  1H71 P;  1IAD A;  1BQQ M;  1YP1 A;  3DL1 A;  1HFC A;  1G9K A;  3F19 A; 
#chains in the Genus database with same CATH homology
 3EHY A;  1BIW A;  1EAK A;  4JPA A;  1CK7 A;  2OXU A;  4AUO A;  4DPE A;  5B5O A;  1G12 A;  2WOA A;  1KBC A;  2I47 A;  2DW0 A;  1JAN A;  1D7X A;  1BKC A;  1R1H A;  1DMT A;  2J0T A;  3CKI A;  1YCM A;  4I35 A;  2MZH A;  1JAP A;  2OW2 A;  1AST A;  1QJI A;  1K7I A;  456C A;  3KEJ A;  1G05 A;  2OI0 A;  1CGF A;  1SAT A;  2AIG P;  3HDA P;  4L6T A;  1FM1 A;  1R1J A;  1MMP A;  3LE9 A;  1XUR A;  5CUH A;  1R55 A;  1C8T A;  2W15 A;  2QPJ A;  1KUI A;  1CGL A;  2Z2D A;  1S4B P;  4H82 A;  3K7L A;  2OW0 A;  3TS4 A;  1RMZ A;  2MLS A;  4GR3 A;  3I7I A;  1PWP A;  3EDZ A;  1PWV A;  1OM6 A;  1C3I A;  5LAB A;  1KUF A;  3O64 A;  2JIH A;  4WKE A;  2USN A;  3G5C A;  4WZV A;  4DV8 A;  3LMC A;  1MMR A;  3EDH A;  1SLM A;  5BPA A;  4HMA A;  1I1I P;  1UEA A;  3LIR A;  3LQB A;  2ERP A;  1FBL A;  2POJ A;  4JQG A;  3HBU P;  3EWJ A;  4IN9 A;  4XM6 A;  1RM8 A;  1MNC A;  4AIG A;  3HY7 A;  1UTZ A;  3HB2 P;  2E3X A;  1A85 A;  3LJT A;  2X3A A;  4A3W A;  5I3M A;  3RTT A;  3V96 B;  4G9L A;  4QKZ A;  2PJT A;  3G42 A;  1JKY A;  3P1V A;  1GO7 P;  2W14 A;  1Q3A A;  4H2E A;  3P24 A;  4HX3 A;  3ZVS A;  3K7N A;  5I4O A;  4DD8 A;  3KEK A;  3LIL A;  3B8Z A;  3KHI A;  3F15 A;  1BZS A;  2W0D A;  2DW1 A;  3I7G A;  5BOT A;  2X7M A;  1K7G A;  3DTI A;  3BA0 A;  4L19 A;  1GXD A;  1USN A;  5H8X A;  1XFU A;  4XM7 A;  1GKC A;  1AF0 A;  1OM7 A;  2AYK A;  1KAP P;  1XFY A;  3HBV P;  4XBH A;  1ZP5 A;  5B5P A;  3DPF A;  3WV1 A;  1BUD A;  1CGE A;  1FLS A;  1J7N A;  2W13 A;  1Y0V A;  3UVC A;  4I03 A;  4JP4 A;  5CZM A;  2DDF A;  2K9C A;  3TT4 A;  3EDG A;  4ON1 A;  5I2Z A;  1R1I A;  3VI1 A;  1D5J A;  1OS2 A;  1GKD A;  1MMQ A;  2ERO A;  4AYK A;  1SRP A;  1CQR A;  4FVL A;  4WK7 A;  1QJJ A;  1JH1 A;  4ILW D;  4PKR A;  2K2G A;  3ZXH A;  966C A;  2OVX A;  2XS3 A;  2WO9 A;  2MZE A;  1ND1 A;  1SLN A;  1BSW A;  3HY9 A;  4DF9 A;  3MA2 A;  3WV2 A;  3DPE A;  1O0T A;  1O0Q A;  3HYG A;  3TVC A;  1PWQ A;  1IAB A;  1PWU A;  1L6J A;  1HV5 A;  5CXA A;  2D1O A;  4H76 A;  3LIK A;  1BKC I;  1ZS0 A;  1XFX A;  3OHO A;  5L7F A;  1BM6 A;  3KEC A;  1SMP A;  4PKV A;  4PKQ A;  1D8M A;  1ZVX A;  1I73 A;  2ERQ A;  4GUY A;  4H84 A;  3ZUK A;  2SRT A;  5JMY A;  1XFZ A;  3OHL A;  4L7A A;  2X3B A;  2A8H A;  3HDB A;  1SU3 A;  3F16 A;  1EB6 A;  1OO9 A;  3WV3 A;  3L0V A;  2JNP A;  4XCT A;  1XFW A;  1K7Q A;  2OY4 A;  5D1T A;  2OW1 A;  1HY7 A;  1XUC A;  3LUM A;  3DTE A;  1HFS A;  3AYU A;  1JJ9 A;  3E8R A;  4L63 A;  5BOY A;  5I0L A;  4A7B A;  4GWN A;  4FXQ A;  2CKI A;  2MLR A;  1A86 A;  2RJQ A;  3F1A A;  3LJZ A;  1JAO A;  5D1U A;  5I43 A;  1Y8J A;  3KME A;  1ZTQ A;  2WO8 A;  1OM8 A;  3LKA A;  5D2B A;  2J83 A;  3Q2H A;  3ELM A;  2HU6 A;  3VTG A;  4J4M A;  1YQY A;  1BUV M;  1YOU A;  2MZI A;  3KWV C;  4PKW A;  2JSD A;  1G4K A;  4GWM A;  1MMB A;  1CAQ A;  3Q2G A;  2FV5 A;  4H49 A;  3N2V A;  2N8R A;  2DW2 A;  2OY2 A;  5D3C A;  3TSK A;  3LJG A;  1KUH A;  1IAC A;  3U1R A;  4H1Q A;  4PKT A;  3AIG A;  1UTT A;  3F17 A;  2TCL A;  3DNG A;  1ZXV A;  2E2D A;  2XS4 A;  1BQO A;  4Q1L A;  3EHX A;  2W12 A;  1G49 A;  3LK8 A;  4PKU A;  3SHI A;  3DTK A;  3AYK A;  4JIJ A;  4XM8 A;  4G0D A;  4AXQ A;  1DTH A;  1CIZ A;  3LGP A;  1Y93 A;  4IJO A;  1C7K A;  4GR0 A;  2O3E A;  3KMC A;  2YIG A;  2L0R A;  3RTS A;  1QIA A;  1QIC A;  1UMT A;  4R3V A;  4JA1 A;  2D1N A;  1UMS A;  1R54 A;  2Y6D A;  1IAG A;  3B2Z A;  4H3X A;  1HOV A;  3F18 A;  1AYK A;  1GE7 A;  2YUF A;  1XUD A;  2YB9 A;  1CXV A;  2OVZ A;  4PKS A;  1Z3J A;  1EUB A;  4GR8 A;  2RJP A;  4CTH A;  1OS9 A;  3L0T A;  3LUN A;  2DDY A;  4EFS A;  2O36 A;  4H30 A;  4WKI A;  1ROS A;  1KUG A;  3N2U A;  3DSL A;  3NX7 A;  4ZR5 A;  1GE6 A;  1IAA A;  1WNI A;  3GBO A;  1GE5 A;  2JT6 A;  3DWB A;  2OXW A;  2Y6C A;  2X3C A;  4IUW A;  1AKL A;  1JIW P;  5D7W A;  2OZR A;  1JIZ A;  1JK3 A;  1PWW A;  1XFV A;  4WF6 A;  2KRJ A;  1OMJ A;  5D1S A;  1BKC E;  3EDI A;  1HTD A;  2JT5 A;  2CLT A;  3USN A;  3O2X A;  1QIB A;  3KRY A;  1GO8 P;  830C A;  1ATL A;  3LQ0 A;  1B8Y A;  2OW9 A;  2V4B A;  5L79 A;  1KUK A;  1B3D A;  1IAE A;  1QUA A;  4GF1 A;  4GQL A;  1ZXC A;  3LEA A;  1JAQ A;  4FU4 A;  1D8F A;  1I76 A;  5I12 A;  2FV9 A;  2OXZ A;  4FXY P;  3B92 A;  1H71 P;  1IAD A;  1BQQ M;  1YP1 A;  3DL1 A;  1HFC A;  1G9K A;  3F19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...