3LKAA

Catalytic domain of human mmp-12 complexed with hydroxamic acid and paramethoxy-sulfonyl amide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Entropic contribution to the linking coefficient in fragment based drug design: a case study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lkaA00
3EDIA 3F18A 3CKIA 3DNGA 1IABA 5D2BA 4H1QA 3LIRA 1GE6A 1ZXCA 3DPFA 1PWUA 5L79A 1CK7A 1Z3JA 4A7BA 2J83A 2OW9A 1S4BP 5I4OA 3KRYA 1SRPA 4PKSA 5L7FA 1DTHA 2WOAA 1CGEA 2MZIA 3LQ0A 3WV3A 2W14A 1G49A 1QICA 3SHIA 4GR3A 1H71P 1C7KA 2EROA 2Z2DA 2OY2A 3ZVSA 4GR0A 3K7LA 1GXDA 3KMEA 1FLSA 2RJPA 3F15A 1O0TA 1A85A 4XCTA 3EWJA 4GWNA 3HYGA 5LABA 2USNA 4G0DA 1UMSA 4R3VA 3Q2HA 1BZSA 1HFCA 1Y8JA 830CA 1BUVM 4GF1A 3LJGA 3WV2A 2E3XA 1JIZA 1A86A 3GBOA 1CQRA 4HX3A 1J7NA 3U1RA 3N2UA 3KHIA 4IUWA 1AF0A 3LJTA 3P1VA 2DW1A 3LKAA 5I0LA 2OY4A 1XFWA 1OMJA 1JIWP 3EDGA 1Y0VA 3G5CA 1OS2A 4H3XA 1UTTA 1QUAA 1ZP5A 3LEAA 2X7MA 2J0TA 2D1NA 3ZXHA 2SRTA 1G05A 2W13A 2K9CA 1HY7A 1L6JA 3LUNA 4PKUA 5D7WA 4PKTA 2X3CA 1GE7A 1GO8P 1D7XA 1QIBA 4GWMA 1MNCA 3TVCA 1UEAA 1BUDA 4JQGA 3HBVP 1USNA 2D1OA 1ND1A 1XFXA 2OW1A 1UTZA 1IAEA 1PWWA 5I12A 1D8FA 3O64A 2N8RA 4ILWD 4ON1A 1ZS0A 2L0RA 2OI0A 4WF6A 2DDFA 2AIGP 1BKCE 1K7IA 1C8TA 1Y93A 1GKCA 1RM8A 4AUOA 1IAGA 1XFZA 5BOTA 5D1TA 2POJA 1HTDA 3LJZA 1ZVXA 2E2DA 1XFUA 1BKCI 1YQYA 1PWQA 1SLMA 3L0VA 3VI1A 3TS4A 1R55A 3B92A 1AYKA 2XS4A 4L63A 1R54A 3DSLA 1FM1A 1YOUA 3LE9A 2ERQA 1ROSA 1XUDA 1B3DA 3HDAP 1DMTA 1JJ9A 2V4BA 1JAPA 1SU3A 4WZVA 2XS3A 1CAQA 2Y6DA 1MMRA 1ASTA 3HY9A 3KEKA 4PKRA 2FV9A 5JMYA 3OHLA 1BIWA 2O3EA 1EUBA 5I43A 3KECA 4XM7A 1ZTQA 4AYKA 1D5JA 4PKVA 4WKEA 3K7NA 3LIKA 3G42A 4FVLA 4H30A 1UMTA 2MZHA 5D3CA 4IJOA 2MZEA 1KBCA 4FXYP 4XM6A 4DV8A 3AIGA 1GKDA 3OHOA 4DPEA 2O36A 4JP4A 3VTGA 1BQOA 1IAAA 3E8RA 2W0DA 456CA 1Q3AA 1I1IP 2DW0A 1SATA 2OXWA 5I3MA 2OXUA 4H82A 2KRJA 1KUFA 5H8XA 2CLTA 2K2GA 1MMBA 2OVXA 2YIGA 1RMZA 4I35A 1D8MA 3F16A 3LK8A 1FBLA 3I7IA 1B8YA 1JK3A 1G9KA 3EHYA 3TT4A 2AYKA 4WK7A 3KEJA 2JSDA 5BOYA 2OW0A 3I7GA 4XBHA 4DD8A 4Q1LA 1PWPA 2JT5A 1BSWA 1YCMA 2OVZA 1HV5A 4DF9A 5B5OA 2W15A 2ERPA 4PKQA 1IADA 2WO8A 1GO7P 1KUGA 3EHXA 5CUHA 3LMCA 4AIGA 4H76A 3ZUKA 1R1IA 4JA1A 1XURA 2JNPA 3F19A 4GR8A 1KUKA 4I03A 2A8HA 3O2XA 3F17A 2CKIA 2PJTA 3USNA 2W12A 3LUMA 2RJQA 3P24A 1KAPP 4ZR5A 2MLSA 3B8ZA 3HBUP 3UVCA 3NX7A 1XFVA 3KMCA 3EDHA 1AKLA 2OXZA 966CA 3BA0A 4FXQA 1R1JA 4EFSA 5D1UA 2TCLA 1R1HA 2HU6A 1K7GA 1G12A 1BKCA 4IN9A 3DWBA 1BQQM 3DL1A 1IACA 1MMPA 4PKWA 2OW2A 4GUYA 2DW2A 4H49A 3LILA 1YP1A 1XFYA 4A3WA 1OM7A 2YB9A 3V96B 2I47A 1KUIA 1QIAA 1JKYA 3WV1A 1EAKA 1JANA 1G4KA 3MA2A 1K7QA 1JH1A 4L19A 3HDBA 4JPAA 1SMPA 5CZMA 5B5PA 1CGLA 1JAQA 2JT6A 1OM6A 1OM8A 4WKIA 1XUCA 3LGPA 1O0QA 3ELMA 3F1AA 3L0TA 4HMAA 3KWVC 1CGFA 4H84A 1HFSA 1WNIA 1CIZA 3N2VA 4FU4A 4CTHA 4J4MA 3LQBA 3AYKA 2FV5A 1OO9A 3HY7A 1SLNA 4G9LA 1OS9A 3HB2P 2MLRA 1I73A 2X3AA 5BPAA 1HOVA 1JAOA 3B2ZA 2JIHA 2Y6CA 5D1SA 4AXQA 1ZXVA 2OZRA 1I76A 1QJJA 1PWVA 3TSKA 3EDZA 1KUHA 1MMQA 3RTTA 3Q2GA 2DDYA 4L6TA 4JIJA 1QJIA 3DPEA 1BM6A 5I2ZA 1EB6A 2QPJA 3AYUA 4GQLA 1GE5A 5CXAA 3RTSA 2X3BA 4H2EA 4QKZA 4XM8A 1ATLA 2WO9A 1CXVA 1C3IA
chains in the Genus database with same CATH superfamily
3EDIA 3F18A 3CKIA 3DNGA 1IABA 5D2BA 4H1QA 3LIRA 1GE6A 1ZXCA 3DPFA 1PWUA 5L79A 1CK7A 1Z3JA 4A7BA 2J83A 2OW9A 1S4BP 5I4OA 3KRYA 1SRPA 4PKSA 5L7FA 1DTHA 2WOAA 1CGEA 2MZIA 3LQ0A 3WV3A 2W14A 1G49A 1QICA 3SHIA 4GR3A 1H71P 1C7KA 2EROA 2Z2DA 2OY2A 3ZVSA 4GR0A 3K7LA 1GXDA 3KMEA 1FLSA 2RJPA 3F15A 1O0TA 1A85A 4XCTA 3EWJA 4GWNA 3HYGA 5LABA 2USNA 4G0DA 1UMSA 4R3VA 3Q2HA 1BZSA 1HFCA 1Y8JA 830CA 1BUVM 4GF1A 3LJGA 3WV2A 2E3XA 1JIZA 1A86A 3GBOA 1CQRA 4HX3A 1J7NA 3U1RA 3N2UA 3KHIA 4IUWA 1AF0A 3LJTA 3P1VA 2DW1A 3LKAA 5I0LA 2OY4A 1XFWA 1OMJA 1JIWP 3EDGA 1Y0VA 3G5CA 1OS2A 4H3XA 1UTTA 1QUAA 1ZP5A 3LEAA 2X7MA 2J0TA 2D1NA 3ZXHA 2SRTA 1G05A 2W13A 2K9CA 1HY7A 1L6JA 3LUNA 4PKUA 5D7WA 4PKTA 2X3CA 1GE7A 1GO8P 1D7XA 1QIBA 4GWMA 1MNCA 3TVCA 1UEAA 1BUDA 4JQGA 3HBVP 1USNA 2D1OA 1ND1A 1XFXA 2OW1A 1UTZA 1IAEA 1PWWA 5I12A 1D8FA 3O64A 2N8RA 4ILWD 4ON1A 1ZS0A 2L0RA 2OI0A 4WF6A 2DDFA 2AIGP 1BKCE 1K7IA 1C8TA 1Y93A 1GKCA 1RM8A 4AUOA 1IAGA 1XFZA 5BOTA 5D1TA 2POJA 1HTDA 4L7AA 3LJZA 1ZVXA 2E2DA 1XFUA 1BKCI 1YQYA 1PWQA 2YUFA 3DTEA 1SLMA 3L0VA 3VI1A 3TS4A 1R55A 3B92A 1AYKA 2XS4A 4L63A 1R54A 3DSLA 1FM1A 1YOUA 3LE9A 2ERQA 3HDAP 1ROSA 1B3DA 1XUDA 1DMTA 1JJ9A 2V4BA 1JAPA 1SU3A 4WZVA 2XS3A 1CAQA 2Y6DA 1MMRA 1ASTA 3HY9A 3KEKA 4PKRA 2FV9A 5JMYA 3OHLA 1BIWA 2O3EA 1EUBA 5I43A 3KECA 4XM7A 1ZTQA 1TVIA 4AYKA 1D5JA 4PKVA 4WKEA 3K7NA 3LIKA 3G42A 4FVLA 4H30A 1UMTA 2MZHA 5D3CA 4IJOA 2MZEA 1KBCA 4FXYP 4XM6A 4DV8A 3AIGA 1GKDA 3OHOA 4DPEA 2O36A 4JP4A 3VTGA 1BQOA 1IAAA 3E8RA 2W0DA 456CA 1Q3AA 1I1IP 2DW0A 1SATA 2OXWA 5I3MA 2OXUA 4H82A 2KRJA 1KUFA 5H8XA 2CLTA 2K2GA 1MMBA 2OVXA 2YIGA 1RMZA 4I35A 1D8MA 3F16A 1XAXA 3LK8A 1FBLA 3I7IA 1B8YA 1JK3A 1G9KA 3EHYA 3TT4A 2AYKA 4WK7A 3KEJA 2JSDA 5BOYA 2OW0A 3I7GA 4XBHA 4DD8A 4Q1LA 1PWPA 2JT5A 1BSWA 1YCMA 2OVZA 1HV5A 4DF9A 5B5OA 2W15A 2ERPA 4PKQA 1IADA 2WO8A 1GO7P 1KUGA 3EHXA 5CUHA 3LMCA 4AIGA 4H76A 3ZUKA 1R1IA 1XM5A 4JA1A 1XURA 2JNPA 3F19A 4GR8A 1KUKA 4I03A 2A8HA 3O2XA 3F17A 2CKIA 2PJTA 3USNA 3DTIA 2W12A 3LUMA 2RJQA 3P24A 1KAPP 4ZR5A 2MLSA 3B8ZA 3HBUP 3UVCA 3NX7A 1XFVA 3KMCA 3EDHA 1AKLA 2OXZA 966CA 3BA0A 4FXQA 1R1JA 4EFSA 5D1UA 2TCLA 1R1HA 2HU6A 1K7GA 1G12A 1BKCA 4IN9A 3DWBA 1BQQM 3DL1A 1IACA 1MMPA 4PKWA 2OW2A 4GUYA 2DW2A 4H49A 3LILA 1YP1A 1XFYA 4A3WA 1OM7A 2YB9A 3V96B 2I47A 1KUIA 1QIAA 1JKYA 3WV1A 1EAKA 1JANA 1G4KA 3MA2A 1K7QA 1JH1A 4L19A 3HDBA 4JPAA 1SMPA 5CZMA 3DTKA 1CGLA 5B5PA 1OZ9A 1JAQA 2JT6A 1OM6A 1OM8A 4WKIA 1XUCA 3LGPA 1O0QA 3ELMA 3F1AA 3L0TA 4HMAA 3KWVC 1CGFA 4H84A 1HFSA 1WNIA 1CIZA 3N2VA 4FU4A 4CTHA 4J4MA 3LQBA 3AYKA 2FV5A 1OO9A 3HY7A 1SLNA 4G9LA 1OS9A 3HB2P 2MLRA 1I73A 2X3AA 5BPAA 1HOVA 1JAOA 3B2ZA 2JIHA 2Y6CA 5D1SA 4AXQA 1ZXVA 2OZRA 1I76A 1QJJA 1PWVA 3TSKA 3EDZA 1KUHA 1MMQA 3RTTA 3Q2GA 2DDYA 4L6TA 4JIJA 1QJIA 3DPEA 1BM6A 5I2ZA 1EB6A 2QPJA 3AYUA 4GQLA 1GE5A 5CXAA 3RTSA 2X3BA 4H2EA 4QKZA 4XM8A 1ATLA 2WO9A 1CXVA 1C3IA
chains in the Genus database with same CATH topology
3EDIA 3F18A 3CKIA 3DNGA 1IABA 5D2BA 4H1QA 3LIRA 1GE6A 1ZXCA 3DPFA 1PWUA 5L79A 1CK7A 1Z3JA 4A7BA 2J83A 2OW9A 1S4BP 5I4OA 3KRYA 1SRPA 4PKSA 5L7FA 1DTHA 2WOAA 1CGEA 2MZIA 3LQ0A 3WV3A 2W14A 1G49A 1QICA 3SHIA 4GR3A 1H71P 1C7KA 2EROA 2Z2DA 2OY2A 3ZVSA 4GR0A 3K7LA 1GXDA 3KMEA 1FLSA 2RJPA 3F15A 1O0TA 1A85A 4XCTA 3EWJA 4GWNA 3HYGA 5LABA 2USNA 4G0DA 1UMSA 4R3VA 3Q2HA 1BZSA 1HFCA 1Y8JA 830CA 1BUVM 4GF1A 3LJGA 3WV2A 2E3XA 1JIZA 1A86A 3GBOA 1CQRA 4HX3A 1J7NA 3U1RA 3N2UA 3KHIA 4IUWA 1AF0A 3LJTA 3P1VA 2DW1A 3LKAA 5I0LA 2OY4A 1XFWA 1OMJA 1JIWP 3EDGA 1Y0VA 3G5CA 1OS2A 4H3XA 1UTTA 1QUAA 1ZP5A 3LEAA 2X7MA 2J0TA 2D1NA 3ZXHA 2SRTA 1G05A 2W13A 2K9CA 1HY7A 1L6JA 3LUNA 4PKUA 5D7WA 4PKTA 2X3CA 1GE7A 1GO8P 1D7XA 1QIBA 4GWMA 1MNCA 3TVCA 1UEAA 1BUDA 4JQGA 3HBVP 1USNA 2D1OA 1ND1A 1XFXA 2OW1A 1UTZA 1IAEA 1PWWA 5I12A 1D8FA 3O64A 2N8RA 4ILWD 4ON1A 1ZS0A 2L0RA 2OI0A 4WF6A 2DDFA 2AIGP 1BKCE 1K7IA 1C8TA 1Y93A 1GKCA 1RM8A 4AUOA 1IAGA 1XFZA 5BOTA 5D1TA 2POJA 1HTDA 4L7AA 3LJZA 1ZVXA 2E2DA 1XFUA 1BKCI 1YQYA 1PWQA 2YUFA 3DTEA 1SLMA 3L0VA 3VI1A 3TS4A 1R55A 3B92A 1AYKA 2XS4A 4L63A 1R54A 3DSLA 1FM1A 1YOUA 3LE9A 2ERQA 1ROSA 1XUDA 1B3DA 3HDAP 1DMTA 1JJ9A 2V4BA 1JAPA 1SU3A 4WZVA 2XS3A 1CAQA 2Y6DA 1MMRA 1ASTA 3HY9A 3KEKA 4PKRA 2FV9A 5JMYA 3OHLA 1BIWA 2O3EA 1EUBA 5I43A 3KECA 4XM7A 1ZTQA 4AYKA 1D5JA 4PKVA 4WKEA 3K7NA 3LIKA 3G42A 4FVLA 4H30A 1UMTA 2MZHA 5D3CA 4IJOA 2MZEA 1KBCA 4FXYP 4XM6A 4DV8A 3AIGA 1GKDA 3OHOA 4DPEA 2O36A 4JP4A 3VTGA 1BQOA 1IAAA 3E8RA 2W0DA 456CA 1Q3AA 1I1IP 2DW0A 1SATA 2OXWA 5I3MA 2OXUA 4H82A 2KRJA 1KUFA 5H8XA 2CLTA 2K2GA 1MMBA 2OVXA 2YIGA 1RMZA 4I35A 1D8MA 3F16A 3LK8A 1FBLA 3I7IA 1B8YA 1JK3A 1G9KA 3EHYA 3TT4A 2AYKA 4WK7A 3KEJA 2JSDA 5BOYA 2OW0A 3I7GA 4XBHA 4DD8A 4Q1LA 1PWPA 2JT5A 1BSWA 1YCMA 2OVZA 1HV5A 4DF9A 5B5OA 2W15A 2ERPA 4PKQA 1IADA 2WO8A 1GO7P 1KUGA 3EHXA 5CUHA 3LMCA 4AIGA 4H76A 3ZUKA 1R1IA 4JA1A 1XURA 2JNPA 3F19A 4GR8A 1KUKA 4I03A 2A8HA 3O2XA 3F17A 2CKIA 2PJTA 3USNA 3DTIA 2W12A 3LUMA 2RJQA 3P24A 1KAPP 4ZR5A 2MLSA 3B8ZA 3HBUP 3UVCA 3NX7A 1XFVA 3KMCA 3EDHA 1AKLA 2OXZA 966CA 3BA0A 4FXQA 1R1JA 4EFSA 5D1UA 2TCLA 1R1HA 2HU6A 1K7GA 1G12A 1BKCA 4IN9A 3DWBA 1BQQM 3DL1A 1IACA 1MMPA 4PKWA 2OW2A 4GUYA 2DW2A 4H49A 3LILA 1YP1A 1XFYA 4A3WA 1OM7A 2YB9A 3V96B 2I47A 1KUIA 1QIAA 1JKYA 3WV1A 1EAKA 1JANA 1G4KA 3MA2A 1K7QA 1JH1A 4L19A 3HDBA 4JPAA 1SMPA 5CZMA 3DTKA 1CGLA 5B5PA 1JAQA 2JT6A 1OM6A 1OM8A 4WKIA 1XUCA 3LGPA 1O0QA 3ELMA 3F1AA 3L0TA 4HMAA 3KWVC 1CGFA 4H84A 1HFSA 1WNIA 1CIZA 3N2VA 4FU4A 4CTHA 4J4MA 3LQBA 3AYKA 2FV5A 1OO9A 3HY7A 1SLNA 4G9LA 1OS9A 3HB2P 2MLRA 1I73A 2X3AA 5BPAA 1HOVA 1JAOA 3B2ZA 2JIHA 2Y6CA 5D1SA 4AXQA 1ZXVA 2OZRA 1I76A 1QJJA 1PWVA 3TSKA 3EDZA 1KUHA 1MMQA 3RTTA 3Q2GA 2DDYA 4L6TA 4JIJA 1QJIA 3DPEA 1BM6A 5I2ZA 1EB6A 2QPJA 3AYUA 4GQLA 1GE5A 5CXAA 3RTSA 2X3BA 4H2EA 4QKZA 4XM8A 1ATLA 2WO9A 1CXVA 1C3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDI A;  3F18 A;  3CKI A;  3DNG A;  1IAB A;  5D2B A;  4H1Q A;  3LIR A;  1GE6 A;  1ZXC A;  3DPF A;  1PWU A;  5L79 A;  1CK7 A;  1Z3J A;  4A7B A;  2J83 A;  2OW9 A;  1S4B P;  5I4O A;  3KRY A;  1SRP A;  4PKS A;  5L7F A;  1DTH A;  2WOA A;  1CGE A;  2MZI A;  3LQ0 A;  3WV3 A;  2W14 A;  1G49 A;  1QIC A;  3SHI A;  4GR3 A;  1H71 P;  1C7K A;  2ERO A;  2Z2D A;  2OY2 A;  3ZVS A;  4GR0 A;  3K7L A;  1GXD A;  3KME A;  1FLS A;  2RJP A;  3F15 A;  1O0T A;  1A85 A;  4XCT A;  3EWJ A;  4GWN A;  3HYG A;  5LAB A;  2USN A;  4G0D A;  1UMS A;  4R3V A;  3Q2H A;  1BZS A;  1HFC A;  1Y8J A;  830C A;  1BUV M;  4GF1 A;  3LJG A;  3WV2 A;  2E3X A;  1JIZ A;  1A86 A;  3GBO A;  1CQR A;  4HX3 A;  1J7N A;  3U1R A;  3N2U A;  3KHI A;  4IUW A;  1AF0 A;  3LJT A;  3P1V A;  2DW1 A;  3LKA A;  5I0L A;  2OY4 A;  1XFW A;  1OMJ A;  1JIW P;  3EDG A;  1Y0V A;  3G5C A;  1OS2 A;  4H3X A;  1UTT A;  1QUA A;  1ZP5 A;  3LEA A;  2X7M A;  2J0T A;  2D1N A;  3ZXH A;  2SRT A;  1G05 A;  2W13 A;  2K9C A;  1HY7 A;  1L6J A;  3LUN A;  4PKU A;  5D7W A;  4PKT A;  2X3C A;  1GE7 A;  1GO8 P;  1D7X A;  1QIB A;  4GWM A;  1MNC A;  3TVC A;  1UEA A;  1BUD A;  4JQG A;  3HBV P;  1USN A;  2D1O A;  1ND1 A;  1XFX A;  2OW1 A;  1UTZ A;  1IAE A;  1PWW A;  5I12 A;  1D8F A;  3O64 A;  2N8R A;  4ILW D;  4ON1 A;  1ZS0 A;  2L0R A;  2OI0 A;  4WF6 A;  2DDF A;  2AIG P;  1BKC E;  1K7I A;  1C8T A;  1Y93 A;  1GKC A;  1RM8 A;  4AUO A;  1IAG A;  1XFZ A;  5BOT A;  5D1T A;  2POJ A;  1HTD A;  3LJZ A;  1ZVX A;  2E2D A;  1XFU A;  1BKC I;  1YQY A;  1PWQ A;  1SLM A;  3L0V A;  3VI1 A;  3TS4 A;  1R55 A;  3B92 A;  1AYK A;  2XS4 A;  4L63 A;  1R54 A;  3DSL A;  1FM1 A;  1YOU A;  3LE9 A;  2ERQ A;  1ROS A;  1XUD A;  1B3D A;  3HDA P;  1DMT A;  1JJ9 A;  2V4B A;  1JAP A;  1SU3 A;  4WZV A;  2XS3 A;  1CAQ A;  2Y6D A;  1MMR A;  1AST A;  3HY9 A;  3KEK A;  4PKR A;  2FV9 A;  5JMY A;  3OHL A;  1BIW A;  2O3E A;  1EUB A;  5I43 A;  3KEC A;  4XM7 A;  1ZTQ A;  4AYK A;  1D5J A;  4PKV A;  4WKE A;  3K7N A;  3LIK A;  3G42 A;  4FVL A;  4H30 A;  1UMT A;  2MZH A;  5D3C A;  4IJO A;  2MZE A;  1KBC A;  4FXY P;  4XM6 A;  4DV8 A;  3AIG A;  1GKD A;  3OHO A;  4DPE A;  2O36 A;  4JP4 A;  3VTG A;  1BQO A;  1IAA A;  3E8R A;  2W0D A;  456C A;  1Q3A A;  1I1I P;  2DW0 A;  1SAT A;  2OXW A;  5I3M A;  2OXU A;  4H82 A;  2KRJ A;  1KUF A;  5H8X A;  2CLT A;  2K2G A;  1MMB A;  2OVX A;  2YIG A;  1RMZ A;  4I35 A;  1D8M A;  3F16 A;  3LK8 A;  1FBL A;  3I7I A;  1B8Y A;  1JK3 A;  1G9K A;  3EHY A;  3TT4 A;  2AYK A;  4WK7 A;  3KEJ A;  2JSD A;  5BOY A;  2OW0 A;  3I7G A;  4XBH A;  4DD8 A;  4Q1L A;  1PWP A;  2JT5 A;  1BSW A;  1YCM A;  2OVZ A;  1HV5 A;  4DF9 A;  5B5O A;  2W15 A;  2ERP A;  4PKQ A;  1IAD A;  2WO8 A;  1GO7 P;  1KUG A;  3EHX A;  5CUH A;  3LMC A;  4AIG A;  4H76 A;  3ZUK A;  1R1I A;  4JA1 A;  1XUR A;  2JNP A;  3F19 A;  4GR8 A;  1KUK A;  4I03 A;  2A8H A;  3O2X A;  3F17 A;  2CKI A;  2PJT A;  3USN A;  2W12 A;  3LUM A;  2RJQ A;  3P24 A;  1KAP P;  4ZR5 A;  2MLS A;  3B8Z A;  3HBU P;  3UVC A;  3NX7 A;  1XFV A;  3KMC A;  3EDH A;  1AKL A;  2OXZ A;  966C A;  3BA0 A;  4FXQ A;  1R1J A;  4EFS A;  5D1U A;  2TCL A;  1R1H A;  2HU6 A;  1K7G A;  1G12 A;  1BKC A;  4IN9 A;  3DWB A;  1BQQ M;  3DL1 A;  1IAC A;  1MMP A;  4PKW A;  2OW2 A;  4GUY A;  2DW2 A;  4H49 A;  3LIL A;  1YP1 A;  1XFY A;  4A3W A;  1OM7 A;  2YB9 A;  3V96 B;  2I47 A;  1KUI A;  1QIA A;  1JKY A;  3WV1 A;  1EAK A;  1JAN A;  1G4K A;  3MA2 A;  1K7Q A;  1JH1 A;  4L19 A;  3HDB A;  4JPA A;  1SMP A;  5CZM A;  5B5P A;  1CGL A;  1JAQ A;  2JT6 A;  1OM6 A;  1OM8 A;  4WKI A;  1XUC A;  3LGP A;  1O0Q A;  3ELM A;  3F1A A;  3L0T A;  4HMA A;  3KWV C;  1CGF A;  4H84 A;  1HFS A;  1WNI A;  1CIZ A;  3N2V A;  4FU4 A;  4CTH A;  4J4M A;  3LQB A;  3AYK A;  2FV5 A;  1OO9 A;  3HY7 A;  1SLN A;  4G9L A;  1OS9 A;  3HB2 P;  2MLR A;  1I73 A;  2X3A A;  5BPA A;  1HOV A;  1JAO A;  3B2Z A;  2JIH A;  2Y6C A;  5D1S A;  4AXQ A;  1ZXV A;  2OZR A;  1I76 A;  1QJJ A;  1PWV A;  3TSK A;  3EDZ A;  1KUH A;  1MMQ A;  3RTT A;  3Q2G A;  2DDY A;  4L6T A;  4JIJ A;  1QJI A;  3DPE A;  1BM6 A;  5I2Z A;  1EB6 A;  2QPJ A;  3AYU A;  4GQL A;  1GE5 A;  5CXA A;  3RTS A;  2X3B A;  4H2E A;  4QKZ A;  4XM8 A;  1ATL A;  2WO9 A;  1CXV A;  1C3I A; 
#chains in the Genus database with same CATH topology
 3EDI A;  3F18 A;  3CKI A;  3DNG A;  1IAB A;  5D2B A;  4H1Q A;  3LIR A;  1GE6 A;  1ZXC A;  3DPF A;  1PWU A;  5L79 A;  1CK7 A;  1Z3J A;  4A7B A;  2J83 A;  2OW9 A;  1S4B P;  5I4O A;  3KRY A;  1SRP A;  4PKS A;  5L7F A;  1DTH A;  2WOA A;  1CGE A;  2MZI A;  3LQ0 A;  3WV3 A;  2W14 A;  1G49 A;  1QIC A;  3SHI A;  4GR3 A;  1H71 P;  1C7K A;  2ERO A;  2Z2D A;  2OY2 A;  3ZVS A;  4GR0 A;  3K7L A;  1GXD A;  3KME A;  1FLS A;  2RJP A;  3F15 A;  1O0T A;  1A85 A;  4XCT A;  3EWJ A;  4GWN A;  3HYG A;  5LAB A;  2USN A;  4G0D A;  1UMS A;  4R3V A;  3Q2H A;  1BZS A;  1HFC A;  1Y8J A;  830C A;  1BUV M;  4GF1 A;  3LJG A;  3WV2 A;  2E3X A;  1JIZ A;  1A86 A;  3GBO A;  1CQR A;  4HX3 A;  1J7N A;  3U1R A;  3N2U A;  3KHI A;  4IUW A;  1AF0 A;  3LJT A;  3P1V A;  2DW1 A;  3LKA A;  5I0L A;  2OY4 A;  1XFW A;  1OMJ A;  1JIW P;  3EDG A;  1Y0V A;  3G5C A;  1OS2 A;  4H3X A;  1UTT A;  1QUA A;  1ZP5 A;  3LEA A;  2X7M A;  2J0T A;  2D1N A;  3ZXH A;  2SRT A;  1G05 A;  2W13 A;  2K9C A;  1HY7 A;  1L6J A;  3LUN A;  4PKU A;  5D7W A;  4PKT A;  2X3C A;  1GE7 A;  1GO8 P;  1D7X A;  1QIB A;  4GWM A;  1MNC A;  3TVC A;  1UEA A;  1BUD A;  4JQG A;  3HBV P;  1USN A;  2D1O A;  1ND1 A;  1XFX A;  2OW1 A;  1UTZ A;  1IAE A;  1PWW A;  5I12 A;  1D8F A;  3O64 A;  2N8R A;  4ILW D;  4ON1 A;  1ZS0 A;  2L0R A;  2OI0 A;  4WF6 A;  2DDF A;  2AIG P;  1BKC E;  1K7I A;  1C8T A;  1Y93 A;  1GKC A;  1RM8 A;  4AUO A;  1IAG A;  1XFZ A;  5BOT A;  5D1T A;  2POJ A;  1HTD A;  4L7A A;  3LJZ A;  1ZVX A;  2E2D A;  1XFU A;  1BKC I;  1YQY A;  1PWQ A;  2YUF A;  3DTE A;  1SLM A;  3L0V A;  3VI1 A;  3TS4 A;  1R55 A;  3B92 A;  1AYK A;  2XS4 A;  4L63 A;  1R54 A;  3DSL A;  1FM1 A;  1YOU A;  3LE9 A;  2ERQ A;  3HDA P;  1ROS A;  1B3D A;  1XUD A;  1DMT A;  1JJ9 A;  2V4B A;  1JAP A;  1SU3 A;  4WZV A;  2XS3 A;  1CAQ A;  2Y6D A;  1MMR A;  1AST A;  3HY9 A;  3KEK A;  4PKR A;  2FV9 A;  5JMY A;  3OHL A;  1BIW A;  2O3E A;  1EUB A;  5I43 A;  3KEC A;  4XM7 A;  1ZTQ A;  1TVI A;  4AYK A;  1D5J A;  4PKV A;  4WKE A;  3K7N A;  3LIK A;  3G42 A;  4FVL A;  4H30 A;  1UMT A;  2MZH A;  5D3C A;  4IJO A;  2MZE A;  1KBC A;  4FXY P;  4XM6 A;  4DV8 A;  3AIG A;  1GKD A;  3OHO A;  4DPE A;  2O36 A;  4JP4 A;  3VTG A;  1BQO A;  1IAA A;  3E8R A;  2W0D A;  456C A;  1Q3A A;  1I1I P;  2DW0 A;  1SAT A;  2OXW A;  5I3M A;  2OXU A;  4H82 A;  2KRJ A;  1KUF A;  5H8X A;  2CLT A;  2K2G A;  1MMB A;  2OVX A;  2YIG A;  1RMZ A;  4I35 A;  1D8M A;  3F16 A;  1XAX A;  3LK8 A;  1FBL A;  3I7I A;  1B8Y A;  1JK3 A;  1G9K A;  3EHY A;  3TT4 A;  2AYK A;  4WK7 A;  3KEJ A;  2JSD A;  5BOY A;  2OW0 A;  3I7G A;  4XBH A;  4DD8 A;  4Q1L A;  1PWP A;  2JT5 A;  1BSW A;  1YCM A;  2OVZ A;  1HV5 A;  4DF9 A;  5B5O A;  2W15 A;  2ERP A;  4PKQ A;  1IAD A;  2WO8 A;  1GO7 P;  1KUG A;  3EHX A;  5CUH A;  3LMC A;  4AIG A;  4H76 A;  3ZUK A;  1R1I A;  1XM5 A;  4JA1 A;  1XUR A;  2JNP A;  3F19 A;  4GR8 A;  1KUK A;  4I03 A;  2A8H A;  3O2X A;  3F17 A;  2CKI A;  2PJT A;  3USN A;  3DTI A;  2W12 A;  3LUM A;  2RJQ A;  3P24 A;  1KAP P;  4ZR5 A;  2MLS A;  3B8Z A;  3HBU P;  3UVC A;  3NX7 A;  1XFV A;  3KMC A;  3EDH A;  1AKL A;  2OXZ A;  966C A;  3BA0 A;  4FXQ A;  1R1J A;  4EFS A;  5D1U A;  2TCL A;  1R1H A;  2HU6 A;  1K7G A;  1G12 A;  1BKC A;  4IN9 A;  3DWB A;  1BQQ M;  3DL1 A;  1IAC A;  1MMP A;  4PKW A;  2OW2 A;  4GUY A;  2DW2 A;  4H49 A;  3LIL A;  1YP1 A;  1XFY A;  4A3W A;  1OM7 A;  2YB9 A;  3V96 B;  2I47 A;  1KUI A;  1QIA A;  1JKY A;  3WV1 A;  1EAK A;  1JAN A;  1G4K A;  3MA2 A;  1K7Q A;  1JH1 A;  4L19 A;  3HDB A;  4JPA A;  1SMP A;  5CZM A;  3DTK A;  1CGL A;  5B5P A;  1OZ9 A;  1JAQ A;  2JT6 A;  1OM6 A;  1OM8 A;  4WKI A;  1XUC A;  3LGP A;  1O0Q A;  3ELM A;  3F1A A;  3L0T A;  4HMA A;  3KWV C;  1CGF A;  4H84 A;  1HFS A;  1WNI A;  1CIZ A;  3N2V A;  4FU4 A;  4CTH A;  4J4M A;  3LQB A;  3AYK A;  2FV5 A;  1OO9 A;  3HY7 A;  1SLN A;  4G9L A;  1OS9 A;  3HB2 P;  2MLR A;  1I73 A;  2X3A A;  5BPA A;  1HOV A;  1JAO A;  3B2Z A;  2JIH A;  2Y6C A;  5D1S A;  4AXQ A;  1ZXV A;  2OZR A;  1I76 A;  1QJJ A;  1PWV A;  3TSK A;  3EDZ A;  1KUH A;  1MMQ A;  3RTT A;  3Q2G A;  2DDY A;  4L6T A;  4JIJ A;  1QJI A;  3DPE A;  1BM6 A;  5I2Z A;  1EB6 A;  2QPJ A;  3AYU A;  4GQL A;  1GE5 A;  5CXA A;  3RTS A;  2X3B A;  4H2E A;  4QKZ A;  4XM8 A;  1ATL A;  2WO9 A;  1CXV A;  1C3I A; 
#chains in the Genus database with same CATH homology
 3EDI A;  3F18 A;  3CKI A;  3DNG A;  1IAB A;  5D2B A;  4H1Q A;  3LIR A;  1GE6 A;  1ZXC A;  3DPF A;  1PWU A;  5L79 A;  1CK7 A;  1Z3J A;  4A7B A;  2J83 A;  2OW9 A;  1S4B P;  5I4O A;  3KRY A;  1SRP A;  4PKS A;  5L7F A;  1DTH A;  2WOA A;  1CGE A;  2MZI A;  3LQ0 A;  3WV3 A;  2W14 A;  1G49 A;  1QIC A;  3SHI A;  4GR3 A;  1H71 P;  1C7K A;  2ERO A;  2Z2D A;  2OY2 A;  3ZVS A;  4GR0 A;  3K7L A;  1GXD A;  3KME A;  1FLS A;  2RJP A;  3F15 A;  1O0T A;  1A85 A;  4XCT A;  3EWJ A;  4GWN A;  3HYG A;  5LAB A;  2USN A;  4G0D A;  1UMS A;  4R3V A;  3Q2H A;  1BZS A;  1HFC A;  1Y8J A;  830C A;  1BUV M;  4GF1 A;  3LJG A;  3WV2 A;  2E3X A;  1JIZ A;  1A86 A;  3GBO A;  1CQR A;  4HX3 A;  1J7N A;  3U1R A;  3N2U A;  3KHI A;  4IUW A;  1AF0 A;  3LJT A;  3P1V A;  2DW1 A;  3LKA A;  5I0L A;  2OY4 A;  1XFW A;  1OMJ A;  1JIW P;  3EDG A;  1Y0V A;  3G5C A;  1OS2 A;  4H3X A;  1UTT A;  1QUA A;  1ZP5 A;  3LEA A;  2X7M A;  2J0T A;  2D1N A;  3ZXH A;  2SRT A;  1G05 A;  2W13 A;  2K9C A;  1HY7 A;  1L6J A;  3LUN A;  4PKU A;  5D7W A;  4PKT A;  2X3C A;  1GE7 A;  1GO8 P;  1D7X A;  1QIB A;  4GWM A;  1MNC A;  3TVC A;  1UEA A;  1BUD A;  4JQG A;  3HBV P;  1USN A;  2D1O A;  1ND1 A;  1XFX A;  2OW1 A;  1UTZ A;  1IAE A;  1PWW A;  5I12 A;  1D8F A;  3O64 A;  2N8R A;  4ILW D;  4ON1 A;  1ZS0 A;  2L0R A;  2OI0 A;  4WF6 A;  2DDF A;  2AIG P;  1BKC E;  1K7I A;  1C8T A;  1Y93 A;  1GKC A;  1RM8 A;  4AUO A;  1IAG A;  1XFZ A;  5BOT A;  5D1T A;  2POJ A;  1HTD A;  4L7A A;  3LJZ A;  1ZVX A;  2E2D A;  1XFU A;  1BKC I;  1YQY A;  1PWQ A;  2YUF A;  3DTE A;  1SLM A;  3L0V A;  3VI1 A;  3TS4 A;  1R55 A;  3B92 A;  1AYK A;  2XS4 A;  4L63 A;  1R54 A;  3DSL A;  1FM1 A;  1YOU A;  3LE9 A;  2ERQ A;  1ROS A;  1XUD A;  1B3D A;  3HDA P;  1DMT A;  1JJ9 A;  2V4B A;  1JAP A;  1SU3 A;  4WZV A;  2XS3 A;  1CAQ A;  2Y6D A;  1MMR A;  1AST A;  3HY9 A;  3KEK A;  4PKR A;  2FV9 A;  5JMY A;  3OHL A;  1BIW A;  2O3E A;  1EUB A;  5I43 A;  3KEC A;  4XM7 A;  1ZTQ A;  4AYK A;  1D5J A;  4PKV A;  4WKE A;  3K7N A;  3LIK A;  3G42 A;  4FVL A;  4H30 A;  1UMT A;  2MZH A;  5D3C A;  4IJO A;  2MZE A;  1KBC A;  4FXY P;  4XM6 A;  4DV8 A;  3AIG A;  1GKD A;  3OHO A;  4DPE A;  2O36 A;  4JP4 A;  3VTG A;  1BQO A;  1IAA A;  3E8R A;  2W0D A;  456C A;  1Q3A A;  1I1I P;  2DW0 A;  1SAT A;  2OXW A;  5I3M A;  2OXU A;  4H82 A;  2KRJ A;  1KUF A;  5H8X A;  2CLT A;  2K2G A;  1MMB A;  2OVX A;  2YIG A;  1RMZ A;  4I35 A;  1D8M A;  3F16 A;  3LK8 A;  1FBL A;  3I7I A;  1B8Y A;  1JK3 A;  1G9K A;  3EHY A;  3TT4 A;  2AYK A;  4WK7 A;  3KEJ A;  2JSD A;  5BOY A;  2OW0 A;  3I7G A;  4XBH A;  4DD8 A;  4Q1L A;  1PWP A;  2JT5 A;  1BSW A;  1YCM A;  2OVZ A;  1HV5 A;  4DF9 A;  5B5O A;  2W15 A;  2ERP A;  4PKQ A;  1IAD A;  2WO8 A;  1GO7 P;  1KUG A;  3EHX A;  5CUH A;  3LMC A;  4AIG A;  4H76 A;  3ZUK A;  1R1I A;  4JA1 A;  1XUR A;  2JNP A;  3F19 A;  4GR8 A;  1KUK A;  4I03 A;  2A8H A;  3O2X A;  3F17 A;  2CKI A;  2PJT A;  3USN A;  3DTI A;  2W12 A;  3LUM A;  2RJQ A;  3P24 A;  1KAP P;  4ZR5 A;  2MLS A;  3B8Z A;  3HBU P;  3UVC A;  3NX7 A;  1XFV A;  3KMC A;  3EDH A;  1AKL A;  2OXZ A;  966C A;  3BA0 A;  4FXQ A;  1R1J A;  4EFS A;  5D1U A;  2TCL A;  1R1H A;  2HU6 A;  1K7G A;  1G12 A;  1BKC A;  4IN9 A;  3DWB A;  1BQQ M;  3DL1 A;  1IAC A;  1MMP A;  4PKW A;  2OW2 A;  4GUY A;  2DW2 A;  4H49 A;  3LIL A;  1YP1 A;  1XFY A;  4A3W A;  1OM7 A;  2YB9 A;  3V96 B;  2I47 A;  1KUI A;  1QIA A;  1JKY A;  3WV1 A;  1EAK A;  1JAN A;  1G4K A;  3MA2 A;  1K7Q A;  1JH1 A;  4L19 A;  3HDB A;  4JPA A;  1SMP A;  5CZM A;  3DTK A;  1CGL A;  5B5P A;  1JAQ A;  2JT6 A;  1OM6 A;  1OM8 A;  4WKI A;  1XUC A;  3LGP A;  1O0Q A;  3ELM A;  3F1A A;  3L0T A;  4HMA A;  3KWV C;  1CGF A;  4H84 A;  1HFS A;  1WNI A;  1CIZ A;  3N2V A;  4FU4 A;  4CTH A;  4J4M A;  3LQB A;  3AYK A;  2FV5 A;  1OO9 A;  3HY7 A;  1SLN A;  4G9L A;  1OS9 A;  3HB2 P;  2MLR A;  1I73 A;  2X3A A;  5BPA A;  1HOV A;  1JAO A;  3B2Z A;  2JIH A;  2Y6C A;  5D1S A;  4AXQ A;  1ZXV A;  2OZR A;  1I76 A;  1QJJ A;  1PWV A;  3TSK A;  3EDZ A;  1KUH A;  1MMQ A;  3RTT A;  3Q2G A;  2DDY A;  4L6T A;  4JIJ A;  1QJI A;  3DPE A;  1BM6 A;  5I2Z A;  1EB6 A;  2QPJ A;  3AYU A;  4GQL A;  1GE5 A;  5CXA A;  3RTS A;  2X3B A;  4H2E A;  4QKZ A;  4XM8 A;  1ATL A;  2WO9 A;  1CXV A;  1C3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...