3LKAA

Catalytic domain of human mmp-12 complexed with hydroxamic acid and paramethoxy-sulfonyl amide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Entropic contribution to the linking coefficient in fragment based drug design: a case study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lkaA00
3ELMA 3I7IA 2DDFA 2W12A 2N8RA 1JKYA 3VI1A 3B92A 4JA1A 1MNCA 3F16A 3VTGA 4GR0A 1SU3A 3V96B 1GE6A 1USNA 1XFUA 2W14A 1EB6A 3O2XA 5I3MA 2K2GA 5D1TA 3CKIA 2WOAA 2A8HA 1D8MA 3HBUP 3EDHA 5D7WA 4PKWA 1G49A 3TSKA 3AYUA 1QJIA 1BQQM 2DW0A 3LKAA 1XFVA 1IAAA 2HU6A 3LJTA 2D1OA 3EHXA 1KUHA 1FLSA 2MZHA 3LIKA 2W0DA 4A7BA 5CXAA 2L0RA 3F17A 1K7IA 4J4MA 4FVLA 3F19A 2MLSA 5D1UA 4AUOA 1HY7A 5L79A 3NX7A 3HDAP 4AIGA 1EAKA 1Q3AA 1G12A 1R1IA 3G5CA 3GBOA 1GE5A 2XS3A 1OO9A 3LUMA 3DWBA 3OHLA 4ON1A 1G9KA 5I0LA 3BA0A 3EDIA 2TCLA 1KUIA 1XUCA 4PKTA 3AIGA 3ZUKA 3LE9A 4PKRA 2W15A 4DF9A 4GUYA 2MZIA 4DPEA 1ZP5A 3P24A 4IJOA 1R1JA 1BM6A 2PJTA 2SRTA 5I43A 1AKLA 3Q2HA 1DMTA 1UTTA 1CAQA 5LABA 3KMEA 4L6TA 1ZXCA 1JAOA 2OXZA 4GR8A 4GF1A 1H71P 2CLTA 1KBCA 3N2UA 1YCMA 3LUNA 3DPEA 2OZRA 1PWQA 1AYKA 4A3WA 5BOYA 1GE7A 1K7QA 1UTZA 2O3EA 2K9CA 1IAEA 1JAPA 1C7KA 3LQBA 1FBLA 456CA 4PKVA 4AYKA 1PWWA 5CUHA 3DSLA 4GWNA 2QPJA 2YB9A 1XFZA 1XFWA 3Q2GA 3AYKA 3KRYA 1D8FA 1WNIA 2EROA 1FM1A 3DL1A 4GR3A 2I47A 4JPAA 1SMPA 4GQLA 3RTTA 4WKEA 3F18A 3B2ZA 1YOUA 3KWVC 2OW2A 1OM6A 4FXYP 1I76A 1C8TA 3WV1A 1OMJA 1QIAA 1UMSA 1GXDA 5L7FA 5B5PA 3WV3A 1XUDA 2XS4A 4H3XA 1A86A 3TT4A 1Y0VA 3MA2A 1YP1A 2O36A 2W13A 2USNA 5BPAA 1MMPA 1CGEA 1HTDA 1SLMA 4H82A 1CXVA 1ZXVA 3WV2A 5JMYA 5CZMA 3HYGA 5I4OA 1EUBA 2WO9A 3I7GA 3K7NA 2POJA 4L63A 1JAQA 1HFSA 3HY9A 1I73A 1CQRA 1G05A 3UVCA 2Y6CA 1SLNA 2ERQA 1UEAA 2E3XA 1HOVA 3F15A 1MMRA 4IN9A 1ZTQA 4L19A 3HBVP 4Q1LA 5I2ZA 3K7LA 1R1HA 1S4BP 1BUVM 4ILWD 4HMAA 2OXUA 1R54A 2JIHA 3ZXHA 3RTSA 4H30A 1ZS0A 1BSWA 1JH1A 2OVZA 3USNA 2MZEA 966CA 3O64A 1ATLA 3EDGA 3P1VA 2FV9A 3DNGA 4H76A 1A85A 2OW0A 5D1SA 1XURA 3HB2P 5D2BA 1BKCE 1B3DA 3LK8A 1GKDA 3F1AA 4PKQA 1PWUA 3EWJA 1ZVXA 2X3CA 4CTHA 1DTHA 2D1NA 2WO8A 4HX3A 4H49A 3L0TA 1BIWA 1KUGA 4DV8A 2OW9A 2AIGP 1KUKA 3DPFA 4I35A 3L0VA 4FXQA 5BOTA 1CIZA 3ZVSA 1SRPA 2DW1A 3KECA 4JIJA 1BKCI 1CGFA 1JK3A 2X3AA 2DW2A 1BZSA 1RMZA 3U1RA 5D3CA 1L6JA 1G4KA 4IUWA 4XM7A 1IABA 3OHOA 4JP4A 1Y8JA 1OS2A 4EFSA 1GO7P 4XM8A 2RJQA 4GWMA 4H1QA 1J7NA 1I1IP 4WK7A 5B5OA 1C3IA 4WF6A 4DD8A 3LGPA 2MLRA 4XBHA 1KAPP 1QICA 1Z3JA 2Z2DA 4XCTA 2Y6DA 3LEAA 3KHIA 1IACA 1QJJA 1ND1A 1D7XA 2JT5A 4H2EA 2J0TA 1PWVA 1O0TA 2OI0A 3LMCA 1B8YA 1BQOA 3B8ZA 1GO8P 2ERPA 3LJGA 2V4BA 1O0QA 2X7MA 3LILA 2YIGA 3E8RA 4I03A 1XFXA 3HY7A 3SHIA 5H8XA 3TVCA 1R55A 4WZVA 2DDYA 4G9LA 3LJZA 1JJ9A 3LQ0A 1AF0A 1MMQA 1PWPA 1OM7A 1QUAA 1XFYA 4PKSA 5I12A 2OW1A 3KEJA 1IAGA 1K7GA 1OS9A 3G42A 1KUFA 1YQYA 2OVXA 1CGLA 1JANA 1GKCA 1Y93A 4XM6A 1JIZA 1QIBA 2OY4A 1ROSA 1CK7A 2JSDA 3KMCA 1JIWP 1OM8A 2AYKA 2JT6A 1HFCA 830CA 2JNPA 2OY2A 2FV5A 2KRJA 1RM8A 3KEKA 4R3VA 2X3BA 3TS4A 2OXWA 4ZR5A 1UMTA 1D5JA 2CKIA 1IADA 4AXQA 1ASTA 1BUDA 2RJPA 1SATA 4FU4A 3HDBA 3LIRA 3EDZA 4QKZA 1HV5A 2J83A 3N2VA 2E2DA 1MMBA 4JQGA 4PKUA 1BKCA 4G0DA 4H84A 3EHYA 4WKIA
chains in the Genus database with same CATH superfamily
3ELMA 3I7IA 2DDFA 2W12A 2N8RA 1JKYA 3VI1A 3B92A 4JA1A 1MNCA 3F16A 3VTGA 4GR0A 1SU3A 3V96B 1GE6A 1USNA 1XFUA 2W14A 1EB6A 3O2XA 5I3MA 2K2GA 5D1TA 3CKIA 2WOAA 2A8HA 1D8MA 3HBUP 3EDHA 5D7WA 4PKWA 1G49A 3TSKA 3AYUA 1QJIA 1BQQM 2DW0A 3LKAA 1XFVA 1IAAA 2HU6A 3LJTA 2D1OA 3EHXA 1KUHA 1FLSA 2MZHA 3LIKA 2W0DA 4A7BA 5CXAA 2L0RA 3F17A 1K7IA 4J4MA 4FVLA 3F19A 2MLSA 5D1UA 4AUOA 1HY7A 5L79A 3NX7A 3HDAP 4AIGA 1EAKA 1Q3AA 1G12A 1R1IA 3G5CA 3GBOA 1GE5A 2XS3A 1OO9A 3LUMA 3DWBA 3OHLA 4ON1A 1G9KA 5I0LA 3BA0A 3EDIA 2TCLA 1KUIA 1XUCA 4PKTA 3AIGA 3ZUKA 3LE9A 4PKRA 2W15A 4DF9A 4GUYA 2MZIA 4DPEA 1OZ9A 1ZP5A 3P24A 4IJOA 1R1JA 1BM6A 2PJTA 2SRTA 5I43A 1AKLA 3Q2HA 1DMTA 1UTTA 1CAQA 5LABA 3KMEA 4L6TA 1ZXCA 1JAOA 2OXZA 4GR8A 4GF1A 1H71P 2CLTA 1KBCA 3N2UA 1YCMA 3LUNA 3DPEA 2OZRA 1PWQA 1AYKA 4A3WA 5BOYA 1GE7A 1K7QA 1UTZA 2O3EA 2K9CA 1XAXA 1IAEA 1JAPA 1C7KA 3LQBA 1FBLA 456CA 4PKVA 4AYKA 1PWWA 5CUHA 3DSLA 4GWNA 2QPJA 2YB9A 1XFZA 1XFWA 3Q2GA 3AYKA 3KRYA 1D8FA 1WNIA 2EROA 1FM1A 3DL1A 4GR3A 2I47A 4JPAA 1SMPA 4GQLA 3RTTA 4WKEA 3F18A 3B2ZA 1YOUA 3KWVC 2OW2A 1OM6A 4FXYP 1I76A 1C8TA 3WV1A 1OMJA 1QIAA 1UMSA 1GXDA 5L7FA 5B5PA 3WV3A 1XUDA 2XS4A 4H3XA 1A86A 3TT4A 1Y0VA 3MA2A 1YP1A 2O36A 2W13A 2USNA 5BPAA 1MMPA 1CGEA 1HTDA 1SLMA 4H82A 1CXVA 1ZXVA 3WV2A 5JMYA 5CZMA 3HYGA 5I4OA 1EUBA 2WO9A 3I7GA 3K7NA 2POJA 4L63A 1JAQA 1HFSA 3HY9A 3DTKA 1I73A 1CQRA 1G05A 3UVCA 1XM5A 2Y6CA 1SLNA 2ERQA 1UEAA 2E3XA 1HOVA 3F15A 1MMRA 4IN9A 1ZTQA 4L19A 3HBVP 4Q1LA 5I2ZA 3K7LA 1R1HA 1S4BP 1BUVM 4ILWD 4HMAA 2OXUA 1R54A 2JIHA 3ZXHA 3RTSA 4H30A 1ZS0A 1BSWA 1JH1A 2OVZA 3USNA 2MZEA 966CA 3O64A 1ATLA 3EDGA 3P1VA 2FV9A 3DNGA 4H76A 1A85A 2OW0A 5D1SA 2YUFA 1XURA 3HB2P 4L7AA 5D2BA 1BKCE 3DTEA 1B3DA 3LK8A 1GKDA 3F1AA 4PKQA 1PWUA 3EWJA 1ZVXA 2X3CA 4CTHA 1DTHA 2D1NA 2WO8A 4HX3A 4H49A 3L0TA 1BIWA 1KUGA 4DV8A 2OW9A 2AIGP 1KUKA 3DPFA 4I35A 3L0VA 4FXQA 5BOTA 1CIZA 3ZVSA 1SRPA 2DW1A 3KECA 4JIJA 1BKCI 1CGFA 1JK3A 2X3AA 2DW2A 1BZSA 3DTIA 1RMZA 3U1RA 5D3CA 1L6JA 1G4KA 4IUWA 4XM7A 1IABA 3OHOA 4JP4A 1Y8JA 1OS2A 4EFSA 1GO7P 4XM8A 2RJQA 4GWMA 4H1QA 1J7NA 1I1IP 4WK7A 5B5OA 1C3IA 4WF6A 4DD8A 3LGPA 2MLRA 4XBHA 1KAPP 1QICA 1Z3JA 2Z2DA 4XCTA 2Y6DA 3LEAA 3KHIA 1IACA 1QJJA 1TVIA 1ND1A 1D7XA 2JT5A 4H2EA 2J0TA 1PWVA 1O0TA 2OI0A 3LMCA 1B8YA 1BQOA 3B8ZA 1GO8P 2ERPA 3LJGA 2V4BA 1O0QA 2X7MA 3LILA 2YIGA 3E8RA 4I03A 1XFXA 3HY7A 3SHIA 5H8XA 3TVCA 1R55A 4WZVA 2DDYA 4G9LA 3LJZA 1JJ9A 3LQ0A 1AF0A 1MMQA 1PWPA 1OM7A 1QUAA 1XFYA 4PKSA 5I12A 2OW1A 3KEJA 1IAGA 1K7GA 1OS9A 3G42A 1KUFA 1YQYA 2OVXA 1CGLA 1JANA 1GKCA 1Y93A 4XM6A 1JIZA 1QIBA 2OY4A 1ROSA 1CK7A 2JSDA 3KMCA 1JIWP 1OM8A 2AYKA 2JT6A 1HFCA 830CA 2JNPA 2OY2A 2FV5A 2KRJA 1RM8A 3KEKA 4R3VA 2X3BA 3TS4A 2OXWA 4ZR5A 1UMTA 1D5JA 2CKIA 1IADA 4AXQA 1ASTA 1BUDA 2RJPA 1SATA 4FU4A 3HDBA 3LIRA 3EDZA 4QKZA 1HV5A 2J83A 3N2VA 2E2DA 1MMBA 4JQGA 4PKUA 1BKCA 4G0DA 4H84A 3EHYA 4WKIA
chains in the Genus database with same CATH topology
3ELMA 3I7IA 2DDFA 2W12A 2N8RA 1JKYA 3VI1A 3B92A 4JA1A 1MNCA 3F16A 3VTGA 4GR0A 1SU3A 3V96B 1GE6A 1USNA 1XFUA 2W14A 1EB6A 3O2XA 5I3MA 2K2GA 5D1TA 3CKIA 2WOAA 2A8HA 1D8MA 3HBUP 3EDHA 5D7WA 4PKWA 1G49A 3TSKA 3AYUA 1QJIA 1BQQM 2DW0A 3LKAA 1XFVA 1IAAA 2HU6A 3LJTA 2D1OA 3EHXA 1KUHA 1FLSA 2MZHA 3LIKA 2W0DA 4A7BA 5CXAA 2L0RA 3F17A 1K7IA 4J4MA 4FVLA 3F19A 2MLSA 5D1UA 4AUOA 1HY7A 5L79A 3NX7A 3HDAP 4AIGA 1EAKA 1Q3AA 1G12A 1R1IA 3G5CA 3GBOA 1GE5A 2XS3A 1OO9A 3LUMA 3DWBA 3OHLA 4ON1A 1G9KA 5I0LA 3BA0A 3EDIA 2TCLA 1KUIA 1XUCA 4PKTA 3AIGA 3ZUKA 3LE9A 4PKRA 2W15A 4DF9A 4GUYA 2MZIA 4DPEA 1ZP5A 3P24A 4IJOA 1R1JA 1BM6A 2PJTA 2SRTA 5I43A 1AKLA 3Q2HA 1DMTA 1UTTA 1CAQA 5LABA 3KMEA 4L6TA 1ZXCA 1JAOA 2OXZA 4GR8A 4GF1A 1H71P 2CLTA 1KBCA 3N2UA 1YCMA 3LUNA 3DPEA 2OZRA 1PWQA 1AYKA 4A3WA 5BOYA 1GE7A 1K7QA 1UTZA 2O3EA 2K9CA 1IAEA 1JAPA 1C7KA 3LQBA 1FBLA 456CA 4PKVA 4AYKA 1PWWA 5CUHA 3DSLA 4GWNA 2QPJA 2YB9A 1XFZA 1XFWA 3Q2GA 3AYKA 3KRYA 1D8FA 1WNIA 2EROA 1FM1A 3DL1A 4GR3A 2I47A 4JPAA 1SMPA 4GQLA 3RTTA 4WKEA 3F18A 3B2ZA 1YOUA 3KWVC 2OW2A 1OM6A 4FXYP 1I76A 1C8TA 3WV1A 1OMJA 1QIAA 1UMSA 1GXDA 5L7FA 5B5PA 3WV3A 1XUDA 2XS4A 4H3XA 1A86A 3TT4A 1Y0VA 3MA2A 1YP1A 2O36A 2W13A 2USNA 5BPAA 1MMPA 1CGEA 1HTDA 1SLMA 4H82A 1CXVA 1ZXVA 3WV2A 5JMYA 5CZMA 3HYGA 5I4OA 1EUBA 2WO9A 3I7GA 3K7NA 2POJA 4L63A 1JAQA 1HFSA 3HY9A 3DTKA 1I73A 1CQRA 1G05A 3UVCA 2Y6CA 1SLNA 2ERQA 1UEAA 2E3XA 1HOVA 3F15A 1MMRA 4IN9A 1ZTQA 4L19A 3HBVP 4Q1LA 5I2ZA 3K7LA 1R1HA 1S4BP 1BUVM 4ILWD 4HMAA 2OXUA 1R54A 2JIHA 3ZXHA 3RTSA 4H30A 1ZS0A 1BSWA 1JH1A 2OVZA 3USNA 2MZEA 966CA 3O64A 1ATLA 3EDGA 3P1VA 2FV9A 3DNGA 4H76A 1A85A 2OW0A 5D1SA 2YUFA 1XURA 3HB2P 4L7AA 5D2BA 1BKCE 3DTEA 1B3DA 3LK8A 1GKDA 3F1AA 4PKQA 1PWUA 3EWJA 1ZVXA 2X3CA 4CTHA 1DTHA 2D1NA 2WO8A 4HX3A 4H49A 3L0TA 1BIWA 1KUGA 4DV8A 2OW9A 2AIGP 1KUKA 3DPFA 4I35A 3L0VA 4FXQA 5BOTA 1CIZA 3ZVSA 1SRPA 2DW1A 3KECA 4JIJA 1BKCI 1CGFA 1JK3A 2X3AA 2DW2A 1BZSA 3DTIA 1RMZA 3U1RA 5D3CA 1L6JA 1G4KA 4IUWA 4XM7A 1IABA 3OHOA 4JP4A 1Y8JA 1OS2A 4EFSA 1GO7P 4XM8A 2RJQA 4GWMA 4H1QA 1J7NA 1I1IP 4WK7A 5B5OA 1C3IA 4WF6A 4DD8A 3LGPA 2MLRA 4XBHA 1KAPP 1QICA 1Z3JA 2Z2DA 4XCTA 2Y6DA 3LEAA 3KHIA 1IACA 1QJJA 1ND1A 1D7XA 2JT5A 4H2EA 2J0TA 1PWVA 1O0TA 2OI0A 3LMCA 1B8YA 1BQOA 3B8ZA 1GO8P 2ERPA 3LJGA 2V4BA 1O0QA 2X7MA 3LILA 2YIGA 3E8RA 4I03A 1XFXA 3HY7A 3SHIA 5H8XA 3TVCA 1R55A 4WZVA 2DDYA 4G9LA 3LJZA 1JJ9A 3LQ0A 1AF0A 1MMQA 1PWPA 1OM7A 1QUAA 1XFYA 4PKSA 5I12A 2OW1A 3KEJA 1IAGA 1K7GA 1OS9A 3G42A 1KUFA 1YQYA 2OVXA 1CGLA 1JANA 1GKCA 1Y93A 4XM6A 1JIZA 1QIBA 2OY4A 1ROSA 1CK7A 2JSDA 3KMCA 1JIWP 1OM8A 2AYKA 2JT6A 1HFCA 830CA 2JNPA 2OY2A 2FV5A 2KRJA 1RM8A 3KEKA 4R3VA 2X3BA 3TS4A 2OXWA 4ZR5A 1UMTA 1D5JA 2CKIA 1IADA 4AXQA 1ASTA 1BUDA 2RJPA 1SATA 4FU4A 3HDBA 3LIRA 3EDZA 4QKZA 1HV5A 2J83A 3N2VA 2E2DA 1MMBA 4JQGA 4PKUA 1BKCA 4G0DA 4H84A 3EHYA 4WKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELM A;  3I7I A;  2DDF A;  2W12 A;  2N8R A;  1JKY A;  3VI1 A;  3B92 A;  4JA1 A;  1MNC A;  3F16 A;  3VTG A;  4GR0 A;  1SU3 A;  3V96 B;  1GE6 A;  1USN A;  1XFU A;  2W14 A;  1EB6 A;  3O2X A;  5I3M A;  2K2G A;  5D1T A;  3CKI A;  2WOA A;  2A8H A;  1D8M A;  3HBU P;  3EDH A;  5D7W A;  4PKW A;  1G49 A;  3TSK A;  3AYU A;  1QJI A;  1BQQ M;  2DW0 A;  3LKA A;  1XFV A;  1IAA A;  2HU6 A;  3LJT A;  2D1O A;  3EHX A;  1KUH A;  1FLS A;  2MZH A;  3LIK A;  2W0D A;  4A7B A;  5CXA A;  2L0R A;  3F17 A;  1K7I A;  4J4M A;  4FVL A;  3F19 A;  2MLS A;  5D1U A;  4AUO A;  1HY7 A;  5L79 A;  3NX7 A;  3HDA P;  4AIG A;  1EAK A;  1Q3A A;  1G12 A;  1R1I A;  3G5C A;  3GBO A;  1GE5 A;  2XS3 A;  1OO9 A;  3LUM A;  3DWB A;  3OHL A;  4ON1 A;  1G9K A;  5I0L A;  3BA0 A;  3EDI A;  2TCL A;  1KUI A;  1XUC A;  4PKT A;  3AIG A;  3ZUK A;  3LE9 A;  4PKR A;  2W15 A;  4DF9 A;  4GUY A;  2MZI A;  4DPE A;  1ZP5 A;  3P24 A;  4IJO A;  1R1J A;  1BM6 A;  2PJT A;  2SRT A;  5I43 A;  1AKL A;  3Q2H A;  1DMT A;  1UTT A;  1CAQ A;  5LAB A;  3KME A;  4L6T A;  1ZXC A;  1JAO A;  2OXZ A;  4GR8 A;  4GF1 A;  1H71 P;  2CLT A;  1KBC A;  3N2U A;  1YCM A;  3LUN A;  3DPE A;  2OZR A;  1PWQ A;  1AYK A;  4A3W A;  5BOY A;  1GE7 A;  1K7Q A;  1UTZ A;  2O3E A;  2K9C A;  1IAE A;  1JAP A;  1C7K A;  3LQB A;  1FBL A;  456C A;  4PKV A;  4AYK A;  1PWW A;  5CUH A;  3DSL A;  4GWN A;  2QPJ A;  2YB9 A;  1XFZ A;  1XFW A;  3Q2G A;  3AYK A;  3KRY A;  1D8F A;  1WNI A;  2ERO A;  1FM1 A;  3DL1 A;  4GR3 A;  2I47 A;  4JPA A;  1SMP A;  4GQL A;  3RTT A;  4WKE A;  3F18 A;  3B2Z A;  1YOU A;  3KWV C;  2OW2 A;  1OM6 A;  4FXY P;  1I76 A;  1C8T A;  3WV1 A;  1OMJ A;  1QIA A;  1UMS A;  1GXD A;  5L7F A;  5B5P A;  3WV3 A;  1XUD A;  2XS4 A;  4H3X A;  1A86 A;  3TT4 A;  1Y0V A;  3MA2 A;  1YP1 A;  2O36 A;  2W13 A;  2USN A;  5BPA A;  1MMP A;  1CGE A;  1HTD A;  1SLM A;  4H82 A;  1CXV A;  1ZXV A;  3WV2 A;  5JMY A;  5CZM A;  3HYG A;  5I4O A;  1EUB A;  2WO9 A;  3I7G A;  3K7N A;  2POJ A;  4L63 A;  1JAQ A;  1HFS A;  3HY9 A;  1I73 A;  1CQR A;  1G05 A;  3UVC A;  2Y6C A;  1SLN A;  2ERQ A;  1UEA A;  2E3X A;  1HOV A;  3F15 A;  1MMR A;  4IN9 A;  1ZTQ A;  4L19 A;  3HBV P;  4Q1L A;  5I2Z A;  3K7L A;  1R1H A;  1S4B P;  1BUV M;  4ILW D;  4HMA A;  2OXU A;  1R54 A;  2JIH A;  3ZXH A;  3RTS A;  4H30 A;  1ZS0 A;  1BSW A;  1JH1 A;  2OVZ A;  3USN A;  2MZE A;  966C A;  3O64 A;  1ATL A;  3EDG A;  3P1V A;  2FV9 A;  3DNG A;  4H76 A;  1A85 A;  2OW0 A;  5D1S A;  1XUR A;  3HB2 P;  5D2B A;  1BKC E;  1B3D A;  3LK8 A;  1GKD A;  3F1A A;  4PKQ A;  1PWU A;  3EWJ A;  1ZVX A;  2X3C A;  4CTH A;  1DTH A;  2D1N A;  2WO8 A;  4HX3 A;  4H49 A;  3L0T A;  1BIW A;  1KUG A;  4DV8 A;  2OW9 A;  2AIG P;  1KUK A;  3DPF A;  4I35 A;  3L0V A;  4FXQ A;  5BOT A;  1CIZ A;  3ZVS A;  1SRP A;  2DW1 A;  3KEC A;  4JIJ A;  1BKC I;  1CGF A;  1JK3 A;  2X3A A;  2DW2 A;  1BZS A;  1RMZ A;  3U1R A;  5D3C A;  1L6J A;  1G4K A;  4IUW A;  4XM7 A;  1IAB A;  3OHO A;  4JP4 A;  1Y8J A;  1OS2 A;  4EFS A;  1GO7 P;  4XM8 A;  2RJQ A;  4GWM A;  4H1Q A;  1J7N A;  1I1I P;  4WK7 A;  5B5O A;  1C3I A;  4WF6 A;  4DD8 A;  3LGP A;  2MLR A;  4XBH A;  1KAP P;  1QIC A;  1Z3J A;  2Z2D A;  4XCT A;  2Y6D A;  3LEA A;  3KHI A;  1IAC A;  1QJJ A;  1ND1 A;  1D7X A;  2JT5 A;  4H2E A;  2J0T A;  1PWV A;  1O0T A;  2OI0 A;  3LMC A;  1B8Y A;  1BQO A;  3B8Z A;  1GO8 P;  2ERP A;  3LJG A;  2V4B A;  1O0Q A;  2X7M A;  3LIL A;  2YIG A;  3E8R A;  4I03 A;  1XFX A;  3HY7 A;  3SHI A;  5H8X A;  3TVC A;  1R55 A;  4WZV A;  2DDY A;  4G9L A;  3LJZ A;  1JJ9 A;  3LQ0 A;  1AF0 A;  1MMQ A;  1PWP A;  1OM7 A;  1QUA A;  1XFY A;  4PKS A;  5I12 A;  2OW1 A;  3KEJ A;  1IAG A;  1K7G A;  1OS9 A;  3G42 A;  1KUF A;  1YQY A;  2OVX A;  1CGL A;  1JAN A;  1GKC A;  1Y93 A;  4XM6 A;  1JIZ A;  1QIB A;  2OY4 A;  1ROS A;  1CK7 A;  2JSD A;  3KMC A;  1JIW P;  1OM8 A;  2AYK A;  2JT6 A;  1HFC A;  830C A;  2JNP A;  2OY2 A;  2FV5 A;  2KRJ A;  1RM8 A;  3KEK A;  4R3V A;  2X3B A;  3TS4 A;  2OXW A;  4ZR5 A;  1UMT A;  1D5J A;  2CKI A;  1IAD A;  4AXQ A;  1AST A;  1BUD A;  2RJP A;  1SAT A;  4FU4 A;  3HDB A;  3LIR A;  3EDZ A;  4QKZ A;  1HV5 A;  2J83 A;  3N2V A;  2E2D A;  1MMB A;  4JQG A;  4PKU A;  1BKC A;  4G0D A;  4H84 A;  3EHY A;  4WKI A; 
#chains in the Genus database with same CATH topology
 3ELM A;  3I7I A;  2DDF A;  2W12 A;  2N8R A;  1JKY A;  3VI1 A;  3B92 A;  4JA1 A;  1MNC A;  3F16 A;  3VTG A;  4GR0 A;  1SU3 A;  3V96 B;  1GE6 A;  1USN A;  1XFU A;  2W14 A;  1EB6 A;  3O2X A;  5I3M A;  2K2G A;  5D1T A;  3CKI A;  2WOA A;  2A8H A;  1D8M A;  3HBU P;  3EDH A;  5D7W A;  4PKW A;  1G49 A;  3TSK A;  3AYU A;  1QJI A;  1BQQ M;  2DW0 A;  3LKA A;  1XFV A;  1IAA A;  2HU6 A;  3LJT A;  2D1O A;  3EHX A;  1KUH A;  1FLS A;  2MZH A;  3LIK A;  2W0D A;  4A7B A;  5CXA A;  2L0R A;  3F17 A;  1K7I A;  4J4M A;  4FVL A;  3F19 A;  2MLS A;  5D1U A;  4AUO A;  1HY7 A;  5L79 A;  3NX7 A;  3HDA P;  4AIG A;  1EAK A;  1Q3A A;  1G12 A;  1R1I A;  3G5C A;  3GBO A;  1GE5 A;  2XS3 A;  1OO9 A;  3LUM A;  3DWB A;  3OHL A;  4ON1 A;  1G9K A;  5I0L A;  3BA0 A;  3EDI A;  2TCL A;  1KUI A;  1XUC A;  4PKT A;  3AIG A;  3ZUK A;  3LE9 A;  4PKR A;  2W15 A;  4DF9 A;  4GUY A;  2MZI A;  4DPE A;  1OZ9 A;  1ZP5 A;  3P24 A;  4IJO A;  1R1J A;  1BM6 A;  2PJT A;  2SRT A;  5I43 A;  1AKL A;  3Q2H A;  1DMT A;  1UTT A;  1CAQ A;  5LAB A;  3KME A;  4L6T A;  1ZXC A;  1JAO A;  2OXZ A;  4GR8 A;  4GF1 A;  1H71 P;  2CLT A;  1KBC A;  3N2U A;  1YCM A;  3LUN A;  3DPE A;  2OZR A;  1PWQ A;  1AYK A;  4A3W A;  5BOY A;  1GE7 A;  1K7Q A;  1UTZ A;  2O3E A;  2K9C A;  1XAX A;  1IAE A;  1JAP A;  1C7K A;  3LQB A;  1FBL A;  456C A;  4PKV A;  4AYK A;  1PWW A;  5CUH A;  3DSL A;  4GWN A;  2QPJ A;  2YB9 A;  1XFZ A;  1XFW A;  3Q2G A;  3AYK A;  3KRY A;  1D8F A;  1WNI A;  2ERO A;  1FM1 A;  3DL1 A;  4GR3 A;  2I47 A;  4JPA A;  1SMP A;  4GQL A;  3RTT A;  4WKE A;  3F18 A;  3B2Z A;  1YOU A;  3KWV C;  2OW2 A;  1OM6 A;  4FXY P;  1I76 A;  1C8T A;  3WV1 A;  1OMJ A;  1QIA A;  1UMS A;  1GXD A;  5L7F A;  5B5P A;  3WV3 A;  1XUD A;  2XS4 A;  4H3X A;  1A86 A;  3TT4 A;  1Y0V A;  3MA2 A;  1YP1 A;  2O36 A;  2W13 A;  2USN A;  5BPA A;  1MMP A;  1CGE A;  1HTD A;  1SLM A;  4H82 A;  1CXV A;  1ZXV A;  3WV2 A;  5JMY A;  5CZM A;  3HYG A;  5I4O A;  1EUB A;  2WO9 A;  3I7G A;  3K7N A;  2POJ A;  4L63 A;  1JAQ A;  1HFS A;  3HY9 A;  3DTK A;  1I73 A;  1CQR A;  1G05 A;  3UVC A;  1XM5 A;  2Y6C A;  1SLN A;  2ERQ A;  1UEA A;  2E3X A;  1HOV A;  3F15 A;  1MMR A;  4IN9 A;  1ZTQ A;  4L19 A;  3HBV P;  4Q1L A;  5I2Z A;  3K7L A;  1R1H A;  1S4B P;  1BUV M;  4ILW D;  4HMA A;  2OXU A;  1R54 A;  2JIH A;  3ZXH A;  3RTS A;  4H30 A;  1ZS0 A;  1BSW A;  1JH1 A;  2OVZ A;  3USN A;  2MZE A;  966C A;  3O64 A;  1ATL A;  3EDG A;  3P1V A;  2FV9 A;  3DNG A;  4H76 A;  1A85 A;  2OW0 A;  5D1S A;  2YUF A;  1XUR A;  3HB2 P;  4L7A A;  5D2B A;  1BKC E;  3DTE A;  1B3D A;  3LK8 A;  1GKD A;  3F1A A;  4PKQ A;  1PWU A;  3EWJ A;  1ZVX A;  2X3C A;  4CTH A;  1DTH A;  2D1N A;  2WO8 A;  4HX3 A;  4H49 A;  3L0T A;  1BIW A;  1KUG A;  4DV8 A;  2OW9 A;  2AIG P;  1KUK A;  3DPF A;  4I35 A;  3L0V A;  4FXQ A;  5BOT A;  1CIZ A;  3ZVS A;  1SRP A;  2DW1 A;  3KEC A;  4JIJ A;  1BKC I;  1CGF A;  1JK3 A;  2X3A A;  2DW2 A;  1BZS A;  3DTI A;  1RMZ A;  3U1R A;  5D3C A;  1L6J A;  1G4K A;  4IUW A;  4XM7 A;  1IAB A;  3OHO A;  4JP4 A;  1Y8J A;  1OS2 A;  4EFS A;  1GO7 P;  4XM8 A;  2RJQ A;  4GWM A;  4H1Q A;  1J7N A;  1I1I P;  4WK7 A;  5B5O A;  1C3I A;  4WF6 A;  4DD8 A;  3LGP A;  2MLR A;  4XBH A;  1KAP P;  1QIC A;  1Z3J A;  2Z2D A;  4XCT A;  2Y6D A;  3LEA A;  3KHI A;  1IAC A;  1QJJ A;  1TVI A;  1ND1 A;  1D7X A;  2JT5 A;  4H2E A;  2J0T A;  1PWV A;  1O0T A;  2OI0 A;  3LMC A;  1B8Y A;  1BQO A;  3B8Z A;  1GO8 P;  2ERP A;  3LJG A;  2V4B A;  1O0Q A;  2X7M A;  3LIL A;  2YIG A;  3E8R A;  4I03 A;  1XFX A;  3HY7 A;  3SHI A;  5H8X A;  3TVC A;  1R55 A;  4WZV A;  2DDY A;  4G9L A;  3LJZ A;  1JJ9 A;  3LQ0 A;  1AF0 A;  1MMQ A;  1PWP A;  1OM7 A;  1QUA A;  1XFY A;  4PKS A;  5I12 A;  2OW1 A;  3KEJ A;  1IAG A;  1K7G A;  1OS9 A;  3G42 A;  1KUF A;  1YQY A;  2OVX A;  1CGL A;  1JAN A;  1GKC A;  1Y93 A;  4XM6 A;  1JIZ A;  1QIB A;  2OY4 A;  1ROS A;  1CK7 A;  2JSD A;  3KMC A;  1JIW P;  1OM8 A;  2AYK A;  2JT6 A;  1HFC A;  830C A;  2JNP A;  2OY2 A;  2FV5 A;  2KRJ A;  1RM8 A;  3KEK A;  4R3V A;  2X3B A;  3TS4 A;  2OXW A;  4ZR5 A;  1UMT A;  1D5J A;  2CKI A;  1IAD A;  4AXQ A;  1AST A;  1BUD A;  2RJP A;  1SAT A;  4FU4 A;  3HDB A;  3LIR A;  3EDZ A;  4QKZ A;  1HV5 A;  2J83 A;  3N2V A;  2E2D A;  1MMB A;  4JQG A;  4PKU A;  1BKC A;  4G0D A;  4H84 A;  3EHY A;  4WKI A; 
#chains in the Genus database with same CATH homology
 3ELM A;  3I7I A;  2DDF A;  2W12 A;  2N8R A;  1JKY A;  3VI1 A;  3B92 A;  4JA1 A;  1MNC A;  3F16 A;  3VTG A;  4GR0 A;  1SU3 A;  3V96 B;  1GE6 A;  1USN A;  1XFU A;  2W14 A;  1EB6 A;  3O2X A;  5I3M A;  2K2G A;  5D1T A;  3CKI A;  2WOA A;  2A8H A;  1D8M A;  3HBU P;  3EDH A;  5D7W A;  4PKW A;  1G49 A;  3TSK A;  3AYU A;  1QJI A;  1BQQ M;  2DW0 A;  3LKA A;  1XFV A;  1IAA A;  2HU6 A;  3LJT A;  2D1O A;  3EHX A;  1KUH A;  1FLS A;  2MZH A;  3LIK A;  2W0D A;  4A7B A;  5CXA A;  2L0R A;  3F17 A;  1K7I A;  4J4M A;  4FVL A;  3F19 A;  2MLS A;  5D1U A;  4AUO A;  1HY7 A;  5L79 A;  3NX7 A;  3HDA P;  4AIG A;  1EAK A;  1Q3A A;  1G12 A;  1R1I A;  3G5C A;  3GBO A;  1GE5 A;  2XS3 A;  1OO9 A;  3LUM A;  3DWB A;  3OHL A;  4ON1 A;  1G9K A;  5I0L A;  3BA0 A;  3EDI A;  2TCL A;  1KUI A;  1XUC A;  4PKT A;  3AIG A;  3ZUK A;  3LE9 A;  4PKR A;  2W15 A;  4DF9 A;  4GUY A;  2MZI A;  4DPE A;  1ZP5 A;  3P24 A;  4IJO A;  1R1J A;  1BM6 A;  2PJT A;  2SRT A;  5I43 A;  1AKL A;  3Q2H A;  1DMT A;  1UTT A;  1CAQ A;  5LAB A;  3KME A;  4L6T A;  1ZXC A;  1JAO A;  2OXZ A;  4GR8 A;  4GF1 A;  1H71 P;  2CLT A;  1KBC A;  3N2U A;  1YCM A;  3LUN A;  3DPE A;  2OZR A;  1PWQ A;  1AYK A;  4A3W A;  5BOY A;  1GE7 A;  1K7Q A;  1UTZ A;  2O3E A;  2K9C A;  1IAE A;  1JAP A;  1C7K A;  3LQB A;  1FBL A;  456C A;  4PKV A;  4AYK A;  1PWW A;  5CUH A;  3DSL A;  4GWN A;  2QPJ A;  2YB9 A;  1XFZ A;  1XFW A;  3Q2G A;  3AYK A;  3KRY A;  1D8F A;  1WNI A;  2ERO A;  1FM1 A;  3DL1 A;  4GR3 A;  2I47 A;  4JPA A;  1SMP A;  4GQL A;  3RTT A;  4WKE A;  3F18 A;  3B2Z A;  1YOU A;  3KWV C;  2OW2 A;  1OM6 A;  4FXY P;  1I76 A;  1C8T A;  3WV1 A;  1OMJ A;  1QIA A;  1UMS A;  1GXD A;  5L7F A;  5B5P A;  3WV3 A;  1XUD A;  2XS4 A;  4H3X A;  1A86 A;  3TT4 A;  1Y0V A;  3MA2 A;  1YP1 A;  2O36 A;  2W13 A;  2USN A;  5BPA A;  1MMP A;  1CGE A;  1HTD A;  1SLM A;  4H82 A;  1CXV A;  1ZXV A;  3WV2 A;  5JMY A;  5CZM A;  3HYG A;  5I4O A;  1EUB A;  2WO9 A;  3I7G A;  3K7N A;  2POJ A;  4L63 A;  1JAQ A;  1HFS A;  3HY9 A;  3DTK A;  1I73 A;  1CQR A;  1G05 A;  3UVC A;  2Y6C A;  1SLN A;  2ERQ A;  1UEA A;  2E3X A;  1HOV A;  3F15 A;  1MMR A;  4IN9 A;  1ZTQ A;  4L19 A;  3HBV P;  4Q1L A;  5I2Z A;  3K7L A;  1R1H A;  1S4B P;  1BUV M;  4ILW D;  4HMA A;  2OXU A;  1R54 A;  2JIH A;  3ZXH A;  3RTS A;  4H30 A;  1ZS0 A;  1BSW A;  1JH1 A;  2OVZ A;  3USN A;  2MZE A;  966C A;  3O64 A;  1ATL A;  3EDG A;  3P1V A;  2FV9 A;  3DNG A;  4H76 A;  1A85 A;  2OW0 A;  5D1S A;  2YUF A;  1XUR A;  3HB2 P;  4L7A A;  5D2B A;  1BKC E;  3DTE A;  1B3D A;  3LK8 A;  1GKD A;  3F1A A;  4PKQ A;  1PWU A;  3EWJ A;  1ZVX A;  2X3C A;  4CTH A;  1DTH A;  2D1N A;  2WO8 A;  4HX3 A;  4H49 A;  3L0T A;  1BIW A;  1KUG A;  4DV8 A;  2OW9 A;  2AIG P;  1KUK A;  3DPF A;  4I35 A;  3L0V A;  4FXQ A;  5BOT A;  1CIZ A;  3ZVS A;  1SRP A;  2DW1 A;  3KEC A;  4JIJ A;  1BKC I;  1CGF A;  1JK3 A;  2X3A A;  2DW2 A;  1BZS A;  3DTI A;  1RMZ A;  3U1R A;  5D3C A;  1L6J A;  1G4K A;  4IUW A;  4XM7 A;  1IAB A;  3OHO A;  4JP4 A;  1Y8J A;  1OS2 A;  4EFS A;  1GO7 P;  4XM8 A;  2RJQ A;  4GWM A;  4H1Q A;  1J7N A;  1I1I P;  4WK7 A;  5B5O A;  1C3I A;  4WF6 A;  4DD8 A;  3LGP A;  2MLR A;  4XBH A;  1KAP P;  1QIC A;  1Z3J A;  2Z2D A;  4XCT A;  2Y6D A;  3LEA A;  3KHI A;  1IAC A;  1QJJ A;  1ND1 A;  1D7X A;  2JT5 A;  4H2E A;  2J0T A;  1PWV A;  1O0T A;  2OI0 A;  3LMC A;  1B8Y A;  1BQO A;  3B8Z A;  1GO8 P;  2ERP A;  3LJG A;  2V4B A;  1O0Q A;  2X7M A;  3LIL A;  2YIG A;  3E8R A;  4I03 A;  1XFX A;  3HY7 A;  3SHI A;  5H8X A;  3TVC A;  1R55 A;  4WZV A;  2DDY A;  4G9L A;  3LJZ A;  1JJ9 A;  3LQ0 A;  1AF0 A;  1MMQ A;  1PWP A;  1OM7 A;  1QUA A;  1XFY A;  4PKS A;  5I12 A;  2OW1 A;  3KEJ A;  1IAG A;  1K7G A;  1OS9 A;  3G42 A;  1KUF A;  1YQY A;  2OVX A;  1CGL A;  1JAN A;  1GKC A;  1Y93 A;  4XM6 A;  1JIZ A;  1QIB A;  2OY4 A;  1ROS A;  1CK7 A;  2JSD A;  3KMC A;  1JIW P;  1OM8 A;  2AYK A;  2JT6 A;  1HFC A;  830C A;  2JNP A;  2OY2 A;  2FV5 A;  2KRJ A;  1RM8 A;  3KEK A;  4R3V A;  2X3B A;  3TS4 A;  2OXW A;  4ZR5 A;  1UMT A;  1D5J A;  2CKI A;  1IAD A;  4AXQ A;  1AST A;  1BUD A;  2RJP A;  1SAT A;  4FU4 A;  3HDB A;  3LIR A;  3EDZ A;  4QKZ A;  1HV5 A;  2J83 A;  3N2V A;  2E2D A;  1MMB A;  4JQG A;  4PKU A;  1BKC A;  4G0D A;  4H84 A;  3EHY A;  4WKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...