1BZSA

Crystal structure of mmp8 complexed with hmr2909
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
165
structure length
165
Chain Sequence
FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NEUTROPHIL COLLAGENASE
publication title Quantitative structure-activity relationship of human neutrophil collagenase (MMP-8) inhibitors using comparative molecular field analysis and X-ray structure analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 165
sequence length 165
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1998-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bzsA00
2OW0A 3ZVSA 1FM1A 2TCLA 1BKCA 1SLNA 3HY7A 1CGFA 1GE5A 2OXWA 1C8TA 5BOYA 2JIHA 1GO8P 5BOTA 2MLSA 4ON1A 1Q3AA 1H71P 3F18A 1K7QA 1SLMA 3EDIA 2JSDA 3KEJA 1C7KA 1DMTA 3LKAA 3LQ0A 2W13A 5D1UA 4WZVA 1BKCE 1HOVA 2KRJA 2OY2A 1QUAA 4H1QA 4DF9A 1IACA 3LUMA 2N8RA 4GWMA 3KEKA 2DW2A 4H76A 1MMQA 3ELMA 3B2ZA 3DNGA 2DDYA 2Z2DA 2JT5A 3I7GA 4XCTA 3DPEA 3P1VA 2V4BA 2X3CA 1Y8JA 3AYUA 3DPFA 2QPJA 3EWJA 1PWQA 5CXAA 1QJIA 4R3VA 4G0DA 1DTHA 4H82A 1HTDA 3KMEA 1GE6A 3LJTA 1G49A 4IUWA 3K7LA 4HX3A 1EAKA 2O36A 4DPEA 5L7FA 1SU3A 1KUGA 1PWVA 1ASTA 4GR3A 1D8FA 4AYKA 1G4KA 1HY7A 1GKDA 4WKIA 3EDHA 1ND1A 1SATA 1BUVM 1ROSA 1JIZA 1Z3JA 1CIZA 3B8ZA 1L6JA 1FBLA 2JT6A 1PWWA 1R55A 3LGPA 3KWVC 3RTSA 4FXYP 3USNA 3LEAA 4H2EA 3HYGA 1BQOA 4FXQA 1JK3A 1D8MA 4I35A 3F15A 3EDGA 1K7GA 3HB2P 1BSWA 4DV8A 4EFSA 1QICA 2OY4A 4JPAA 5I3MA 2MZEA 3BA0A 3HY9A 4IN9A 1HFSA 3CKIA 1BIWA 1ZTQA 1OS2A 2J83A 1AKLA 2DW0A 1XFXA 3I7IA 4WK7A 1AYKA 4A3WA 3G42A 4XM8A 4GR0A 1BQQM 3F16A 3AYKA 1I73A 4GF1A 1CXVA 2I47A 2WO8A 3DL1A 2ERQA 1BM6A 1SRPA 1XFVA 3N2VA 1GO7P 1UMTA 3HBUP 3TVCA 1IABA 3HDAP 1CGLA 2DW1A 2O3EA 3LQBA 1BUDA 2OW2A 1I1IP 1OM6A 1IAAA 1A86A 1JANA 1XFWA 1GE7A 3DSLA 1EB6A 4AIGA 1C3IA 1O0QA 1KUKA 3SHIA 4CTHA 1PWPA 4PKTA 3EHXA 3UVCA 2A8HA 4ZR5A 5BPAA 2Y6DA 1CGEA 3EHYA 2SRTA 1R1JA 1ZS0A 2POJA 3F19A 3LJGA 1UMSA 1UTZA 3B92A 2X7MA 3TS4A 3LE9A 4PKRA 1CAQA 5I4OA 3V96B 3HBVP 1XURA 2YB9A 2K2GA 1KAPP 3KECA 4XBHA 3LIKA 5I0LA 1KUFA 3RTTA 2XS4A 3F1AA 1B3DA 2E3XA 2X3BA 4GQLA 1G12A 3F17A 3LK8A 5D2BA 1YQYA 4DD8A 2W15A 1JAQA 4L6TA 4L63A 2OXUA 1JAOA 4H49A 4AXQA 2MZIA 1YOUA 5CUHA 1YCMA 2OW9A 1MMPA 1KUIA 1HV5A 2HU6A 1D5JA 1MNCA 3KMCA 4ILWD 5LABA 1CQRA 1QIBA 1WNIA 3LMCA 4JQGA 1YP1A 1G05A 1O0TA 4G9LA 1BKCI 1JAPA 2X3AA 3LJZA 3G5CA 2RJPA 3GBOA 2JNPA 4I03A 4PKQA 3L0VA 3VTGA 4QKZA 2OVZA 3DWBA 1G9KA 1ZXCA 4JP4A 1R1HA 3O64A 1K7IA 3Q2HA 5I12A 4PKSA 1RM8A 5D1TA 1Y0VA 1OM7A 1XUDA 2AYKA 4FVLA 4PKUA 966CA 5JMYA 1S4BP 2MLRA 4WF6A 2USNA 4AUOA 1EUBA 5L79A 3E8RA 1D7XA 1OMJA 2D1NA 3WV1A 3LIRA 1R54A 1ZXVA 3LUNA 1IADA 4FU4A 3OHLA 1KUHA 3WV2A 3WV3A 3ZUKA 1JKYA 1B8YA 1UTTA 5B5PA 1Y93A 1J7NA 1XFYA 1QIAA 3N2UA 3OHOA 2W0DA 2CLTA 4GUYA 1KBCA 4JIJA 2WOAA 2OVXA 1HFCA 1ZVXA 2WO9A 4GWNA 2W12A 1UEAA 5B5OA 4XM6A 1XFUA 2RJQA 830CA 1A85A 1FLSA 2XS3A 1OO9A 2OZRA 1OM8A 3AIGA 2OI0A 4PKVA 4L19A 1I76A 1ATLA 1JJ9A 2FV9A 2CKIA 2ERPA 1R1IA 3EDZA 3KHIA 4WKEA 5H8XA 1USNA 2W14A 2AIGP 5D3CA 1XFZA 3Q2GA 1BZSA 4GR8A 1JH1A 1IAGA 3O2XA 3U1RA 1ZP5A 4JA1A 4A7BA 5D1SA 2PJTA 2OW1A 4Q1LA 3K7NA 4HMAA 2K9CA 1IAEA 1SMPA 2L0RA 3TSKA 3TT4A 5I2ZA 4H30A 5I43A 1QJJA 1AF0A 1OS9A 1CK7A 2YIGA 3VI1A 4H3XA 4PKWA 3HDBA 4IJOA 3P24A 3L0TA 2MZHA 4H84A 2J0TA 4J4MA 2E2DA 1PWUA 3ZXHA 3MA2A 3KRYA 2DDFA 2Y6CA 4XM7A 1XUCA 1JIWP 1MMBA 2EROA 5CZMA 1RMZA 1MMRA 2FV5A 3NX7A 3LILA 456CA 1GXDA 2OXZA 2D1OA 1GKCA 5D7WA
chains in the Genus database with same CATH superfamily
2OW0A 3ZVSA 1FM1A 2TCLA 1BKCA 1SLNA 3HY7A 1CGFA 1GE5A 2OXWA 1C8TA 5BOYA 2JIHA 1GO8P 5BOTA 2MLSA 4ON1A 1Q3AA 1H71P 3F18A 1K7QA 1SLMA 3EDIA 2JSDA 3KEJA 1XAXA 1C7KA 1DMTA 3LKAA 3LQ0A 2W13A 5D1UA 4WZVA 1BKCE 1HOVA 2KRJA 2OY2A 1QUAA 4H1QA 4DF9A 1IACA 3LUMA 2N8RA 4GWMA 3KEKA 2DW2A 4H76A 1MMQA 3ELMA 3B2ZA 3DNGA 2DDYA 2Z2DA 2JT5A 3I7GA 4XCTA 3DPEA 3P1VA 2V4BA 2X3CA 1Y8JA 3AYUA 3DPFA 2QPJA 3EWJA 1PWQA 5CXAA 1QJIA 4R3VA 4G0DA 1DTHA 4H82A 1HTDA 3KMEA 1GE6A 3LJTA 1G49A 4IUWA 3K7LA 4HX3A 1EAKA 2O36A 4DPEA 5L7FA 1SU3A 1KUGA 1PWVA 1ASTA 4GR3A 1D8FA 4AYKA 1G4KA 1HY7A 1GKDA 4WKIA 3EDHA 1ND1A 1SATA 1BUVM 1ROSA 1JIZA 1Z3JA 1CIZA 3B8ZA 1L6JA 1FBLA 2JT6A 3DTKA 1PWWA 1R55A 3LGPA 3KWVC 3RTSA 4FXYP 3USNA 3LEAA 4H2EA 3HYGA 1BQOA 4FXQA 1JK3A 1D8MA 4I35A 3F15A 3EDGA 1K7GA 3HB2P 1BSWA 4DV8A 4EFSA 1QICA 2OY4A 4JPAA 5I3MA 2MZEA 3BA0A 3HY9A 4IN9A 1HFSA 3CKIA 1BIWA 1ZTQA 1OS2A 2J83A 1AKLA 2DW0A 1XFXA 3I7IA 4WK7A 1AYKA 4A3WA 3G42A 4XM8A 4GR0A 1BQQM 3F16A 3AYKA 1I73A 4GF1A 1CXVA 2I47A 2WO8A 3DL1A 2ERQA 4L7AA 1BM6A 1SRPA 1XFVA 3N2VA 1GO7P 1UMTA 3HBUP 3TVCA 1IABA 3HDAP 1CGLA 2DW1A 2O3EA 3LQBA 1BUDA 2OW2A 1I1IP 1OM6A 1IAAA 1A86A 1JANA 1XFWA 1GE7A 3DSLA 1EB6A 4AIGA 1C3IA 1O0QA 1KUKA 3SHIA 4CTHA 1PWPA 4PKTA 3EHXA 3UVCA 2A8HA 4ZR5A 5BPAA 2Y6DA 1OZ9A 1CGEA 3EHYA 2SRTA 1R1JA 1ZS0A 2POJA 3F19A 3LJGA 1UMSA 1UTZA 3B92A 2X7MA 3TS4A 3LE9A 4PKRA 1CAQA 5I4OA 3V96B 3HBVP 1XURA 2YB9A 2K2GA 1KAPP 3KECA 4XBHA 3LIKA 5I0LA 1KUFA 3RTTA 2XS4A 3F1AA 1B3DA 2E3XA 2X3BA 4GQLA 1G12A 3F17A 3LK8A 5D2BA 1YQYA 4DD8A 2W15A 1JAQA 4L6TA 4L63A 2OXUA 1JAOA 4H49A 4AXQA 2MZIA 1YOUA 5CUHA 1YCMA 2OW9A 1MMPA 1KUIA 1HV5A 2HU6A 1D5JA 1MNCA 3KMCA 4ILWD 5LABA 1CQRA 1QIBA 1WNIA 3LMCA 4JQGA 1YP1A 1G05A 1O0TA 4G9LA 1BKCI 1JAPA 2X3AA 3LJZA 3G5CA 2RJPA 3GBOA 2JNPA 4I03A 4PKQA 3L0VA 3VTGA 4QKZA 2OVZA 3DWBA 1G9KA 1ZXCA 4JP4A 1R1HA 3O64A 1K7IA 3Q2HA 5I12A 4PKSA 1RM8A 5D1TA 1Y0VA 1OM7A 1XUDA 2AYKA 3DTIA 4FVLA 4PKUA 966CA 5JMYA 1S4BP 2MLRA 4WF6A 3DTEA 2USNA 4AUOA 1EUBA 5L79A 3E8RA 1D7XA 1OMJA 2D1NA 3WV1A 3LIRA 1R54A 1ZXVA 3LUNA 1IADA 4FU4A 3OHLA 1KUHA 3WV2A 3WV3A 3ZUKA 1JKYA 1B8YA 1UTTA 5B5PA 1Y93A 1J7NA 1XFYA 1QIAA 3N2UA 3OHOA 2W0DA 2CLTA 4GUYA 1KBCA 4JIJA 2WOAA 2OVXA 1HFCA 1ZVXA 2WO9A 4GWNA 2W12A 1UEAA 5B5OA 4XM6A 1XFUA 2RJQA 830CA 1A85A 1FLSA 2XS3A 1OO9A 2OZRA 1OM8A 3AIGA 2OI0A 4PKVA 4L19A 1I76A 1ATLA 1JJ9A 2FV9A 2CKIA 2ERPA 1R1IA 3EDZA 3KHIA 1TVIA 4WKEA 5H8XA 1USNA 2W14A 2AIGP 5D3CA 1XFZA 3Q2GA 1BZSA 4GR8A 1JH1A 1IAGA 3O2XA 3U1RA 1ZP5A 4JA1A 4A7BA 5D1SA 2PJTA 2OW1A 4Q1LA 3K7NA 4HMAA 2K9CA 1XM5A 1IAEA 1SMPA 2L0RA 3TSKA 3TT4A 5I2ZA 4H30A 5I43A 1QJJA 1AF0A 1OS9A 1CK7A 2YIGA 3VI1A 4H3XA 4PKWA 3HDBA 4IJOA 3P24A 3L0TA 2MZHA 4H84A 2J0TA 2YUFA 4J4MA 2E2DA 1PWUA 3ZXHA 3MA2A 3KRYA 2DDFA 2Y6CA 4XM7A 1XUCA 1JIWP 1MMBA 2EROA 5CZMA 1RMZA 1MMRA 2FV5A 3NX7A 3LILA 456CA 1GXDA 2OXZA 2D1OA 1GKCA 5D7WA
chains in the Genus database with same CATH topology
2OW0A 3ZVSA 1FM1A 2TCLA 1BKCA 1SLNA 3HY7A 1CGFA 1GE5A 2OXWA 1C8TA 5BOYA 2JIHA 1GO8P 5BOTA 2MLSA 4ON1A 1Q3AA 1H71P 3F18A 1K7QA 1SLMA 3EDIA 2JSDA 3KEJA 1C7KA 1DMTA 3LKAA 3LQ0A 2W13A 5D1UA 4WZVA 1BKCE 1HOVA 2KRJA 2OY2A 1QUAA 4H1QA 4DF9A 1IACA 3LUMA 2N8RA 4GWMA 3KEKA 2DW2A 4H76A 1MMQA 3ELMA 3B2ZA 3DNGA 2DDYA 2Z2DA 2JT5A 3I7GA 4XCTA 3DPEA 3P1VA 2V4BA 2X3CA 1Y8JA 3AYUA 3DPFA 2QPJA 3EWJA 1PWQA 5CXAA 1QJIA 4R3VA 4G0DA 1DTHA 4H82A 1HTDA 3KMEA 1GE6A 3LJTA 1G49A 4IUWA 3K7LA 4HX3A 1EAKA 2O36A 4DPEA 5L7FA 1SU3A 1KUGA 1PWVA 1ASTA 4GR3A 1D8FA 4AYKA 1G4KA 1HY7A 1GKDA 4WKIA 3EDHA 1ND1A 1SATA 1BUVM 1ROSA 1JIZA 1Z3JA 1CIZA 3B8ZA 1L6JA 1FBLA 2JT6A 3DTKA 1PWWA 1R55A 3LGPA 3KWVC 3RTSA 4FXYP 3USNA 3LEAA 4H2EA 3HYGA 1BQOA 4FXQA 1JK3A 1D8MA 4I35A 3F15A 3EDGA 1K7GA 3HB2P 1BSWA 4DV8A 4EFSA 1QICA 2OY4A 4JPAA 5I3MA 2MZEA 3BA0A 3HY9A 4IN9A 1HFSA 3CKIA 1BIWA 1ZTQA 1OS2A 2J83A 1AKLA 2DW0A 1XFXA 3I7IA 4WK7A 1AYKA 4A3WA 3G42A 4XM8A 4GR0A 1BQQM 3F16A 3AYKA 1I73A 4GF1A 1CXVA 2I47A 2WO8A 3DL1A 2ERQA 4L7AA 1BM6A 1SRPA 1XFVA 3N2VA 1GO7P 1UMTA 3HBUP 3TVCA 1IABA 3HDAP 1CGLA 2DW1A 2O3EA 3LQBA 1BUDA 2OW2A 1I1IP 1OM6A 1IAAA 1A86A 1JANA 1XFWA 1GE7A 3DSLA 1EB6A 4AIGA 1C3IA 1O0QA 1KUKA 3SHIA 4CTHA 1PWPA 4PKTA 3EHXA 3UVCA 2A8HA 4ZR5A 5BPAA 2Y6DA 1CGEA 3EHYA 2SRTA 1R1JA 1ZS0A 2POJA 3F19A 3LJGA 1UMSA 1UTZA 3B92A 2X7MA 3TS4A 3LE9A 4PKRA 1CAQA 5I4OA 3V96B 3HBVP 1XURA 2YB9A 2K2GA 1KAPP 3KECA 4XBHA 3LIKA 5I0LA 1KUFA 3RTTA 2XS4A 3F1AA 1B3DA 2E3XA 2X3BA 4GQLA 1G12A 3F17A 3LK8A 5D2BA 1YQYA 4DD8A 2W15A 1JAQA 4L6TA 4L63A 2OXUA 1JAOA 4H49A 4AXQA 2MZIA 1YOUA 5CUHA 1YCMA 2OW9A 1MMPA 1KUIA 1HV5A 2HU6A 1D5JA 1MNCA 3KMCA 4ILWD 5LABA 1CQRA 1QIBA 1WNIA 3LMCA 4JQGA 1YP1A 1G05A 1O0TA 4G9LA 1BKCI 1JAPA 2X3AA 3LJZA 3G5CA 2RJPA 3GBOA 2JNPA 4I03A 4PKQA 3L0VA 3VTGA 4QKZA 2OVZA 3DWBA 1G9KA 1ZXCA 4JP4A 1R1HA 3O64A 1K7IA 3Q2HA 5I12A 4PKSA 1RM8A 5D1TA 1Y0VA 1OM7A 1XUDA 2AYKA 3DTIA 4FVLA 4PKUA 966CA 5JMYA 1S4BP 2MLRA 4WF6A 3DTEA 2USNA 4AUOA 1EUBA 5L79A 3E8RA 1D7XA 1OMJA 2D1NA 3WV1A 3LIRA 1R54A 1ZXVA 3LUNA 1IADA 4FU4A 3OHLA 1KUHA 3WV2A 3WV3A 3ZUKA 1JKYA 1B8YA 1UTTA 5B5PA 1Y93A 1J7NA 1XFYA 1QIAA 3N2UA 3OHOA 2W0DA 2CLTA 4GUYA 1KBCA 4JIJA 2WOAA 2OVXA 1HFCA 1ZVXA 2WO9A 4GWNA 2W12A 1UEAA 5B5OA 4XM6A 1XFUA 2RJQA 830CA 1A85A 1FLSA 2XS3A 1OO9A 2OZRA 1OM8A 3AIGA 2OI0A 4PKVA 4L19A 1I76A 1ATLA 1JJ9A 2FV9A 2CKIA 2ERPA 1R1IA 3EDZA 3KHIA 4WKEA 5H8XA 1USNA 2W14A 2AIGP 5D3CA 1XFZA 3Q2GA 1BZSA 4GR8A 1JH1A 1IAGA 3O2XA 3U1RA 1ZP5A 4JA1A 4A7BA 5D1SA 2PJTA 2OW1A 4Q1LA 3K7NA 4HMAA 2K9CA 1IAEA 1SMPA 2L0RA 3TSKA 3TT4A 5I2ZA 4H30A 5I43A 1QJJA 1AF0A 1OS9A 1CK7A 2YIGA 3VI1A 4H3XA 4PKWA 3HDBA 4IJOA 3P24A 3L0TA 2MZHA 4H84A 2J0TA 2YUFA 4J4MA 2E2DA 1PWUA 3ZXHA 3MA2A 3KRYA 2DDFA 2Y6CA 4XM7A 1XUCA 1JIWP 1MMBA 2EROA 5CZMA 1RMZA 1MMRA 2FV5A 3NX7A 3LILA 456CA 1GXDA 2OXZA 2D1OA 1GKCA 5D7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OW0 A;  3ZVS A;  1FM1 A;  2TCL A;  1BKC A;  1SLN A;  3HY7 A;  1CGF A;  1GE5 A;  2OXW A;  1C8T A;  5BOY A;  2JIH A;  1GO8 P;  5BOT A;  2MLS A;  4ON1 A;  1Q3A A;  1H71 P;  3F18 A;  1K7Q A;  1SLM A;  3EDI A;  2JSD A;  3KEJ A;  1C7K A;  1DMT A;  3LKA A;  3LQ0 A;  2W13 A;  5D1U A;  4WZV A;  1BKC E;  1HOV A;  2KRJ A;  2OY2 A;  1QUA A;  4H1Q A;  4DF9 A;  1IAC A;  3LUM A;  2N8R A;  4GWM A;  3KEK A;  2DW2 A;  4H76 A;  1MMQ A;  3ELM A;  3B2Z A;  3DNG A;  2DDY A;  2Z2D A;  2JT5 A;  3I7G A;  4XCT A;  3DPE A;  3P1V A;  2V4B A;  2X3C A;  1Y8J A;  3AYU A;  3DPF A;  2QPJ A;  3EWJ A;  1PWQ A;  5CXA A;  1QJI A;  4R3V A;  4G0D A;  1DTH A;  4H82 A;  1HTD A;  3KME A;  1GE6 A;  3LJT A;  1G49 A;  4IUW A;  3K7L A;  4HX3 A;  1EAK A;  2O36 A;  4DPE A;  5L7F A;  1SU3 A;  1KUG A;  1PWV A;  1AST A;  4GR3 A;  1D8F A;  4AYK A;  1G4K A;  1HY7 A;  1GKD A;  4WKI A;  3EDH A;  1ND1 A;  1SAT A;  1BUV M;  1ROS A;  1JIZ A;  1Z3J A;  1CIZ A;  3B8Z A;  1L6J A;  1FBL A;  2JT6 A;  1PWW A;  1R55 A;  3LGP A;  3KWV C;  3RTS A;  4FXY P;  3USN A;  3LEA A;  4H2E A;  3HYG A;  1BQO A;  4FXQ A;  1JK3 A;  1D8M A;  4I35 A;  3F15 A;  3EDG A;  1K7G A;  3HB2 P;  1BSW A;  4DV8 A;  4EFS A;  1QIC A;  2OY4 A;  4JPA A;  5I3M A;  2MZE A;  3BA0 A;  3HY9 A;  4IN9 A;  1HFS A;  3CKI A;  1BIW A;  1ZTQ A;  1OS2 A;  2J83 A;  1AKL A;  2DW0 A;  1XFX A;  3I7I A;  4WK7 A;  1AYK A;  4A3W A;  3G42 A;  4XM8 A;  4GR0 A;  1BQQ M;  3F16 A;  3AYK A;  1I73 A;  4GF1 A;  1CXV A;  2I47 A;  2WO8 A;  3DL1 A;  2ERQ A;  1BM6 A;  1SRP A;  1XFV A;  3N2V A;  1GO7 P;  1UMT A;  3HBU P;  3TVC A;  1IAB A;  3HDA P;  1CGL A;  2DW1 A;  2O3E A;  3LQB A;  1BUD A;  2OW2 A;  1I1I P;  1OM6 A;  1IAA A;  1A86 A;  1JAN A;  1XFW A;  1GE7 A;  3DSL A;  1EB6 A;  4AIG A;  1C3I A;  1O0Q A;  1KUK A;  3SHI A;  4CTH A;  1PWP A;  4PKT A;  3EHX A;  3UVC A;  2A8H A;  4ZR5 A;  5BPA A;  2Y6D A;  1CGE A;  3EHY A;  2SRT A;  1R1J A;  1ZS0 A;  2POJ A;  3F19 A;  3LJG A;  1UMS A;  1UTZ A;  3B92 A;  2X7M A;  3TS4 A;  3LE9 A;  4PKR A;  1CAQ A;  5I4O A;  3V96 B;  3HBV P;  1XUR A;  2YB9 A;  2K2G A;  1KAP P;  3KEC A;  4XBH A;  3LIK A;  5I0L A;  1KUF A;  3RTT A;  2XS4 A;  3F1A A;  1B3D A;  2E3X A;  2X3B A;  4GQL A;  1G12 A;  3F17 A;  3LK8 A;  5D2B A;  1YQY A;  4DD8 A;  2W15 A;  1JAQ A;  4L6T A;  4L63 A;  2OXU A;  1JAO A;  4H49 A;  4AXQ A;  2MZI A;  1YOU A;  5CUH A;  1YCM A;  2OW9 A;  1MMP A;  1KUI A;  1HV5 A;  2HU6 A;  1D5J A;  1MNC A;  3KMC A;  4ILW D;  5LAB A;  1CQR A;  1QIB A;  1WNI A;  3LMC A;  4JQG A;  1YP1 A;  1G05 A;  1O0T A;  4G9L A;  1BKC I;  1JAP A;  2X3A A;  3LJZ A;  3G5C A;  2RJP A;  3GBO A;  2JNP A;  4I03 A;  4PKQ A;  3L0V A;  3VTG A;  4QKZ A;  2OVZ A;  3DWB A;  1G9K A;  1ZXC A;  4JP4 A;  1R1H A;  3O64 A;  1K7I A;  3Q2H A;  5I12 A;  4PKS A;  1RM8 A;  5D1T A;  1Y0V A;  1OM7 A;  1XUD A;  2AYK A;  4FVL A;  4PKU A;  966C A;  5JMY A;  1S4B P;  2MLR A;  4WF6 A;  2USN A;  4AUO A;  1EUB A;  5L79 A;  3E8R A;  1D7X A;  1OMJ A;  2D1N A;  3WV1 A;  3LIR A;  1R54 A;  1ZXV A;  3LUN A;  1IAD A;  4FU4 A;  3OHL A;  1KUH A;  3WV2 A;  3WV3 A;  3ZUK A;  1JKY A;  1B8Y A;  1UTT A;  5B5P A;  1Y93 A;  1J7N A;  1XFY A;  1QIA A;  3N2U A;  3OHO A;  2W0D A;  2CLT A;  4GUY A;  1KBC A;  4JIJ A;  2WOA A;  2OVX A;  1HFC A;  1ZVX A;  2WO9 A;  4GWN A;  2W12 A;  1UEA A;  5B5O A;  4XM6 A;  1XFU A;  2RJQ A;  830C A;  1A85 A;  1FLS A;  2XS3 A;  1OO9 A;  2OZR A;  1OM8 A;  3AIG A;  2OI0 A;  4PKV A;  4L19 A;  1I76 A;  1ATL A;  1JJ9 A;  2FV9 A;  2CKI A;  2ERP A;  1R1I A;  3EDZ A;  3KHI A;  4WKE A;  5H8X A;  1USN A;  2W14 A;  2AIG P;  5D3C A;  1XFZ A;  3Q2G A;  1BZS A;  4GR8 A;  1JH1 A;  1IAG A;  3O2X A;  3U1R A;  1ZP5 A;  4JA1 A;  4A7B A;  5D1S A;  2PJT A;  2OW1 A;  4Q1L A;  3K7N A;  4HMA A;  2K9C A;  1IAE A;  1SMP A;  2L0R A;  3TSK A;  3TT4 A;  5I2Z A;  4H30 A;  5I43 A;  1QJJ A;  1AF0 A;  1OS9 A;  1CK7 A;  2YIG A;  3VI1 A;  4H3X A;  4PKW A;  3HDB A;  4IJO A;  3P24 A;  3L0T A;  2MZH A;  4H84 A;  2J0T A;  4J4M A;  2E2D A;  1PWU A;  3ZXH A;  3MA2 A;  3KRY A;  2DDF A;  2Y6C A;  4XM7 A;  1XUC A;  1JIW P;  1MMB A;  2ERO A;  5CZM A;  1RMZ A;  1MMR A;  2FV5 A;  3NX7 A;  3LIL A;  456C A;  1GXD A;  2OXZ A;  2D1O A;  1GKC A;  5D7W A; 
#chains in the Genus database with same CATH topology
 2OW0 A;  3ZVS A;  1FM1 A;  2TCL A;  1BKC A;  1SLN A;  3HY7 A;  1CGF A;  1GE5 A;  2OXW A;  1C8T A;  5BOY A;  2JIH A;  1GO8 P;  5BOT A;  2MLS A;  4ON1 A;  1Q3A A;  1H71 P;  3F18 A;  1K7Q A;  1SLM A;  3EDI A;  2JSD A;  3KEJ A;  1XAX A;  1C7K A;  1DMT A;  3LKA A;  3LQ0 A;  2W13 A;  5D1U A;  4WZV A;  1BKC E;  1HOV A;  2KRJ A;  2OY2 A;  1QUA A;  4H1Q A;  4DF9 A;  1IAC A;  3LUM A;  2N8R A;  4GWM A;  3KEK A;  2DW2 A;  4H76 A;  1MMQ A;  3ELM A;  3B2Z A;  3DNG A;  2DDY A;  2Z2D A;  2JT5 A;  3I7G A;  4XCT A;  3DPE A;  3P1V A;  2V4B A;  2X3C A;  1Y8J A;  3AYU A;  3DPF A;  2QPJ A;  3EWJ A;  1PWQ A;  5CXA A;  1QJI A;  4R3V A;  4G0D A;  1DTH A;  4H82 A;  1HTD A;  3KME A;  1GE6 A;  3LJT A;  1G49 A;  4IUW A;  3K7L A;  4HX3 A;  1EAK A;  2O36 A;  4DPE A;  5L7F A;  1SU3 A;  1KUG A;  1PWV A;  1AST A;  4GR3 A;  1D8F A;  4AYK A;  1G4K A;  1HY7 A;  1GKD A;  4WKI A;  3EDH A;  1ND1 A;  1SAT A;  1BUV M;  1ROS A;  1JIZ A;  1Z3J A;  1CIZ A;  3B8Z A;  1L6J A;  1FBL A;  2JT6 A;  3DTK A;  1PWW A;  1R55 A;  3LGP A;  3KWV C;  3RTS A;  4FXY P;  3USN A;  3LEA A;  4H2E A;  3HYG A;  1BQO A;  4FXQ A;  1JK3 A;  1D8M A;  4I35 A;  3F15 A;  3EDG A;  1K7G A;  3HB2 P;  1BSW A;  4DV8 A;  4EFS A;  1QIC A;  2OY4 A;  4JPA A;  5I3M A;  2MZE A;  3BA0 A;  3HY9 A;  4IN9 A;  1HFS A;  3CKI A;  1BIW A;  1ZTQ A;  1OS2 A;  2J83 A;  1AKL A;  2DW0 A;  1XFX A;  3I7I A;  4WK7 A;  1AYK A;  4A3W A;  3G42 A;  4XM8 A;  4GR0 A;  1BQQ M;  3F16 A;  3AYK A;  1I73 A;  4GF1 A;  1CXV A;  2I47 A;  2WO8 A;  3DL1 A;  2ERQ A;  4L7A A;  1BM6 A;  1SRP A;  1XFV A;  3N2V A;  1GO7 P;  1UMT A;  3HBU P;  3TVC A;  1IAB A;  3HDA P;  1CGL A;  2DW1 A;  2O3E A;  3LQB A;  1BUD A;  2OW2 A;  1I1I P;  1OM6 A;  1IAA A;  1A86 A;  1JAN A;  1XFW A;  1GE7 A;  3DSL A;  1EB6 A;  4AIG A;  1C3I A;  1O0Q A;  1KUK A;  3SHI A;  4CTH A;  1PWP A;  4PKT A;  3EHX A;  3UVC A;  2A8H A;  4ZR5 A;  5BPA A;  2Y6D A;  1OZ9 A;  1CGE A;  3EHY A;  2SRT A;  1R1J A;  1ZS0 A;  2POJ A;  3F19 A;  3LJG A;  1UMS A;  1UTZ A;  3B92 A;  2X7M A;  3TS4 A;  3LE9 A;  4PKR A;  1CAQ A;  5I4O A;  3V96 B;  3HBV P;  1XUR A;  2YB9 A;  2K2G A;  1KAP P;  3KEC A;  4XBH A;  3LIK A;  5I0L A;  1KUF A;  3RTT A;  2XS4 A;  3F1A A;  1B3D A;  2E3X A;  2X3B A;  4GQL A;  1G12 A;  3F17 A;  3LK8 A;  5D2B A;  1YQY A;  4DD8 A;  2W15 A;  1JAQ A;  4L6T A;  4L63 A;  2OXU A;  1JAO A;  4H49 A;  4AXQ A;  2MZI A;  1YOU A;  5CUH A;  1YCM A;  2OW9 A;  1MMP A;  1KUI A;  1HV5 A;  2HU6 A;  1D5J A;  1MNC A;  3KMC A;  4ILW D;  5LAB A;  1CQR A;  1QIB A;  1WNI A;  3LMC A;  4JQG A;  1YP1 A;  1G05 A;  1O0T A;  4G9L A;  1BKC I;  1JAP A;  2X3A A;  3LJZ A;  3G5C A;  2RJP A;  3GBO A;  2JNP A;  4I03 A;  4PKQ A;  3L0V A;  3VTG A;  4QKZ A;  2OVZ A;  3DWB A;  1G9K A;  1ZXC A;  4JP4 A;  1R1H A;  3O64 A;  1K7I A;  3Q2H A;  5I12 A;  4PKS A;  1RM8 A;  5D1T A;  1Y0V A;  1OM7 A;  1XUD A;  2AYK A;  3DTI A;  4FVL A;  4PKU A;  966C A;  5JMY A;  1S4B P;  2MLR A;  4WF6 A;  3DTE A;  2USN A;  4AUO A;  1EUB A;  5L79 A;  3E8R A;  1D7X A;  1OMJ A;  2D1N A;  3WV1 A;  3LIR A;  1R54 A;  1ZXV A;  3LUN A;  1IAD A;  4FU4 A;  3OHL A;  1KUH A;  3WV2 A;  3WV3 A;  3ZUK A;  1JKY A;  1B8Y A;  1UTT A;  5B5P A;  1Y93 A;  1J7N A;  1XFY A;  1QIA A;  3N2U A;  3OHO A;  2W0D A;  2CLT A;  4GUY A;  1KBC A;  4JIJ A;  2WOA A;  2OVX A;  1HFC A;  1ZVX A;  2WO9 A;  4GWN A;  2W12 A;  1UEA A;  5B5O A;  4XM6 A;  1XFU A;  2RJQ A;  830C A;  1A85 A;  1FLS A;  2XS3 A;  1OO9 A;  2OZR A;  1OM8 A;  3AIG A;  2OI0 A;  4PKV A;  4L19 A;  1I76 A;  1ATL A;  1JJ9 A;  2FV9 A;  2CKI A;  2ERP A;  1R1I A;  3EDZ A;  3KHI A;  1TVI A;  4WKE A;  5H8X A;  1USN A;  2W14 A;  2AIG P;  5D3C A;  1XFZ A;  3Q2G A;  1BZS A;  4GR8 A;  1JH1 A;  1IAG A;  3O2X A;  3U1R A;  1ZP5 A;  4JA1 A;  4A7B A;  5D1S A;  2PJT A;  2OW1 A;  4Q1L A;  3K7N A;  4HMA A;  2K9C A;  1XM5 A;  1IAE A;  1SMP A;  2L0R A;  3TSK A;  3TT4 A;  5I2Z A;  4H30 A;  5I43 A;  1QJJ A;  1AF0 A;  1OS9 A;  1CK7 A;  2YIG A;  3VI1 A;  4H3X A;  4PKW A;  3HDB A;  4IJO A;  3P24 A;  3L0T A;  2MZH A;  4H84 A;  2J0T A;  2YUF A;  4J4M A;  2E2D A;  1PWU A;  3ZXH A;  3MA2 A;  3KRY A;  2DDF A;  2Y6C A;  4XM7 A;  1XUC A;  1JIW P;  1MMB A;  2ERO A;  5CZM A;  1RMZ A;  1MMR A;  2FV5 A;  3NX7 A;  3LIL A;  456C A;  1GXD A;  2OXZ A;  2D1O A;  1GKC A;  5D7W A; 
#chains in the Genus database with same CATH homology
 2OW0 A;  3ZVS A;  1FM1 A;  2TCL A;  1BKC A;  1SLN A;  3HY7 A;  1CGF A;  1GE5 A;  2OXW A;  1C8T A;  5BOY A;  2JIH A;  1GO8 P;  5BOT A;  2MLS A;  4ON1 A;  1Q3A A;  1H71 P;  3F18 A;  1K7Q A;  1SLM A;  3EDI A;  2JSD A;  3KEJ A;  1C7K A;  1DMT A;  3LKA A;  3LQ0 A;  2W13 A;  5D1U A;  4WZV A;  1BKC E;  1HOV A;  2KRJ A;  2OY2 A;  1QUA A;  4H1Q A;  4DF9 A;  1IAC A;  3LUM A;  2N8R A;  4GWM A;  3KEK A;  2DW2 A;  4H76 A;  1MMQ A;  3ELM A;  3B2Z A;  3DNG A;  2DDY A;  2Z2D A;  2JT5 A;  3I7G A;  4XCT A;  3DPE A;  3P1V A;  2V4B A;  2X3C A;  1Y8J A;  3AYU A;  3DPF A;  2QPJ A;  3EWJ A;  1PWQ A;  5CXA A;  1QJI A;  4R3V A;  4G0D A;  1DTH A;  4H82 A;  1HTD A;  3KME A;  1GE6 A;  3LJT A;  1G49 A;  4IUW A;  3K7L A;  4HX3 A;  1EAK A;  2O36 A;  4DPE A;  5L7F A;  1SU3 A;  1KUG A;  1PWV A;  1AST A;  4GR3 A;  1D8F A;  4AYK A;  1G4K A;  1HY7 A;  1GKD A;  4WKI A;  3EDH A;  1ND1 A;  1SAT A;  1BUV M;  1ROS A;  1JIZ A;  1Z3J A;  1CIZ A;  3B8Z A;  1L6J A;  1FBL A;  2JT6 A;  3DTK A;  1PWW A;  1R55 A;  3LGP A;  3KWV C;  3RTS A;  4FXY P;  3USN A;  3LEA A;  4H2E A;  3HYG A;  1BQO A;  4FXQ A;  1JK3 A;  1D8M A;  4I35 A;  3F15 A;  3EDG A;  1K7G A;  3HB2 P;  1BSW A;  4DV8 A;  4EFS A;  1QIC A;  2OY4 A;  4JPA A;  5I3M A;  2MZE A;  3BA0 A;  3HY9 A;  4IN9 A;  1HFS A;  3CKI A;  1BIW A;  1ZTQ A;  1OS2 A;  2J83 A;  1AKL A;  2DW0 A;  1XFX A;  3I7I A;  4WK7 A;  1AYK A;  4A3W A;  3G42 A;  4XM8 A;  4GR0 A;  1BQQ M;  3F16 A;  3AYK A;  1I73 A;  4GF1 A;  1CXV A;  2I47 A;  2WO8 A;  3DL1 A;  2ERQ A;  4L7A A;  1BM6 A;  1SRP A;  1XFV A;  3N2V A;  1GO7 P;  1UMT A;  3HBU P;  3TVC A;  1IAB A;  3HDA P;  1CGL A;  2DW1 A;  2O3E A;  3LQB A;  1BUD A;  2OW2 A;  1I1I P;  1OM6 A;  1IAA A;  1A86 A;  1JAN A;  1XFW A;  1GE7 A;  3DSL A;  1EB6 A;  4AIG A;  1C3I A;  1O0Q A;  1KUK A;  3SHI A;  4CTH A;  1PWP A;  4PKT A;  3EHX A;  3UVC A;  2A8H A;  4ZR5 A;  5BPA A;  2Y6D A;  1CGE A;  3EHY A;  2SRT A;  1R1J A;  1ZS0 A;  2POJ A;  3F19 A;  3LJG A;  1UMS A;  1UTZ A;  3B92 A;  2X7M A;  3TS4 A;  3LE9 A;  4PKR A;  1CAQ A;  5I4O A;  3V96 B;  3HBV P;  1XUR A;  2YB9 A;  2K2G A;  1KAP P;  3KEC A;  4XBH A;  3LIK A;  5I0L A;  1KUF A;  3RTT A;  2XS4 A;  3F1A A;  1B3D A;  2E3X A;  2X3B A;  4GQL A;  1G12 A;  3F17 A;  3LK8 A;  5D2B A;  1YQY A;  4DD8 A;  2W15 A;  1JAQ A;  4L6T A;  4L63 A;  2OXU A;  1JAO A;  4H49 A;  4AXQ A;  2MZI A;  1YOU A;  5CUH A;  1YCM A;  2OW9 A;  1MMP A;  1KUI A;  1HV5 A;  2HU6 A;  1D5J A;  1MNC A;  3KMC A;  4ILW D;  5LAB A;  1CQR A;  1QIB A;  1WNI A;  3LMC A;  4JQG A;  1YP1 A;  1G05 A;  1O0T A;  4G9L A;  1BKC I;  1JAP A;  2X3A A;  3LJZ A;  3G5C A;  2RJP A;  3GBO A;  2JNP A;  4I03 A;  4PKQ A;  3L0V A;  3VTG A;  4QKZ A;  2OVZ A;  3DWB A;  1G9K A;  1ZXC A;  4JP4 A;  1R1H A;  3O64 A;  1K7I A;  3Q2H A;  5I12 A;  4PKS A;  1RM8 A;  5D1T A;  1Y0V A;  1OM7 A;  1XUD A;  2AYK A;  3DTI A;  4FVL A;  4PKU A;  966C A;  5JMY A;  1S4B P;  2MLR A;  4WF6 A;  3DTE A;  2USN A;  4AUO A;  1EUB A;  5L79 A;  3E8R A;  1D7X A;  1OMJ A;  2D1N A;  3WV1 A;  3LIR A;  1R54 A;  1ZXV A;  3LUN A;  1IAD A;  4FU4 A;  3OHL A;  1KUH A;  3WV2 A;  3WV3 A;  3ZUK A;  1JKY A;  1B8Y A;  1UTT A;  5B5P A;  1Y93 A;  1J7N A;  1XFY A;  1QIA A;  3N2U A;  3OHO A;  2W0D A;  2CLT A;  4GUY A;  1KBC A;  4JIJ A;  2WOA A;  2OVX A;  1HFC A;  1ZVX A;  2WO9 A;  4GWN A;  2W12 A;  1UEA A;  5B5O A;  4XM6 A;  1XFU A;  2RJQ A;  830C A;  1A85 A;  1FLS A;  2XS3 A;  1OO9 A;  2OZR A;  1OM8 A;  3AIG A;  2OI0 A;  4PKV A;  4L19 A;  1I76 A;  1ATL A;  1JJ9 A;  2FV9 A;  2CKI A;  2ERP A;  1R1I A;  3EDZ A;  3KHI A;  4WKE A;  5H8X A;  1USN A;  2W14 A;  2AIG P;  5D3C A;  1XFZ A;  3Q2G A;  1BZS A;  4GR8 A;  1JH1 A;  1IAG A;  3O2X A;  3U1R A;  1ZP5 A;  4JA1 A;  4A7B A;  5D1S A;  2PJT A;  2OW1 A;  4Q1L A;  3K7N A;  4HMA A;  2K9C A;  1IAE A;  1SMP A;  2L0R A;  3TSK A;  3TT4 A;  5I2Z A;  4H30 A;  5I43 A;  1QJJ A;  1AF0 A;  1OS9 A;  1CK7 A;  2YIG A;  3VI1 A;  4H3X A;  4PKW A;  3HDB A;  4IJO A;  3P24 A;  3L0T A;  2MZH A;  4H84 A;  2J0T A;  2YUF A;  4J4M A;  2E2D A;  1PWU A;  3ZXH A;  3MA2 A;  3KRY A;  2DDF A;  2Y6C A;  4XM7 A;  1XUC A;  1JIW P;  1MMB A;  2ERO A;  5CZM A;  1RMZ A;  1MMR A;  2FV5 A;  3NX7 A;  3LIL A;  456C A;  1GXD A;  2OXZ A;  2D1O A;  1GKC A;  5D7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...