1HOVA

Solution structure of a catalytic domain of mmp-2 complexed with sc-74020
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
163
structure length
163
Chain Sequence
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-2
publication title Solution structure and backbone dynamics of the catalytic domain of matrix metalloproteinase-2 complexed with a hydroxamic acid inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 25
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2000-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hovA00
1GE5A 2W15A 3KECA 5BOYA 2FV9A 1MMPA 4Q1LA 4DV8A 3RTTA 5D2BA 5I0LA 3F15A 3DPFA 1O0TA 1CAQA 1B3DA 4CTHA 3P24A 1FLSA 3DWBA 3HDAP 1GXDA 4DD8A 2DW1A 1OM8A 3OHOA 4ILWD 2OW9A 3CKIA 4GUYA 1CGEA 1CGLA 2OW2A 4WK7A 3F19A 2K2GA 3TT4A 1JAOA 3B8ZA 3EDIA 3LILA 2ERQA 2DW0A 2W14A 2V4BA 4H76A 2E2DA 1XUDA 1HFSA 4AIGA 2DW2A 1ZP5A 2Y6DA 1BUVM 1HY7A 1QJIA 1PWUA 2X3CA 1UTZA 3O64A 1C7KA 2OW0A 2X7MA 3KMEA 1ZXVA 1EAKA 1ZS0A 5I4OA 1Y0VA 1Z3JA 3WV1A 3LIRA 1QJJA 2CLTA 1GO7P 830CA 5D7WA 1H71P 5D3CA 1GO8P 1I1IP 3ZVSA 3NX7A 4I35A 1K7IA 3EHYA 1RMZA 3LJGA 3KEKA 4JA1A 2PJTA 1IAGA 1JK3A 3AYUA 4PKSA 1C3IA 1R1IA 1CQRA 3EDZA 3MA2A 2TCLA 3HBVP 4JIJA 1K7QA 2X3BA 5L79A 1QUAA 1G9KA 4H30A 3AIGA 4XCTA 2OY4A 1Y93A 4L63A 4HX3A 2J83A 1ATLA 1K7GA 3LGPA 3VTGA 3DPEA 1QIBA 1XUCA 4I03A 1O0QA 1AYKA 1HFCA 3F17A 3LMCA 1EUBA 5I3MA 1AKLA 3N2UA 5JMYA 1CGFA 3LUNA 1UTTA 1YQYA 4XM6A 1MMRA 3KRYA 1PWVA 1MMQA 1DMTA 2OI0A 3LQ0A 1S4BP 1USNA 3LJZA 1OS2A 1PWPA 4H82A 2I47A 3KHIA 2J0TA 1D7XA 1R1HA 1XURA 3DNGA 1BKCA 4XM8A 3ZXHA 2D1OA 2MLSA 3L0VA 4A7BA 2MZIA 2QPJA 3G5CA 2AIGP 4WKIA 3HY7A 1ND1A 1Q3AA 2POJA 2WO9A 1HV5A 1XFYA 1MNCA 1OM7A 1GE7A 2W13A 3K7NA 5D1UA 4H2EA 4H3XA 1WNIA 4G9LA 2JT5A 1YCMA 1G49A 1RM8A 4ON1A 2EROA 3DSLA 4PKUA 3F16A 3N2VA 1EB6A 4AXQA 2W12A 2K9CA 5CXAA 1ROSA 1XFVA 1KBCA 1KAPP 2D1NA 3HB2P 1A86A 2USNA 1KUHA 2SRTA 1JAPA 4PKRA 1QIAA 1CK7A 1XFWA 1ZTQA 2O3EA 3HBUP 3B2ZA 1FM1A 4JPAA 4IN9A 4WF6A 3V96B 4PKWA 2JT6A 4GQLA 2MZHA 3I7IA 4PKTA 2OVZA 2OW1A 1CIZA 4GR8A 3USNA 3LKAA 3ELMA 5I12A 1OMJA 4ZR5A 1FBLA 1UMSA 1BQQM 3WV2A 3KMCA 4H1QA 1XFZA 4GR0A 1ZVXA 1YOUA 1JIWP 3ZUKA 3Q2HA 4GR3A 4EFSA 1JANA 4A3WA 1I73A 2YIGA 3O2XA 1BM6A 1BUDA 1D8FA 4G0DA 2KRJA 1CXVA 4WKEA 2DDYA 4GWMA 2MZEA 3BA0A 2W0DA 2RJPA 1KUGA 4GF1A 1GE6A 1J7NA 1SU3A 3EDGA 4GWNA 5B5PA 5I43A 2ERPA 1SLNA 3LK8A 1PWWA 1BKCE 1IAEA 5CZMA 1UEAA 3GBOA 4DF9A 1KUIA 2XS3A 3P1VA 3HDBA 3WV3A 4FXQA 5CUHA 4FVLA 3LUMA 1D8MA 2OXUA 4PKVA 3DL1A 2X3AA 2XS4A 2OY2A 5BOTA 2FV5A 3Q2GA 1IADA 1OM6A 2WOAA 4DPEA 1ZXCA 4JQGA 1I76A 4AYKA 2JNPA 2O36A 1BIWA 3LE9A 3HY9A 4L19A 1R1JA 3EWJA 1JIZA 1JAQA 1DTHA 1G4KA 5LABA 3U1RA 4AUOA 1BZSA 1SRPA 4XBHA 1XFUA 5H8XA 1YP1A 1KUFA 2A8HA 1JKYA 4FU4A 1IABA 4XM7A 3G42A 1JH1A 2CKIA 3LQBA 2DDFA 4WZVA 3F18A 1OO9A 4R3VA 1AF0A 1Y8JA 4H49A 3OHLA 4HMAA 1PWQA 5D1SA 4H84A 1SATA 4FXYP 5L7FA 1MMBA 2HU6A 2JSDA 1HOVA 4J4MA 3HYGA 1KUKA 3B92A 1L6JA 2L0RA 4JP4A 2OXZA 1C8TA 966CA 2WO8A 2E3XA 1BSWA 3AYKA 1GKCA 3SHIA 1A85A 1QICA 1SMPA 2OVXA 1OS9A 2YB9A 1SLMA 456CA 1B8YA 3LIKA 3LJTA 3UVCA 1R55A 1ASTA 5D1TA 3EHXA 4L6TA 2Y6CA 4QKZA 3KEJA 5BPAA 1BQOA 3TS4A 1IAAA 3L0TA 1GKDA 3F1AA 3TVCA 1BKCI 4IJOA 2JIHA 3TSKA 3K7LA 2AYKA 4PKQA 2RJQA 2Z2DA 2N8RA 1XFXA 3I7GA 3E8RA 1IACA 5I2ZA 1JJ9A 3RTSA 3EDHA 2OXWA 5B5OA 1HTDA 3LEAA 2MLRA 1R54A 2OZRA 1D5JA 1G12A 1G05A 3KWVC 3VI1A 4IUWA 1UMTA
chains in the Genus database with same CATH superfamily
1GE5A 2W15A 3KECA 5BOYA 2FV9A 1MMPA 4Q1LA 4DV8A 3RTTA 5D2BA 5I0LA 3F15A 3DPFA 1O0TA 1CAQA 1B3DA 4CTHA 3P24A 1FLSA 3DWBA 3HDAP 1GXDA 4DD8A 2DW1A 1OM8A 3OHOA 4ILWD 2OW9A 3CKIA 4GUYA 1CGEA 1CGLA 2OW2A 4WK7A 3F19A 2K2GA 3TT4A 1JAOA 3B8ZA 3EDIA 3LILA 2ERQA 2DW0A 2W14A 2V4BA 4H76A 2E2DA 1XUDA 1HFSA 4AIGA 2DW2A 1ZP5A 2Y6DA 1BUVM 1HY7A 1QJIA 1PWUA 2X3CA 1UTZA 3O64A 1C7KA 2OW0A 2X7MA 3KMEA 1ZXVA 1EAKA 1ZS0A 5I4OA 1Y0VA 1Z3JA 3WV1A 3LIRA 1QJJA 2CLTA 1GO7P 830CA 5D7WA 1H71P 5D3CA 1GO8P 1I1IP 3ZVSA 3NX7A 4I35A 1K7IA 3EHYA 1RMZA 3LJGA 3KEKA 4JA1A 2PJTA 1IAGA 1JK3A 3AYUA 4PKSA 1C3IA 1R1IA 1CQRA 3EDZA 3MA2A 3DTEA 2TCLA 3HBVP 4JIJA 1K7QA 2X3BA 5L79A 1QUAA 1G9KA 4H30A 3AIGA 4XCTA 2OY4A 1Y93A 4L63A 4HX3A 2J83A 1ATLA 1K7GA 3LGPA 3VTGA 3DPEA 1QIBA 1XUCA 4I03A 1O0QA 1AYKA 1HFCA 3F17A 3LMCA 1EUBA 5I3MA 1AKLA 3N2UA 4L7AA 5JMYA 1CGFA 3LUNA 1UTTA 1YQYA 4XM6A 1MMRA 3KRYA 1PWVA 1MMQA 1OZ9A 1DMTA 2OI0A 3LQ0A 1S4BP 1USNA 3LJZA 1OS2A 1PWPA 4H82A 2I47A 3KHIA 2J0TA 1D7XA 1R1HA 1XURA 3DNGA 1BKCA 4XM8A 3ZXHA 2D1OA 2MLSA 3L0VA 4A7BA 2MZIA 2QPJA 3G5CA 2AIGP 4WKIA 3HY7A 1ND1A 1Q3AA 2POJA 2WO9A 1HV5A 1XFYA 1MNCA 1OM7A 1GE7A 2W13A 3K7NA 5D1UA 4H2EA 4H3XA 1WNIA 4G9LA 2JT5A 1YCMA 1G49A 1RM8A 4ON1A 2EROA 3DSLA 4PKUA 3F16A 3N2VA 1EB6A 4AXQA 2W12A 2K9CA 5CXAA 1ROSA 1XFVA 1KBCA 1KAPP 2D1NA 3HB2P 1A86A 2USNA 1KUHA 2SRTA 1JAPA 4PKRA 1QIAA 1CK7A 1XFWA 1ZTQA 2O3EA 3HBUP 3B2ZA 1FM1A 4JPAA 4IN9A 4WF6A 3V96B 4PKWA 2JT6A 4GQLA 2MZHA 3I7IA 4PKTA 2OVZA 2OW1A 1CIZA 3DTKA 4GR8A 3USNA 3LKAA 3ELMA 5I12A 1OMJA 4ZR5A 1FBLA 1UMSA 1BQQM 3WV2A 3KMCA 4H1QA 1XFZA 4GR0A 1ZVXA 1XAXA 1YOUA 1JIWP 3ZUKA 3Q2HA 4GR3A 4EFSA 1JANA 4A3WA 1I73A 2YIGA 3O2XA 1BM6A 1BUDA 1D8FA 4G0DA 2KRJA 1CXVA 4WKEA 2DDYA 4GWMA 2MZEA 3BA0A 2W0DA 2RJPA 1KUGA 4GF1A 1GE6A 1J7NA 1SU3A 3EDGA 3DTIA 4GWNA 5B5PA 5I43A 2ERPA 1SLNA 3LK8A 1PWWA 1BKCE 1IAEA 5CZMA 1UEAA 3GBOA 4DF9A 1KUIA 2XS3A 3P1VA 3HDBA 3WV3A 4FXQA 5CUHA 4FVLA 3LUMA 1D8MA 2OXUA 4PKVA 3DL1A 2X3AA 2XS4A 2OY2A 5BOTA 2FV5A 3Q2GA 1IADA 1OM6A 2WOAA 4DPEA 1ZXCA 4JQGA 1I76A 4AYKA 2JNPA 2O36A 1BIWA 3LE9A 3HY9A 4L19A 1R1JA 3EWJA 1JIZA 1JAQA 1DTHA 1G4KA 5LABA 3U1RA 4AUOA 1BZSA 1SRPA 4XBHA 1XFUA 5H8XA 1YP1A 1KUFA 2A8HA 1JKYA 4FU4A 1IABA 4XM7A 3G42A 1JH1A 2CKIA 3LQBA 2DDFA 4WZVA 3F18A 1OO9A 4R3VA 1AF0A 1Y8JA 4H49A 3OHLA 4HMAA 1PWQA 5D1SA 4H84A 1SATA 4FXYP 5L7FA 1MMBA 2HU6A 2JSDA 1HOVA 4J4MA 3HYGA 1KUKA 3B92A 1L6JA 2L0RA 4JP4A 2OXZA 1C8TA 1XM5A 966CA 2WO8A 2E3XA 1BSWA 3AYKA 1GKCA 3SHIA 1A85A 1QICA 1SMPA 2OVXA 1OS9A 1TVIA 2YB9A 1SLMA 456CA 1B8YA 3LIKA 3LJTA 3UVCA 1R55A 1ASTA 5D1TA 3EHXA 2YUFA 4L6TA 2Y6CA 4QKZA 3KEJA 5BPAA 1BQOA 3TS4A 1IAAA 3L0TA 1GKDA 3F1AA 3TVCA 1BKCI 4IJOA 2JIHA 3TSKA 3K7LA 2AYKA 4PKQA 2RJQA 2Z2DA 2N8RA 1XFXA 3I7GA 3E8RA 1IACA 5I2ZA 1JJ9A 3RTSA 3EDHA 2OXWA 5B5OA 1HTDA 3LEAA 2MLRA 1R54A 2OZRA 1D5JA 1G12A 1G05A 3KWVC 3VI1A 4IUWA 1UMTA
chains in the Genus database with same CATH topology
1GE5A 2W15A 3KECA 5BOYA 2FV9A 1MMPA 4Q1LA 4DV8A 3RTTA 5D2BA 5I0LA 3F15A 3DPFA 1O0TA 1CAQA 1B3DA 4CTHA 3P24A 1FLSA 3DWBA 3HDAP 1GXDA 4DD8A 2DW1A 1OM8A 3OHOA 4ILWD 2OW9A 3CKIA 4GUYA 1CGEA 1CGLA 2OW2A 4WK7A 3F19A 2K2GA 3TT4A 1JAOA 3B8ZA 3EDIA 3LILA 2ERQA 2DW0A 2W14A 2V4BA 4H76A 2E2DA 1XUDA 1HFSA 4AIGA 2DW2A 1ZP5A 2Y6DA 1BUVM 1HY7A 1QJIA 1PWUA 2X3CA 1UTZA 3O64A 1C7KA 2OW0A 2X7MA 3KMEA 1ZXVA 1EAKA 1ZS0A 5I4OA 1Y0VA 1Z3JA 3WV1A 3LIRA 1QJJA 2CLTA 1GO7P 830CA 5D7WA 1H71P 5D3CA 1GO8P 1I1IP 3ZVSA 3NX7A 4I35A 1K7IA 3EHYA 1RMZA 3LJGA 3KEKA 4JA1A 2PJTA 1IAGA 1JK3A 3AYUA 4PKSA 1C3IA 1R1IA 1CQRA 3EDZA 3MA2A 3DTEA 2TCLA 3HBVP 4JIJA 1K7QA 2X3BA 5L79A 1QUAA 1G9KA 4H30A 3AIGA 4XCTA 2OY4A 1Y93A 4L63A 4HX3A 2J83A 1ATLA 1K7GA 3LGPA 3VTGA 3DPEA 1QIBA 1XUCA 4I03A 1O0QA 1AYKA 1HFCA 3F17A 3LMCA 1EUBA 5I3MA 1AKLA 3N2UA 4L7AA 5JMYA 1CGFA 3LUNA 1UTTA 1YQYA 4XM6A 1MMRA 3KRYA 1PWVA 1MMQA 1DMTA 2OI0A 3LQ0A 1S4BP 1USNA 3LJZA 1OS2A 1PWPA 4H82A 2I47A 3KHIA 2J0TA 1D7XA 1R1HA 1XURA 3DNGA 1BKCA 4XM8A 3ZXHA 2D1OA 2MLSA 3L0VA 4A7BA 2MZIA 2QPJA 3G5CA 2AIGP 4WKIA 3HY7A 1ND1A 1Q3AA 2POJA 2WO9A 1HV5A 1XFYA 1MNCA 1OM7A 1GE7A 2W13A 3K7NA 5D1UA 4H2EA 4H3XA 1WNIA 4G9LA 2JT5A 1YCMA 1G49A 1RM8A 4ON1A 2EROA 3DSLA 4PKUA 3F16A 3N2VA 1EB6A 4AXQA 2W12A 2K9CA 5CXAA 1ROSA 1XFVA 1KBCA 1KAPP 2D1NA 3HB2P 1A86A 2USNA 1KUHA 2SRTA 1JAPA 4PKRA 1QIAA 1CK7A 1XFWA 1ZTQA 2O3EA 3HBUP 3B2ZA 1FM1A 4JPAA 4IN9A 4WF6A 3V96B 4PKWA 2JT6A 4GQLA 2MZHA 3I7IA 4PKTA 2OVZA 2OW1A 1CIZA 3DTKA 4GR8A 3USNA 3LKAA 3ELMA 5I12A 1OMJA 4ZR5A 1FBLA 1UMSA 1BQQM 3WV2A 3KMCA 4H1QA 1XFZA 4GR0A 1ZVXA 1YOUA 1JIWP 3ZUKA 3Q2HA 4GR3A 4EFSA 1JANA 4A3WA 1I73A 2YIGA 3O2XA 1BM6A 1BUDA 1D8FA 4G0DA 2KRJA 1CXVA 4WKEA 2DDYA 4GWMA 2MZEA 3BA0A 2W0DA 2RJPA 1KUGA 4GF1A 1GE6A 1J7NA 1SU3A 3EDGA 3DTIA 4GWNA 5B5PA 5I43A 2ERPA 1SLNA 3LK8A 1PWWA 1BKCE 1IAEA 5CZMA 1UEAA 3GBOA 4DF9A 1KUIA 2XS3A 3P1VA 3HDBA 3WV3A 4FXQA 5CUHA 4FVLA 3LUMA 1D8MA 2OXUA 4PKVA 3DL1A 2X3AA 2XS4A 2OY2A 5BOTA 2FV5A 3Q2GA 1IADA 1OM6A 2WOAA 4DPEA 1ZXCA 4JQGA 1I76A 4AYKA 2JNPA 2O36A 1BIWA 3LE9A 3HY9A 4L19A 1R1JA 3EWJA 1JIZA 1JAQA 1DTHA 1G4KA 5LABA 3U1RA 4AUOA 1BZSA 1SRPA 4XBHA 1XFUA 5H8XA 1YP1A 1KUFA 2A8HA 1JKYA 4FU4A 1IABA 4XM7A 3G42A 1JH1A 2CKIA 3LQBA 2DDFA 4WZVA 3F18A 1OO9A 4R3VA 1AF0A 1Y8JA 4H49A 3OHLA 4HMAA 1PWQA 5D1SA 4H84A 1SATA 4FXYP 5L7FA 1MMBA 2HU6A 2JSDA 1HOVA 4J4MA 3HYGA 1KUKA 3B92A 1L6JA 2L0RA 4JP4A 2OXZA 1C8TA 966CA 2WO8A 2E3XA 1BSWA 3AYKA 1GKCA 3SHIA 1A85A 1QICA 1SMPA 2OVXA 1OS9A 2YB9A 1SLMA 456CA 1B8YA 3LIKA 3LJTA 3UVCA 1R55A 1ASTA 5D1TA 3EHXA 2YUFA 4L6TA 2Y6CA 4QKZA 3KEJA 5BPAA 1BQOA 3TS4A 1IAAA 3L0TA 1GKDA 3F1AA 3TVCA 1BKCI 4IJOA 2JIHA 3TSKA 3K7LA 2AYKA 4PKQA 2RJQA 2Z2DA 2N8RA 1XFXA 3I7GA 3E8RA 1IACA 5I2ZA 1JJ9A 3RTSA 3EDHA 2OXWA 5B5OA 1HTDA 3LEAA 2MLRA 1R54A 2OZRA 1D5JA 1G12A 1G05A 3KWVC 3VI1A 4IUWA 1UMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GE5 A;  2W15 A;  3KEC A;  5BOY A;  2FV9 A;  1MMP A;  4Q1L A;  4DV8 A;  3RTT A;  5D2B A;  5I0L A;  3F15 A;  3DPF A;  1O0T A;  1CAQ A;  1B3D A;  4CTH A;  3P24 A;  1FLS A;  3DWB A;  3HDA P;  1GXD A;  4DD8 A;  2DW1 A;  1OM8 A;  3OHO A;  4ILW D;  2OW9 A;  3CKI A;  4GUY A;  1CGE A;  1CGL A;  2OW2 A;  4WK7 A;  3F19 A;  2K2G A;  3TT4 A;  1JAO A;  3B8Z A;  3EDI A;  3LIL A;  2ERQ A;  2DW0 A;  2W14 A;  2V4B A;  4H76 A;  2E2D A;  1XUD A;  1HFS A;  4AIG A;  2DW2 A;  1ZP5 A;  2Y6D A;  1BUV M;  1HY7 A;  1QJI A;  1PWU A;  2X3C A;  1UTZ A;  3O64 A;  1C7K A;  2OW0 A;  2X7M A;  3KME A;  1ZXV A;  1EAK A;  1ZS0 A;  5I4O A;  1Y0V A;  1Z3J A;  3WV1 A;  3LIR A;  1QJJ A;  2CLT A;  1GO7 P;  830C A;  5D7W A;  1H71 P;  5D3C A;  1GO8 P;  1I1I P;  3ZVS A;  3NX7 A;  4I35 A;  1K7I A;  3EHY A;  1RMZ A;  3LJG A;  3KEK A;  4JA1 A;  2PJT A;  1IAG A;  1JK3 A;  3AYU A;  4PKS A;  1C3I A;  1R1I A;  1CQR A;  3EDZ A;  3MA2 A;  2TCL A;  3HBV P;  4JIJ A;  1K7Q A;  2X3B A;  5L79 A;  1QUA A;  1G9K A;  4H30 A;  3AIG A;  4XCT A;  2OY4 A;  1Y93 A;  4L63 A;  4HX3 A;  2J83 A;  1ATL A;  1K7G A;  3LGP A;  3VTG A;  3DPE A;  1QIB A;  1XUC A;  4I03 A;  1O0Q A;  1AYK A;  1HFC A;  3F17 A;  3LMC A;  1EUB A;  5I3M A;  1AKL A;  3N2U A;  5JMY A;  1CGF A;  3LUN A;  1UTT A;  1YQY A;  4XM6 A;  1MMR A;  3KRY A;  1PWV A;  1MMQ A;  1DMT A;  2OI0 A;  3LQ0 A;  1S4B P;  1USN A;  3LJZ A;  1OS2 A;  1PWP A;  4H82 A;  2I47 A;  3KHI A;  2J0T A;  1D7X A;  1R1H A;  1XUR A;  3DNG A;  1BKC A;  4XM8 A;  3ZXH A;  2D1O A;  2MLS A;  3L0V A;  4A7B A;  2MZI A;  2QPJ A;  3G5C A;  2AIG P;  4WKI A;  3HY7 A;  1ND1 A;  1Q3A A;  2POJ A;  2WO9 A;  1HV5 A;  1XFY A;  1MNC A;  1OM7 A;  1GE7 A;  2W13 A;  3K7N A;  5D1U A;  4H2E A;  4H3X A;  1WNI A;  4G9L A;  2JT5 A;  1YCM A;  1G49 A;  1RM8 A;  4ON1 A;  2ERO A;  3DSL A;  4PKU A;  3F16 A;  3N2V A;  1EB6 A;  4AXQ A;  2W12 A;  2K9C A;  5CXA A;  1ROS A;  1XFV A;  1KBC A;  1KAP P;  2D1N A;  3HB2 P;  1A86 A;  2USN A;  1KUH A;  2SRT A;  1JAP A;  4PKR A;  1QIA A;  1CK7 A;  1XFW A;  1ZTQ A;  2O3E A;  3HBU P;  3B2Z A;  1FM1 A;  4JPA A;  4IN9 A;  4WF6 A;  3V96 B;  4PKW A;  2JT6 A;  4GQL A;  2MZH A;  3I7I A;  4PKT A;  2OVZ A;  2OW1 A;  1CIZ A;  4GR8 A;  3USN A;  3LKA A;  3ELM A;  5I12 A;  1OMJ A;  4ZR5 A;  1FBL A;  1UMS A;  1BQQ M;  3WV2 A;  3KMC A;  4H1Q A;  1XFZ A;  4GR0 A;  1ZVX A;  1YOU A;  1JIW P;  3ZUK A;  3Q2H A;  4GR3 A;  4EFS A;  1JAN A;  4A3W A;  1I73 A;  2YIG A;  3O2X A;  1BM6 A;  1BUD A;  1D8F A;  4G0D A;  2KRJ A;  1CXV A;  4WKE A;  2DDY A;  4GWM A;  2MZE A;  3BA0 A;  2W0D A;  2RJP A;  1KUG A;  4GF1 A;  1GE6 A;  1J7N A;  1SU3 A;  3EDG A;  4GWN A;  5B5P A;  5I43 A;  2ERP A;  1SLN A;  3LK8 A;  1PWW A;  1BKC E;  1IAE A;  5CZM A;  1UEA A;  3GBO A;  4DF9 A;  1KUI A;  2XS3 A;  3P1V A;  3HDB A;  3WV3 A;  4FXQ A;  5CUH A;  4FVL A;  3LUM A;  1D8M A;  2OXU A;  4PKV A;  3DL1 A;  2X3A A;  2XS4 A;  2OY2 A;  5BOT A;  2FV5 A;  3Q2G A;  1IAD A;  1OM6 A;  2WOA A;  4DPE A;  1ZXC A;  4JQG A;  1I76 A;  4AYK A;  2JNP A;  2O36 A;  1BIW A;  3LE9 A;  3HY9 A;  4L19 A;  1R1J A;  3EWJ A;  1JIZ A;  1JAQ A;  1DTH A;  1G4K A;  5LAB A;  3U1R A;  4AUO A;  1BZS A;  1SRP A;  4XBH A;  1XFU A;  5H8X A;  1YP1 A;  1KUF A;  2A8H A;  1JKY A;  4FU4 A;  1IAB A;  4XM7 A;  3G42 A;  1JH1 A;  2CKI A;  3LQB A;  2DDF A;  4WZV A;  3F18 A;  1OO9 A;  4R3V A;  1AF0 A;  1Y8J A;  4H49 A;  3OHL A;  4HMA A;  1PWQ A;  5D1S A;  4H84 A;  1SAT A;  4FXY P;  5L7F A;  1MMB A;  2HU6 A;  2JSD A;  1HOV A;  4J4M A;  3HYG A;  1KUK A;  3B92 A;  1L6J A;  2L0R A;  4JP4 A;  2OXZ A;  1C8T A;  966C A;  2WO8 A;  2E3X A;  1BSW A;  3AYK A;  1GKC A;  3SHI A;  1A85 A;  1QIC A;  1SMP A;  2OVX A;  1OS9 A;  2YB9 A;  1SLM A;  456C A;  1B8Y A;  3LIK A;  3LJT A;  3UVC A;  1R55 A;  1AST A;  5D1T A;  3EHX A;  4L6T A;  2Y6C A;  4QKZ A;  3KEJ A;  5BPA A;  1BQO A;  3TS4 A;  1IAA A;  3L0T A;  1GKD A;  3F1A A;  3TVC A;  1BKC I;  4IJO A;  2JIH A;  3TSK A;  3K7L A;  2AYK A;  4PKQ A;  2RJQ A;  2Z2D A;  2N8R A;  1XFX A;  3I7G A;  3E8R A;  1IAC A;  5I2Z A;  1JJ9 A;  3RTS A;  3EDH A;  2OXW A;  5B5O A;  1HTD A;  3LEA A;  2MLR A;  1R54 A;  2OZR A;  1D5J A;  1G12 A;  1G05 A;  3KWV C;  3VI1 A;  4IUW A;  1UMT A; 
#chains in the Genus database with same CATH topology
 1GE5 A;  2W15 A;  3KEC A;  5BOY A;  2FV9 A;  1MMP A;  4Q1L A;  4DV8 A;  3RTT A;  5D2B A;  5I0L A;  3F15 A;  3DPF A;  1O0T A;  1CAQ A;  1B3D A;  4CTH A;  3P24 A;  1FLS A;  3DWB A;  3HDA P;  1GXD A;  4DD8 A;  2DW1 A;  1OM8 A;  3OHO A;  4ILW D;  2OW9 A;  3CKI A;  4GUY A;  1CGE A;  1CGL A;  2OW2 A;  4WK7 A;  3F19 A;  2K2G A;  3TT4 A;  1JAO A;  3B8Z A;  3EDI A;  3LIL A;  2ERQ A;  2DW0 A;  2W14 A;  2V4B A;  4H76 A;  2E2D A;  1XUD A;  1HFS A;  4AIG A;  2DW2 A;  1ZP5 A;  2Y6D A;  1BUV M;  1HY7 A;  1QJI A;  1PWU A;  2X3C A;  1UTZ A;  3O64 A;  1C7K A;  2OW0 A;  2X7M A;  3KME A;  1ZXV A;  1EAK A;  1ZS0 A;  5I4O A;  1Y0V A;  1Z3J A;  3WV1 A;  3LIR A;  1QJJ A;  2CLT A;  1GO7 P;  830C A;  5D7W A;  1H71 P;  5D3C A;  1GO8 P;  1I1I P;  3ZVS A;  3NX7 A;  4I35 A;  1K7I A;  3EHY A;  1RMZ A;  3LJG A;  3KEK A;  4JA1 A;  2PJT A;  1IAG A;  1JK3 A;  3AYU A;  4PKS A;  1C3I A;  1R1I A;  1CQR A;  3EDZ A;  3MA2 A;  3DTE A;  2TCL A;  3HBV P;  4JIJ A;  1K7Q A;  2X3B A;  5L79 A;  1QUA A;  1G9K A;  4H30 A;  3AIG A;  4XCT A;  2OY4 A;  1Y93 A;  4L63 A;  4HX3 A;  2J83 A;  1ATL A;  1K7G A;  3LGP A;  3VTG A;  3DPE A;  1QIB A;  1XUC A;  4I03 A;  1O0Q A;  1AYK A;  1HFC A;  3F17 A;  3LMC A;  1EUB A;  5I3M A;  1AKL A;  3N2U A;  4L7A A;  5JMY A;  1CGF A;  3LUN A;  1UTT A;  1YQY A;  4XM6 A;  1MMR A;  3KRY A;  1PWV A;  1MMQ A;  1OZ9 A;  1DMT A;  2OI0 A;  3LQ0 A;  1S4B P;  1USN A;  3LJZ A;  1OS2 A;  1PWP A;  4H82 A;  2I47 A;  3KHI A;  2J0T A;  1D7X A;  1R1H A;  1XUR A;  3DNG A;  1BKC A;  4XM8 A;  3ZXH A;  2D1O A;  2MLS A;  3L0V A;  4A7B A;  2MZI A;  2QPJ A;  3G5C A;  2AIG P;  4WKI A;  3HY7 A;  1ND1 A;  1Q3A A;  2POJ A;  2WO9 A;  1HV5 A;  1XFY A;  1MNC A;  1OM7 A;  1GE7 A;  2W13 A;  3K7N A;  5D1U A;  4H2E A;  4H3X A;  1WNI A;  4G9L A;  2JT5 A;  1YCM A;  1G49 A;  1RM8 A;  4ON1 A;  2ERO A;  3DSL A;  4PKU A;  3F16 A;  3N2V A;  1EB6 A;  4AXQ A;  2W12 A;  2K9C A;  5CXA A;  1ROS A;  1XFV A;  1KBC A;  1KAP P;  2D1N A;  3HB2 P;  1A86 A;  2USN A;  1KUH A;  2SRT A;  1JAP A;  4PKR A;  1QIA A;  1CK7 A;  1XFW A;  1ZTQ A;  2O3E A;  3HBU P;  3B2Z A;  1FM1 A;  4JPA A;  4IN9 A;  4WF6 A;  3V96 B;  4PKW A;  2JT6 A;  4GQL A;  2MZH A;  3I7I A;  4PKT A;  2OVZ A;  2OW1 A;  1CIZ A;  3DTK A;  4GR8 A;  3USN A;  3LKA A;  3ELM A;  5I12 A;  1OMJ A;  4ZR5 A;  1FBL A;  1UMS A;  1BQQ M;  3WV2 A;  3KMC A;  4H1Q A;  1XFZ A;  4GR0 A;  1ZVX A;  1XAX A;  1YOU A;  1JIW P;  3ZUK A;  3Q2H A;  4GR3 A;  4EFS A;  1JAN A;  4A3W A;  1I73 A;  2YIG A;  3O2X A;  1BM6 A;  1BUD A;  1D8F A;  4G0D A;  2KRJ A;  1CXV A;  4WKE A;  2DDY A;  4GWM A;  2MZE A;  3BA0 A;  2W0D A;  2RJP A;  1KUG A;  4GF1 A;  1GE6 A;  1J7N A;  1SU3 A;  3EDG A;  3DTI A;  4GWN A;  5B5P A;  5I43 A;  2ERP A;  1SLN A;  3LK8 A;  1PWW A;  1BKC E;  1IAE A;  5CZM A;  1UEA A;  3GBO A;  4DF9 A;  1KUI A;  2XS3 A;  3P1V A;  3HDB A;  3WV3 A;  4FXQ A;  5CUH A;  4FVL A;  3LUM A;  1D8M A;  2OXU A;  4PKV A;  3DL1 A;  2X3A A;  2XS4 A;  2OY2 A;  5BOT A;  2FV5 A;  3Q2G A;  1IAD A;  1OM6 A;  2WOA A;  4DPE A;  1ZXC A;  4JQG A;  1I76 A;  4AYK A;  2JNP A;  2O36 A;  1BIW A;  3LE9 A;  3HY9 A;  4L19 A;  1R1J A;  3EWJ A;  1JIZ A;  1JAQ A;  1DTH A;  1G4K A;  5LAB A;  3U1R A;  4AUO A;  1BZS A;  1SRP A;  4XBH A;  1XFU A;  5H8X A;  1YP1 A;  1KUF A;  2A8H A;  1JKY A;  4FU4 A;  1IAB A;  4XM7 A;  3G42 A;  1JH1 A;  2CKI A;  3LQB A;  2DDF A;  4WZV A;  3F18 A;  1OO9 A;  4R3V A;  1AF0 A;  1Y8J A;  4H49 A;  3OHL A;  4HMA A;  1PWQ A;  5D1S A;  4H84 A;  1SAT A;  4FXY P;  5L7F A;  1MMB A;  2HU6 A;  2JSD A;  1HOV A;  4J4M A;  3HYG A;  1KUK A;  3B92 A;  1L6J A;  2L0R A;  4JP4 A;  2OXZ A;  1C8T A;  1XM5 A;  966C A;  2WO8 A;  2E3X A;  1BSW A;  3AYK A;  1GKC A;  3SHI A;  1A85 A;  1QIC A;  1SMP A;  2OVX A;  1OS9 A;  1TVI A;  2YB9 A;  1SLM A;  456C A;  1B8Y A;  3LIK A;  3LJT A;  3UVC A;  1R55 A;  1AST A;  5D1T A;  3EHX A;  2YUF A;  4L6T A;  2Y6C A;  4QKZ A;  3KEJ A;  5BPA A;  1BQO A;  3TS4 A;  1IAA A;  3L0T A;  1GKD A;  3F1A A;  3TVC A;  1BKC I;  4IJO A;  2JIH A;  3TSK A;  3K7L A;  2AYK A;  4PKQ A;  2RJQ A;  2Z2D A;  2N8R A;  1XFX A;  3I7G A;  3E8R A;  1IAC A;  5I2Z A;  1JJ9 A;  3RTS A;  3EDH A;  2OXW A;  5B5O A;  1HTD A;  3LEA A;  2MLR A;  1R54 A;  2OZR A;  1D5J A;  1G12 A;  1G05 A;  3KWV C;  3VI1 A;  4IUW A;  1UMT A; 
#chains in the Genus database with same CATH homology
 1GE5 A;  2W15 A;  3KEC A;  5BOY A;  2FV9 A;  1MMP A;  4Q1L A;  4DV8 A;  3RTT A;  5D2B A;  5I0L A;  3F15 A;  3DPF A;  1O0T A;  1CAQ A;  1B3D A;  4CTH A;  3P24 A;  1FLS A;  3DWB A;  3HDA P;  1GXD A;  4DD8 A;  2DW1 A;  1OM8 A;  3OHO A;  4ILW D;  2OW9 A;  3CKI A;  4GUY A;  1CGE A;  1CGL A;  2OW2 A;  4WK7 A;  3F19 A;  2K2G A;  3TT4 A;  1JAO A;  3B8Z A;  3EDI A;  3LIL A;  2ERQ A;  2DW0 A;  2W14 A;  2V4B A;  4H76 A;  2E2D A;  1XUD A;  1HFS A;  4AIG A;  2DW2 A;  1ZP5 A;  2Y6D A;  1BUV M;  1HY7 A;  1QJI A;  1PWU A;  2X3C A;  1UTZ A;  3O64 A;  1C7K A;  2OW0 A;  2X7M A;  3KME A;  1ZXV A;  1EAK A;  1ZS0 A;  5I4O A;  1Y0V A;  1Z3J A;  3WV1 A;  3LIR A;  1QJJ A;  2CLT A;  1GO7 P;  830C A;  5D7W A;  1H71 P;  5D3C A;  1GO8 P;  1I1I P;  3ZVS A;  3NX7 A;  4I35 A;  1K7I A;  3EHY A;  1RMZ A;  3LJG A;  3KEK A;  4JA1 A;  2PJT A;  1IAG A;  1JK3 A;  3AYU A;  4PKS A;  1C3I A;  1R1I A;  1CQR A;  3EDZ A;  3MA2 A;  3DTE A;  2TCL A;  3HBV P;  4JIJ A;  1K7Q A;  2X3B A;  5L79 A;  1QUA A;  1G9K A;  4H30 A;  3AIG A;  4XCT A;  2OY4 A;  1Y93 A;  4L63 A;  4HX3 A;  2J83 A;  1ATL A;  1K7G A;  3LGP A;  3VTG A;  3DPE A;  1QIB A;  1XUC A;  4I03 A;  1O0Q A;  1AYK A;  1HFC A;  3F17 A;  3LMC A;  1EUB A;  5I3M A;  1AKL A;  3N2U A;  4L7A A;  5JMY A;  1CGF A;  3LUN A;  1UTT A;  1YQY A;  4XM6 A;  1MMR A;  3KRY A;  1PWV A;  1MMQ A;  1DMT A;  2OI0 A;  3LQ0 A;  1S4B P;  1USN A;  3LJZ A;  1OS2 A;  1PWP A;  4H82 A;  2I47 A;  3KHI A;  2J0T A;  1D7X A;  1R1H A;  1XUR A;  3DNG A;  1BKC A;  4XM8 A;  3ZXH A;  2D1O A;  2MLS A;  3L0V A;  4A7B A;  2MZI A;  2QPJ A;  3G5C A;  2AIG P;  4WKI A;  3HY7 A;  1ND1 A;  1Q3A A;  2POJ A;  2WO9 A;  1HV5 A;  1XFY A;  1MNC A;  1OM7 A;  1GE7 A;  2W13 A;  3K7N A;  5D1U A;  4H2E A;  4H3X A;  1WNI A;  4G9L A;  2JT5 A;  1YCM A;  1G49 A;  1RM8 A;  4ON1 A;  2ERO A;  3DSL A;  4PKU A;  3F16 A;  3N2V A;  1EB6 A;  4AXQ A;  2W12 A;  2K9C A;  5CXA A;  1ROS A;  1XFV A;  1KBC A;  1KAP P;  2D1N A;  3HB2 P;  1A86 A;  2USN A;  1KUH A;  2SRT A;  1JAP A;  4PKR A;  1QIA A;  1CK7 A;  1XFW A;  1ZTQ A;  2O3E A;  3HBU P;  3B2Z A;  1FM1 A;  4JPA A;  4IN9 A;  4WF6 A;  3V96 B;  4PKW A;  2JT6 A;  4GQL A;  2MZH A;  3I7I A;  4PKT A;  2OVZ A;  2OW1 A;  1CIZ A;  3DTK A;  4GR8 A;  3USN A;  3LKA A;  3ELM A;  5I12 A;  1OMJ A;  4ZR5 A;  1FBL A;  1UMS A;  1BQQ M;  3WV2 A;  3KMC A;  4H1Q A;  1XFZ A;  4GR0 A;  1ZVX A;  1YOU A;  1JIW P;  3ZUK A;  3Q2H A;  4GR3 A;  4EFS A;  1JAN A;  4A3W A;  1I73 A;  2YIG A;  3O2X A;  1BM6 A;  1BUD A;  1D8F A;  4G0D A;  2KRJ A;  1CXV A;  4WKE A;  2DDY A;  4GWM A;  2MZE A;  3BA0 A;  2W0D A;  2RJP A;  1KUG A;  4GF1 A;  1GE6 A;  1J7N A;  1SU3 A;  3EDG A;  3DTI A;  4GWN A;  5B5P A;  5I43 A;  2ERP A;  1SLN A;  3LK8 A;  1PWW A;  1BKC E;  1IAE A;  5CZM A;  1UEA A;  3GBO A;  4DF9 A;  1KUI A;  2XS3 A;  3P1V A;  3HDB A;  3WV3 A;  4FXQ A;  5CUH A;  4FVL A;  3LUM A;  1D8M A;  2OXU A;  4PKV A;  3DL1 A;  2X3A A;  2XS4 A;  2OY2 A;  5BOT A;  2FV5 A;  3Q2G A;  1IAD A;  1OM6 A;  2WOA A;  4DPE A;  1ZXC A;  4JQG A;  1I76 A;  4AYK A;  2JNP A;  2O36 A;  1BIW A;  3LE9 A;  3HY9 A;  4L19 A;  1R1J A;  3EWJ A;  1JIZ A;  1JAQ A;  1DTH A;  1G4K A;  5LAB A;  3U1R A;  4AUO A;  1BZS A;  1SRP A;  4XBH A;  1XFU A;  5H8X A;  1YP1 A;  1KUF A;  2A8H A;  1JKY A;  4FU4 A;  1IAB A;  4XM7 A;  3G42 A;  1JH1 A;  2CKI A;  3LQB A;  2DDF A;  4WZV A;  3F18 A;  1OO9 A;  4R3V A;  1AF0 A;  1Y8J A;  4H49 A;  3OHL A;  4HMA A;  1PWQ A;  5D1S A;  4H84 A;  1SAT A;  4FXY P;  5L7F A;  1MMB A;  2HU6 A;  2JSD A;  1HOV A;  4J4M A;  3HYG A;  1KUK A;  3B92 A;  1L6J A;  2L0R A;  4JP4 A;  2OXZ A;  1C8T A;  966C A;  2WO8 A;  2E3X A;  1BSW A;  3AYK A;  1GKC A;  3SHI A;  1A85 A;  1QIC A;  1SMP A;  2OVX A;  1OS9 A;  2YB9 A;  1SLM A;  456C A;  1B8Y A;  3LIK A;  3LJT A;  3UVC A;  1R55 A;  1AST A;  5D1T A;  3EHX A;  2YUF A;  4L6T A;  2Y6C A;  4QKZ A;  3KEJ A;  5BPA A;  1BQO A;  3TS4 A;  1IAA A;  3L0T A;  1GKD A;  3F1A A;  3TVC A;  1BKC I;  4IJO A;  2JIH A;  3TSK A;  3K7L A;  2AYK A;  4PKQ A;  2RJQ A;  2Z2D A;  2N8R A;  1XFX A;  3I7G A;  3E8R A;  1IAC A;  5I2Z A;  1JJ9 A;  3RTS A;  3EDH A;  2OXW A;  5B5O A;  1HTD A;  3LEA A;  2MLR A;  1R54 A;  2OZR A;  1D5J A;  1G12 A;  1G05 A;  3KWV C;  3VI1 A;  4IUW A;  1UMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...