1QICA

Crystal structure of stromelysin catalytic domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
IPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STROMELYSIN-1)
publication title X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qicA00
1R1JA 3F16A 4PKWA 3F18A 1FBLA 1KUGA 3LUNA 1RMZA 1RM8A 2HU6A 3KHIA 1ZS0A 3LKAA 2JT5A 4G0DA 4I35A 4CTHA 1QJJA 1OM7A 5I0LA 2ERPA 4L6TA 4AUOA 1R1HA 4DV8A 5B5PA 2RJQA 2W15A 2OW2A 4GUYA 1C7KA 4AYKA 1D8MA 4PKVA 1K7GA 1A85A 1SU3A 2USNA 4GQLA 4WKEA 3RTSA 1JAPA 1SLMA 1QUAA 4R3VA 2Y6CA 1BZSA 1XUCA 2W0DA 4EFSA 4Q1LA 3NX7A 2SRTA 1HTDA 3BA0A 2OW1A 2CKIA 1BUVM 2W12A 4XCTA 3EDIA 1CXVA 2YB9A 1KBCA 1CIZA 4WK7A 3AYKA 3Q2GA 5H8XA 3USNA 2OVZA 3F17A 1PWQA 2X3CA 5CXAA 1OM8A 5D7WA 2Z2DA 4WKIA 3LQBA 4J4MA 5I3MA 2KRJA 3B8ZA 1CGFA 3EHXA 4H49A 1ZP5A 1SLNA 1UTTA 2E3XA 2OXZA 3O64A 1GE7A 3DWBA 5JMYA 4GR0A 3TVCA 3LEAA 3WV1A 2L0RA 1UMTA 1R54A 4HMAA 4PKQA 2FV9A 3LK8A 2DW0A 1BQOA 1JJ9A 3P24A 4ZR5A 4FXYP 4XM6A 2YIGA 3ZUKA 1B3DA 4H30A 1PWWA 1JK3A 1IACA 4H3XA 1FM1A 1ATLA 3DPFA 1AKLA 3KMCA 3F1AA 1D7XA 3KEJA 5L79A 2OY2A 1HY7A 2MZHA 3F15A 5CUHA 4JQGA 2D1NA 3LILA 2WOAA 1XFVA 2X3AA 2I47A 1OO9A 3LGPA 2W14A 3L0VA 3N2VA 1JAOA 1JANA 3LQ0A 1H71P 3LJGA 1HV5A 1C3IA 1D8FA 4AIGA 2AIGP 1DTHA 3KMEA 1IABA 2XS4A 1L6JA 5L7FA 2DW2A 1PWUA 1XUDA 4JA1A 3O2XA 1QIBA 3ELMA 4ON1A 5I4OA 4L63A 966CA 1MMRA 3HDBA 3LUMA 1ASTA 1I73A 4XBHA 4DF9A 3OHLA 3B2ZA 4H84A 2O3EA 3TSKA 1EUBA 1OM6A 2Y6DA 1GKDA 2DDFA 5LABA 1JH1A 2AYKA 2WO9A 2OI0A 5D1UA 1EB6A 3HB2P 4H2EA 1KUKA 3DPEA 3ZXHA 1K7QA 1R55A 1OS9A 3RTTA 2X7MA 3TS4A 1CQRA 2OY4A 830CA 1S4BP 3CKIA 2MZEA 2MLRA 5BPAA 1XFXA 1R1IA 2DW1A 4IJOA 2E2DA 1HOVA 1CGEA 3EHYA 2CLTA 2JNPA 4AXQA 1IAGA 2J83A 4ILWD 3VI1A 1G9KA 2POJA 1ZXVA 2EROA 1G12A 1J7NA 3EDGA 1G4KA 5BOTA 2XS3A 1Z3JA 5BOYA 1DMTA 5D1TA 1YQYA 2A8HA 1MNCA 1GO8P 1PWPA 3OHOA 2J0TA 4JPAA 2OW9A 4DPEA 1GXDA 1MMQA 1CAQA 3WV3A 3LJTA 1B8YA 1WNIA 3L0TA 1OS2A 1KAPP 1I1IP 4WZVA 3VTGA 1O0TA 2DDYA 1ZVXA 4G9LA 2TCLA 3E8RA 3LIKA 1I76A 5CZMA 1KUHA 1Y93A 1AF0A 3HBUP 1BQQM 2O36A 2K9CA 4IUWA 5D3CA 2PJTA 1OMJA 3V96B 1HFCA 3LMCA 3UVCA 2OW0A 1A86A 4I03A 2OXWA 3MA2A 3ZVSA 1JIZA 1BSWA 2ERQA 4GWMA 4GR8A 456CA 3KEKA 3EDZA 3HYGA 4XM7A 1QICA 1UTZA 1D5JA 1GE5A 1KUFA 2N8RA 3LIRA 3EWJA 1BKCI 3I7GA 5D2BA 3AYUA 3N2UA 3LJZA 4FU4A 4HX3A 3I7IA 4A7BA 1BM6A 3G5CA 4GR3A 3WV2A 1PWVA 3U1RA 1IADA 3KRYA 1YP1A 1G49A 5I12A 1JAQA 1JIWP 1SMPA 1FLSA 4FXQA 1ROSA 3HY7A 1BUDA 3P1VA 3KECA 4PKUA 4XM8A 3DL1A 1IAAA 1XFZA 1QJIA 1ZTQA 3K7NA 5I2ZA 2RJPA 1XFUA 1MMBA 1SRPA 4QKZA 3Q2HA 3GBOA 4PKRA 1CK7A 1C8TA 1UMSA 1AYKA 1YCMA 2MZIA 3KWVC 1YOUA 3LE9A 1BKCA 3HY9A 2OZRA 1CGLA 3TT4A 1MMPA 2JSDA 2OVXA 4DD8A 1GE6A 1XFYA 3SHIA 4A3WA 4GWNA 4JIJA 1KUIA 2V4BA 1GO7P 1Y8JA 1UEAA 2JT6A 1SATA 2FV5A 3F19A 3AIGA 4PKSA 4PKTA 1GKCA 4FVLA 4L19A 5D1SA 1ZXCA 1BIWA 1ND1A 4H82A 1Q3AA 3G42A 5B5OA 2D1OA 3K7LA 5I43A 1IAEA 1XURA 1USNA 3HBVP 2MLSA 3DNGA 4WF6A 2WO8A 4JP4A 1K7IA 2OXUA 1XFWA 4H76A 4IN9A 1HFSA 4GF1A 1Y0VA 2QPJA 1JKYA 1QIAA 3EDHA 1BKCE 1O0QA 2X3BA 2W13A 4H1QA 3DSLA 2K2GA 3HDAP 1EAKA 3B92A 1G05A 2JIHA
chains in the Genus database with same CATH superfamily
1R1JA 3F16A 4PKWA 3F18A 1FBLA 1KUGA 3LUNA 1RMZA 1RM8A 2HU6A 3KHIA 1ZS0A 3LKAA 2JT5A 4G0DA 4I35A 4CTHA 1QJJA 1OM7A 5I0LA 2ERPA 4L6TA 1XAXA 3DTKA 4AUOA 1R1HA 4DV8A 5B5PA 2RJQA 2W15A 2OW2A 4GUYA 1C7KA 4AYKA 1D8MA 4PKVA 1K7GA 1A85A 1SU3A 2USNA 4GQLA 4WKEA 3RTSA 1JAPA 1SLMA 1QUAA 4R3VA 2Y6CA 1BZSA 1XUCA 2W0DA 4EFSA 4Q1LA 3NX7A 2SRTA 1HTDA 3BA0A 2OW1A 2CKIA 1BUVM 2W12A 4XCTA 3EDIA 1CXVA 2YB9A 1KBCA 1CIZA 4WK7A 3AYKA 3Q2GA 5H8XA 3USNA 2OVZA 3F17A 1PWQA 2X3CA 5CXAA 1OM8A 5D7WA 2Z2DA 4WKIA 3LQBA 4J4MA 5I3MA 2KRJA 3B8ZA 1CGFA 3EHXA 4H49A 1ZP5A 1SLNA 1UTTA 2E3XA 2OXZA 3O64A 1GE7A 3DWBA 5JMYA 4GR0A 3TVCA 3LEAA 3WV1A 2L0RA 1UMTA 1R54A 4HMAA 4PKQA 2FV9A 3LK8A 2DW0A 1BQOA 1JJ9A 3P24A 4ZR5A 4FXYP 4XM6A 2YIGA 3ZUKA 1B3DA 4H30A 1PWWA 1JK3A 1IACA 4H3XA 1FM1A 1ATLA 3DPFA 1AKLA 3KMCA 3F1AA 1D7XA 3KEJA 5L79A 2OY2A 1HY7A 2MZHA 3F15A 5CUHA 4JQGA 2D1NA 3LILA 2WOAA 1XFVA 2X3AA 2I47A 1OO9A 3LGPA 2W14A 3L0VA 3N2VA 1JAOA 1JANA 3LQ0A 1H71P 3LJGA 1HV5A 1C3IA 1D8FA 4AIGA 2AIGP 1DTHA 3KMEA 1IABA 1TVIA 2XS4A 1L6JA 5L7FA 2DW2A 1PWUA 1XUDA 4JA1A 3O2XA 1QIBA 3ELMA 4ON1A 5I4OA 4L63A 966CA 1MMRA 3HDBA 3LUMA 1ASTA 1I73A 4XBHA 4DF9A 3OHLA 3B2ZA 4H84A 2O3EA 3TSKA 1EUBA 1OM6A 2Y6DA 1GKDA 2DDFA 5LABA 1JH1A 2AYKA 2WO9A 2OI0A 5D1UA 1EB6A 3HB2P 4H2EA 1KUKA 3DPEA 3ZXHA 1K7QA 1R55A 1OS9A 3RTTA 2X7MA 3TS4A 1CQRA 2OY4A 830CA 1S4BP 3CKIA 2MZEA 2MLRA 5BPAA 1XFXA 3DTEA 1R1IA 2DW1A 4IJOA 2E2DA 1HOVA 1CGEA 3EHYA 2CLTA 2JNPA 4AXQA 1IAGA 2J83A 4ILWD 3VI1A 1G9KA 2POJA 1ZXVA 2EROA 1G12A 1J7NA 3EDGA 1G4KA 5BOTA 2XS3A 1Z3JA 5BOYA 1DMTA 5D1TA 1YQYA 2A8HA 1MNCA 1GO8P 1PWPA 3OHOA 2J0TA 4JPAA 2OW9A 4DPEA 1GXDA 1MMQA 1CAQA 3WV3A 3LJTA 1B8YA 1WNIA 3L0TA 1OS2A 1KAPP 1I1IP 3DTIA 4WZVA 3VTGA 1O0TA 2DDYA 1ZVXA 4G9LA 2TCLA 3E8RA 3LIKA 1I76A 5CZMA 1KUHA 1Y93A 1AF0A 3HBUP 1BQQM 2O36A 2K9CA 4IUWA 5D3CA 2PJTA 1OMJA 1XM5A 3V96B 1HFCA 3LMCA 3UVCA 2OW0A 1A86A 4I03A 2OXWA 3MA2A 3ZVSA 1JIZA 1BSWA 2ERQA 4GWMA 4GR8A 456CA 3KEKA 3EDZA 3HYGA 4XM7A 1QICA 1UTZA 1D5JA 1GE5A 1KUFA 2N8RA 3LIRA 3EWJA 1BKCI 3I7GA 5D2BA 3AYUA 3N2UA 3LJZA 4FU4A 4HX3A 3I7IA 4A7BA 1BM6A 3G5CA 4GR3A 3WV2A 1PWVA 3U1RA 1IADA 3KRYA 1YP1A 1G49A 5I12A 1JAQA 1JIWP 1SMPA 1FLSA 4FXQA 1ROSA 3HY7A 1BUDA 3P1VA 3KECA 4PKUA 4XM8A 3DL1A 1IAAA 1XFZA 1QJIA 1ZTQA 2YUFA 3K7NA 5I2ZA 2RJPA 1XFUA 1MMBA 1SRPA 4QKZA 1OZ9A 3Q2HA 3GBOA 4PKRA 1CK7A 1C8TA 1UMSA 1AYKA 1YCMA 2MZIA 3KWVC 1YOUA 3LE9A 1BKCA 3HY9A 2OZRA 1CGLA 3TT4A 1MMPA 2JSDA 2OVXA 4DD8A 1GE6A 1XFYA 3SHIA 4A3WA 4GWNA 4JIJA 1KUIA 2V4BA 1GO7P 1Y8JA 1UEAA 2JT6A 1SATA 2FV5A 3F19A 3AIGA 4PKSA 4PKTA 1GKCA 4FVLA 4L19A 5D1SA 1ZXCA 1BIWA 1ND1A 4H82A 1Q3AA 3G42A 4L7AA 5B5OA 2D1OA 3K7LA 5I43A 1IAEA 1XURA 1USNA 3HBVP 2MLSA 3DNGA 4WF6A 2WO8A 4JP4A 1K7IA 2OXUA 1XFWA 4H76A 4IN9A 1HFSA 4GF1A 1Y0VA 2QPJA 1JKYA 1QIAA 3EDHA 1BKCE 1O0QA 2X3BA 2W13A 4H1QA 3DSLA 2K2GA 3HDAP 1EAKA 3B92A 1G05A 2JIHA
chains in the Genus database with same CATH topology
1R1JA 3F16A 4PKWA 3F18A 1FBLA 1KUGA 3LUNA 1RMZA 1RM8A 2HU6A 3KHIA 1ZS0A 3LKAA 2JT5A 4G0DA 4I35A 4CTHA 1QJJA 1OM7A 5I0LA 2ERPA 4L6TA 3DTKA 4AUOA 1R1HA 4DV8A 5B5PA 2RJQA 2W15A 2OW2A 4GUYA 1C7KA 4AYKA 1D8MA 4PKVA 1K7GA 1A85A 1SU3A 2USNA 4GQLA 4WKEA 3RTSA 1JAPA 1SLMA 1QUAA 4R3VA 2Y6CA 1BZSA 1XUCA 2W0DA 4EFSA 4Q1LA 3NX7A 2SRTA 1HTDA 3BA0A 2OW1A 2CKIA 1BUVM 2W12A 4XCTA 3EDIA 1CXVA 2YB9A 1KBCA 1CIZA 4WK7A 3AYKA 3Q2GA 5H8XA 3USNA 2OVZA 3F17A 1PWQA 2X3CA 5CXAA 1OM8A 5D7WA 2Z2DA 4WKIA 3LQBA 4J4MA 5I3MA 2KRJA 3B8ZA 1CGFA 3EHXA 4H49A 1ZP5A 1SLNA 1UTTA 2E3XA 2OXZA 3O64A 1GE7A 3DWBA 5JMYA 4GR0A 3TVCA 3LEAA 3WV1A 2L0RA 1UMTA 1R54A 4HMAA 4PKQA 2FV9A 3LK8A 2DW0A 1BQOA 1JJ9A 3P24A 4ZR5A 4FXYP 4XM6A 2YIGA 3ZUKA 1B3DA 4H30A 1PWWA 1JK3A 1IACA 4H3XA 1FM1A 1ATLA 3DPFA 1AKLA 3KMCA 3F1AA 1D7XA 3KEJA 5L79A 2OY2A 1HY7A 2MZHA 3F15A 5CUHA 4JQGA 2D1NA 3LILA 2WOAA 1XFVA 2X3AA 2I47A 1OO9A 3LGPA 2W14A 3L0VA 3N2VA 1JAOA 1JANA 3LQ0A 1H71P 3LJGA 1HV5A 1C3IA 1D8FA 4AIGA 2AIGP 1DTHA 3KMEA 1IABA 2XS4A 1L6JA 5L7FA 2DW2A 1PWUA 1XUDA 4JA1A 3O2XA 1QIBA 3ELMA 4ON1A 5I4OA 4L63A 966CA 1MMRA 3HDBA 3LUMA 1ASTA 1I73A 4XBHA 4DF9A 3OHLA 3B2ZA 4H84A 2O3EA 3TSKA 1EUBA 1OM6A 2Y6DA 1GKDA 2DDFA 5LABA 1JH1A 2AYKA 2WO9A 2OI0A 5D1UA 1EB6A 3HB2P 4H2EA 1KUKA 3DPEA 3ZXHA 1K7QA 1R55A 1OS9A 3RTTA 2X7MA 3TS4A 1CQRA 2OY4A 830CA 1S4BP 3CKIA 2MZEA 2MLRA 5BPAA 1XFXA 3DTEA 1R1IA 2DW1A 4IJOA 2E2DA 1HOVA 1CGEA 3EHYA 2CLTA 2JNPA 4AXQA 1IAGA 2J83A 4ILWD 3VI1A 1G9KA 2POJA 1ZXVA 2EROA 1G12A 1J7NA 3EDGA 1G4KA 5BOTA 2XS3A 1Z3JA 5BOYA 1DMTA 5D1TA 1YQYA 2A8HA 1MNCA 1GO8P 1PWPA 3OHOA 2J0TA 4JPAA 2OW9A 4DPEA 1GXDA 1MMQA 1CAQA 3WV3A 3LJTA 1B8YA 1WNIA 3L0TA 1OS2A 1KAPP 1I1IP 3DTIA 4WZVA 3VTGA 1O0TA 2DDYA 1ZVXA 4G9LA 2TCLA 3E8RA 3LIKA 1I76A 5CZMA 1KUHA 1Y93A 1AF0A 3HBUP 1BQQM 2O36A 2K9CA 4IUWA 5D3CA 2PJTA 1OMJA 3V96B 1HFCA 3LMCA 3UVCA 2OW0A 1A86A 4I03A 2OXWA 3MA2A 3ZVSA 1JIZA 1BSWA 2ERQA 4GWMA 4GR8A 456CA 3KEKA 3EDZA 3HYGA 4XM7A 1QICA 1UTZA 1D5JA 1GE5A 1KUFA 2N8RA 3LIRA 3EWJA 1BKCI 3I7GA 5D2BA 3AYUA 3N2UA 3LJZA 4FU4A 4HX3A 3I7IA 4A7BA 1BM6A 3G5CA 4GR3A 3WV2A 1PWVA 3U1RA 1IADA 3KRYA 1YP1A 1G49A 5I12A 1JAQA 1JIWP 1SMPA 1FLSA 4FXQA 1ROSA 3HY7A 1BUDA 3P1VA 3KECA 4PKUA 4XM8A 3DL1A 1IAAA 1XFZA 1QJIA 1ZTQA 2YUFA 3K7NA 5I2ZA 2RJPA 1XFUA 1MMBA 1SRPA 4QKZA 3Q2HA 3GBOA 4PKRA 1CK7A 1C8TA 1UMSA 1AYKA 1YCMA 2MZIA 3KWVC 1YOUA 3LE9A 1BKCA 3HY9A 2OZRA 1CGLA 3TT4A 1MMPA 2JSDA 2OVXA 4DD8A 1GE6A 1XFYA 3SHIA 4A3WA 4GWNA 4JIJA 1KUIA 2V4BA 1GO7P 1Y8JA 1UEAA 2JT6A 1SATA 2FV5A 3F19A 3AIGA 4PKSA 4PKTA 1GKCA 4FVLA 4L19A 5D1SA 1ZXCA 1BIWA 1ND1A 4H82A 1Q3AA 3G42A 4L7AA 5B5OA 2D1OA 3K7LA 5I43A 1IAEA 1XURA 1USNA 3HBVP 2MLSA 3DNGA 4WF6A 2WO8A 4JP4A 1K7IA 2OXUA 1XFWA 4H76A 4IN9A 1HFSA 4GF1A 1Y0VA 2QPJA 1JKYA 1QIAA 3EDHA 1BKCE 1O0QA 2X3BA 2W13A 4H1QA 3DSLA 2K2GA 3HDAP 1EAKA 3B92A 1G05A 2JIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1J A;  3F16 A;  4PKW A;  3F18 A;  1FBL A;  1KUG A;  3LUN A;  1RMZ A;  1RM8 A;  2HU6 A;  3KHI A;  1ZS0 A;  3LKA A;  2JT5 A;  4G0D A;  4I35 A;  4CTH A;  1QJJ A;  1OM7 A;  5I0L A;  2ERP A;  4L6T A;  4AUO A;  1R1H A;  4DV8 A;  5B5P A;  2RJQ A;  2W15 A;  2OW2 A;  4GUY A;  1C7K A;  4AYK A;  1D8M A;  4PKV A;  1K7G A;  1A85 A;  1SU3 A;  2USN A;  4GQL A;  4WKE A;  3RTS A;  1JAP A;  1SLM A;  1QUA A;  4R3V A;  2Y6C A;  1BZS A;  1XUC A;  2W0D A;  4EFS A;  4Q1L A;  3NX7 A;  2SRT A;  1HTD A;  3BA0 A;  2OW1 A;  2CKI A;  1BUV M;  2W12 A;  4XCT A;  3EDI A;  1CXV A;  2YB9 A;  1KBC A;  1CIZ A;  4WK7 A;  3AYK A;  3Q2G A;  5H8X A;  3USN A;  2OVZ A;  3F17 A;  1PWQ A;  2X3C A;  5CXA A;  1OM8 A;  5D7W A;  2Z2D A;  4WKI A;  3LQB A;  4J4M A;  5I3M A;  2KRJ A;  3B8Z A;  1CGF A;  3EHX A;  4H49 A;  1ZP5 A;  1SLN A;  1UTT A;  2E3X A;  2OXZ A;  3O64 A;  1GE7 A;  3DWB A;  5JMY A;  4GR0 A;  3TVC A;  3LEA A;  3WV1 A;  2L0R A;  1UMT A;  1R54 A;  4HMA A;  4PKQ A;  2FV9 A;  3LK8 A;  2DW0 A;  1BQO A;  1JJ9 A;  3P24 A;  4ZR5 A;  4FXY P;  4XM6 A;  2YIG A;  3ZUK A;  1B3D A;  4H30 A;  1PWW A;  1JK3 A;  1IAC A;  4H3X A;  1FM1 A;  1ATL A;  3DPF A;  1AKL A;  3KMC A;  3F1A A;  1D7X A;  3KEJ A;  5L79 A;  2OY2 A;  1HY7 A;  2MZH A;  3F15 A;  5CUH A;  4JQG A;  2D1N A;  3LIL A;  2WOA A;  1XFV A;  2X3A A;  2I47 A;  1OO9 A;  3LGP A;  2W14 A;  3L0V A;  3N2V A;  1JAO A;  1JAN A;  3LQ0 A;  1H71 P;  3LJG A;  1HV5 A;  1C3I A;  1D8F A;  4AIG A;  2AIG P;  1DTH A;  3KME A;  1IAB A;  2XS4 A;  1L6J A;  5L7F A;  2DW2 A;  1PWU A;  1XUD A;  4JA1 A;  3O2X A;  1QIB A;  3ELM A;  4ON1 A;  5I4O A;  4L63 A;  966C A;  1MMR A;  3HDB A;  3LUM A;  1AST A;  1I73 A;  4XBH A;  4DF9 A;  3OHL A;  3B2Z A;  4H84 A;  2O3E A;  3TSK A;  1EUB A;  1OM6 A;  2Y6D A;  1GKD A;  2DDF A;  5LAB A;  1JH1 A;  2AYK A;  2WO9 A;  2OI0 A;  5D1U A;  1EB6 A;  3HB2 P;  4H2E A;  1KUK A;  3DPE A;  3ZXH A;  1K7Q A;  1R55 A;  1OS9 A;  3RTT A;  2X7M A;  3TS4 A;  1CQR A;  2OY4 A;  830C A;  1S4B P;  3CKI A;  2MZE A;  2MLR A;  5BPA A;  1XFX A;  1R1I A;  2DW1 A;  4IJO A;  2E2D A;  1HOV A;  1CGE A;  3EHY A;  2CLT A;  2JNP A;  4AXQ A;  1IAG A;  2J83 A;  4ILW D;  3VI1 A;  1G9K A;  2POJ A;  1ZXV A;  2ERO A;  1G12 A;  1J7N A;  3EDG A;  1G4K A;  5BOT A;  2XS3 A;  1Z3J A;  5BOY A;  1DMT A;  5D1T A;  1YQY A;  2A8H A;  1MNC A;  1GO8 P;  1PWP A;  3OHO A;  2J0T A;  4JPA A;  2OW9 A;  4DPE A;  1GXD A;  1MMQ A;  1CAQ A;  3WV3 A;  3LJT A;  1B8Y A;  1WNI A;  3L0T A;  1OS2 A;  1KAP P;  1I1I P;  4WZV A;  3VTG A;  1O0T A;  2DDY A;  1ZVX A;  4G9L A;  2TCL A;  3E8R A;  3LIK A;  1I76 A;  5CZM A;  1KUH A;  1Y93 A;  1AF0 A;  3HBU P;  1BQQ M;  2O36 A;  2K9C A;  4IUW A;  5D3C A;  2PJT A;  1OMJ A;  3V96 B;  1HFC A;  3LMC A;  3UVC A;  2OW0 A;  1A86 A;  4I03 A;  2OXW A;  3MA2 A;  3ZVS A;  1JIZ A;  1BSW A;  2ERQ A;  4GWM A;  4GR8 A;  456C A;  3KEK A;  3EDZ A;  3HYG A;  4XM7 A;  1QIC A;  1UTZ A;  1D5J A;  1GE5 A;  1KUF A;  2N8R A;  3LIR A;  3EWJ A;  1BKC I;  3I7G A;  5D2B A;  3AYU A;  3N2U A;  3LJZ A;  4FU4 A;  4HX3 A;  3I7I A;  4A7B A;  1BM6 A;  3G5C A;  4GR3 A;  3WV2 A;  1PWV A;  3U1R A;  1IAD A;  3KRY A;  1YP1 A;  1G49 A;  5I12 A;  1JAQ A;  1JIW P;  1SMP A;  1FLS A;  4FXQ A;  1ROS A;  3HY7 A;  1BUD A;  3P1V A;  3KEC A;  4PKU A;  4XM8 A;  3DL1 A;  1IAA A;  1XFZ A;  1QJI A;  1ZTQ A;  3K7N A;  5I2Z A;  2RJP A;  1XFU A;  1MMB A;  1SRP A;  4QKZ A;  3Q2H A;  3GBO A;  4PKR A;  1CK7 A;  1C8T A;  1UMS A;  1AYK A;  1YCM A;  2MZI A;  3KWV C;  1YOU A;  3LE9 A;  1BKC A;  3HY9 A;  2OZR A;  1CGL A;  3TT4 A;  1MMP A;  2JSD A;  2OVX A;  4DD8 A;  1GE6 A;  1XFY A;  3SHI A;  4A3W A;  4GWN A;  4JIJ A;  1KUI A;  2V4B A;  1GO7 P;  1Y8J A;  1UEA A;  2JT6 A;  1SAT A;  2FV5 A;  3F19 A;  3AIG A;  4PKS A;  4PKT A;  1GKC A;  4FVL A;  4L19 A;  5D1S A;  1ZXC A;  1BIW A;  1ND1 A;  4H82 A;  1Q3A A;  3G42 A;  5B5O A;  2D1O A;  3K7L A;  5I43 A;  1IAE A;  1XUR A;  1USN A;  3HBV P;  2MLS A;  3DNG A;  4WF6 A;  2WO8 A;  4JP4 A;  1K7I A;  2OXU A;  1XFW A;  4H76 A;  4IN9 A;  1HFS A;  4GF1 A;  1Y0V A;  2QPJ A;  1JKY A;  1QIA A;  3EDH A;  1BKC E;  1O0Q A;  2X3B A;  2W13 A;  4H1Q A;  3DSL A;  2K2G A;  3HDA P;  1EAK A;  3B92 A;  1G05 A;  2JIH A; 
#chains in the Genus database with same CATH topology
 1R1J A;  3F16 A;  4PKW A;  3F18 A;  1FBL A;  1KUG A;  3LUN A;  1RMZ A;  1RM8 A;  2HU6 A;  3KHI A;  1ZS0 A;  3LKA A;  2JT5 A;  4G0D A;  4I35 A;  4CTH A;  1QJJ A;  1OM7 A;  5I0L A;  2ERP A;  4L6T A;  1XAX A;  3DTK A;  4AUO A;  1R1H A;  4DV8 A;  5B5P A;  2RJQ A;  2W15 A;  2OW2 A;  4GUY A;  1C7K A;  4AYK A;  1D8M A;  4PKV A;  1K7G A;  1A85 A;  1SU3 A;  2USN A;  4GQL A;  4WKE A;  3RTS A;  1JAP A;  1SLM A;  1QUA A;  4R3V A;  2Y6C A;  1BZS A;  1XUC A;  2W0D A;  4EFS A;  4Q1L A;  3NX7 A;  2SRT A;  1HTD A;  3BA0 A;  2OW1 A;  2CKI A;  1BUV M;  2W12 A;  4XCT A;  3EDI A;  1CXV A;  2YB9 A;  1KBC A;  1CIZ A;  4WK7 A;  3AYK A;  3Q2G A;  5H8X A;  3USN A;  2OVZ A;  3F17 A;  1PWQ A;  2X3C A;  5CXA A;  1OM8 A;  5D7W A;  2Z2D A;  4WKI A;  3LQB A;  4J4M A;  5I3M A;  2KRJ A;  3B8Z A;  1CGF A;  3EHX A;  4H49 A;  1ZP5 A;  1SLN A;  1UTT A;  2E3X A;  2OXZ A;  3O64 A;  1GE7 A;  3DWB A;  5JMY A;  4GR0 A;  3TVC A;  3LEA A;  3WV1 A;  2L0R A;  1UMT A;  1R54 A;  4HMA A;  4PKQ A;  2FV9 A;  3LK8 A;  2DW0 A;  1BQO A;  1JJ9 A;  3P24 A;  4ZR5 A;  4FXY P;  4XM6 A;  2YIG A;  3ZUK A;  1B3D A;  4H30 A;  1PWW A;  1JK3 A;  1IAC A;  4H3X A;  1FM1 A;  1ATL A;  3DPF A;  1AKL A;  3KMC A;  3F1A A;  1D7X A;  3KEJ A;  5L79 A;  2OY2 A;  1HY7 A;  2MZH A;  3F15 A;  5CUH A;  4JQG A;  2D1N A;  3LIL A;  2WOA A;  1XFV A;  2X3A A;  2I47 A;  1OO9 A;  3LGP A;  2W14 A;  3L0V A;  3N2V A;  1JAO A;  1JAN A;  3LQ0 A;  1H71 P;  3LJG A;  1HV5 A;  1C3I A;  1D8F A;  4AIG A;  2AIG P;  1DTH A;  3KME A;  1IAB A;  1TVI A;  2XS4 A;  1L6J A;  5L7F A;  2DW2 A;  1PWU A;  1XUD A;  4JA1 A;  3O2X A;  1QIB A;  3ELM A;  4ON1 A;  5I4O A;  4L63 A;  966C A;  1MMR A;  3HDB A;  3LUM A;  1AST A;  1I73 A;  4XBH A;  4DF9 A;  3OHL A;  3B2Z A;  4H84 A;  2O3E A;  3TSK A;  1EUB A;  1OM6 A;  2Y6D A;  1GKD A;  2DDF A;  5LAB A;  1JH1 A;  2AYK A;  2WO9 A;  2OI0 A;  5D1U A;  1EB6 A;  3HB2 P;  4H2E A;  1KUK A;  3DPE A;  3ZXH A;  1K7Q A;  1R55 A;  1OS9 A;  3RTT A;  2X7M A;  3TS4 A;  1CQR A;  2OY4 A;  830C A;  1S4B P;  3CKI A;  2MZE A;  2MLR A;  5BPA A;  1XFX A;  3DTE A;  1R1I A;  2DW1 A;  4IJO A;  2E2D A;  1HOV A;  1CGE A;  3EHY A;  2CLT A;  2JNP A;  4AXQ A;  1IAG A;  2J83 A;  4ILW D;  3VI1 A;  1G9K A;  2POJ A;  1ZXV A;  2ERO A;  1G12 A;  1J7N A;  3EDG A;  1G4K A;  5BOT A;  2XS3 A;  1Z3J A;  5BOY A;  1DMT A;  5D1T A;  1YQY A;  2A8H A;  1MNC A;  1GO8 P;  1PWP A;  3OHO A;  2J0T A;  4JPA A;  2OW9 A;  4DPE A;  1GXD A;  1MMQ A;  1CAQ A;  3WV3 A;  3LJT A;  1B8Y A;  1WNI A;  3L0T A;  1OS2 A;  1KAP P;  1I1I P;  3DTI A;  4WZV A;  3VTG A;  1O0T A;  2DDY A;  1ZVX A;  4G9L A;  2TCL A;  3E8R A;  3LIK A;  1I76 A;  5CZM A;  1KUH A;  1Y93 A;  1AF0 A;  3HBU P;  1BQQ M;  2O36 A;  2K9C A;  4IUW A;  5D3C A;  2PJT A;  1OMJ A;  1XM5 A;  3V96 B;  1HFC A;  3LMC A;  3UVC A;  2OW0 A;  1A86 A;  4I03 A;  2OXW A;  3MA2 A;  3ZVS A;  1JIZ A;  1BSW A;  2ERQ A;  4GWM A;  4GR8 A;  456C A;  3KEK A;  3EDZ A;  3HYG A;  4XM7 A;  1QIC A;  1UTZ A;  1D5J A;  1GE5 A;  1KUF A;  2N8R A;  3LIR A;  3EWJ A;  1BKC I;  3I7G A;  5D2B A;  3AYU A;  3N2U A;  3LJZ A;  4FU4 A;  4HX3 A;  3I7I A;  4A7B A;  1BM6 A;  3G5C A;  4GR3 A;  3WV2 A;  1PWV A;  3U1R A;  1IAD A;  3KRY A;  1YP1 A;  1G49 A;  5I12 A;  1JAQ A;  1JIW P;  1SMP A;  1FLS A;  4FXQ A;  1ROS A;  3HY7 A;  1BUD A;  3P1V A;  3KEC A;  4PKU A;  4XM8 A;  3DL1 A;  1IAA A;  1XFZ A;  1QJI A;  1ZTQ A;  2YUF A;  3K7N A;  5I2Z A;  2RJP A;  1XFU A;  1MMB A;  1SRP A;  4QKZ A;  1OZ9 A;  3Q2H A;  3GBO A;  4PKR A;  1CK7 A;  1C8T A;  1UMS A;  1AYK A;  1YCM A;  2MZI A;  3KWV C;  1YOU A;  3LE9 A;  1BKC A;  3HY9 A;  2OZR A;  1CGL A;  3TT4 A;  1MMP A;  2JSD A;  2OVX A;  4DD8 A;  1GE6 A;  1XFY A;  3SHI A;  4A3W A;  4GWN A;  4JIJ A;  1KUI A;  2V4B A;  1GO7 P;  1Y8J A;  1UEA A;  2JT6 A;  1SAT A;  2FV5 A;  3F19 A;  3AIG A;  4PKS A;  4PKT A;  1GKC A;  4FVL A;  4L19 A;  5D1S A;  1ZXC A;  1BIW A;  1ND1 A;  4H82 A;  1Q3A A;  3G42 A;  4L7A A;  5B5O A;  2D1O A;  3K7L A;  5I43 A;  1IAE A;  1XUR A;  1USN A;  3HBV P;  2MLS A;  3DNG A;  4WF6 A;  2WO8 A;  4JP4 A;  1K7I A;  2OXU A;  1XFW A;  4H76 A;  4IN9 A;  1HFS A;  4GF1 A;  1Y0V A;  2QPJ A;  1JKY A;  1QIA A;  3EDH A;  1BKC E;  1O0Q A;  2X3B A;  2W13 A;  4H1Q A;  3DSL A;  2K2G A;  3HDA P;  1EAK A;  3B92 A;  1G05 A;  2JIH A; 
#chains in the Genus database with same CATH homology
 1R1J A;  3F16 A;  4PKW A;  3F18 A;  1FBL A;  1KUG A;  3LUN A;  1RMZ A;  1RM8 A;  2HU6 A;  3KHI A;  1ZS0 A;  3LKA A;  2JT5 A;  4G0D A;  4I35 A;  4CTH A;  1QJJ A;  1OM7 A;  5I0L A;  2ERP A;  4L6T A;  3DTK A;  4AUO A;  1R1H A;  4DV8 A;  5B5P A;  2RJQ A;  2W15 A;  2OW2 A;  4GUY A;  1C7K A;  4AYK A;  1D8M A;  4PKV A;  1K7G A;  1A85 A;  1SU3 A;  2USN A;  4GQL A;  4WKE A;  3RTS A;  1JAP A;  1SLM A;  1QUA A;  4R3V A;  2Y6C A;  1BZS A;  1XUC A;  2W0D A;  4EFS A;  4Q1L A;  3NX7 A;  2SRT A;  1HTD A;  3BA0 A;  2OW1 A;  2CKI A;  1BUV M;  2W12 A;  4XCT A;  3EDI A;  1CXV A;  2YB9 A;  1KBC A;  1CIZ A;  4WK7 A;  3AYK A;  3Q2G A;  5H8X A;  3USN A;  2OVZ A;  3F17 A;  1PWQ A;  2X3C A;  5CXA A;  1OM8 A;  5D7W A;  2Z2D A;  4WKI A;  3LQB A;  4J4M A;  5I3M A;  2KRJ A;  3B8Z A;  1CGF A;  3EHX A;  4H49 A;  1ZP5 A;  1SLN A;  1UTT A;  2E3X A;  2OXZ A;  3O64 A;  1GE7 A;  3DWB A;  5JMY A;  4GR0 A;  3TVC A;  3LEA A;  3WV1 A;  2L0R A;  1UMT A;  1R54 A;  4HMA A;  4PKQ A;  2FV9 A;  3LK8 A;  2DW0 A;  1BQO A;  1JJ9 A;  3P24 A;  4ZR5 A;  4FXY P;  4XM6 A;  2YIG A;  3ZUK A;  1B3D A;  4H30 A;  1PWW A;  1JK3 A;  1IAC A;  4H3X A;  1FM1 A;  1ATL A;  3DPF A;  1AKL A;  3KMC A;  3F1A A;  1D7X A;  3KEJ A;  5L79 A;  2OY2 A;  1HY7 A;  2MZH A;  3F15 A;  5CUH A;  4JQG A;  2D1N A;  3LIL A;  2WOA A;  1XFV A;  2X3A A;  2I47 A;  1OO9 A;  3LGP A;  2W14 A;  3L0V A;  3N2V A;  1JAO A;  1JAN A;  3LQ0 A;  1H71 P;  3LJG A;  1HV5 A;  1C3I A;  1D8F A;  4AIG A;  2AIG P;  1DTH A;  3KME A;  1IAB A;  2XS4 A;  1L6J A;  5L7F A;  2DW2 A;  1PWU A;  1XUD A;  4JA1 A;  3O2X A;  1QIB A;  3ELM A;  4ON1 A;  5I4O A;  4L63 A;  966C A;  1MMR A;  3HDB A;  3LUM A;  1AST A;  1I73 A;  4XBH A;  4DF9 A;  3OHL A;  3B2Z A;  4H84 A;  2O3E A;  3TSK A;  1EUB A;  1OM6 A;  2Y6D A;  1GKD A;  2DDF A;  5LAB A;  1JH1 A;  2AYK A;  2WO9 A;  2OI0 A;  5D1U A;  1EB6 A;  3HB2 P;  4H2E A;  1KUK A;  3DPE A;  3ZXH A;  1K7Q A;  1R55 A;  1OS9 A;  3RTT A;  2X7M A;  3TS4 A;  1CQR A;  2OY4 A;  830C A;  1S4B P;  3CKI A;  2MZE A;  2MLR A;  5BPA A;  1XFX A;  3DTE A;  1R1I A;  2DW1 A;  4IJO A;  2E2D A;  1HOV A;  1CGE A;  3EHY A;  2CLT A;  2JNP A;  4AXQ A;  1IAG A;  2J83 A;  4ILW D;  3VI1 A;  1G9K A;  2POJ A;  1ZXV A;  2ERO A;  1G12 A;  1J7N A;  3EDG A;  1G4K A;  5BOT A;  2XS3 A;  1Z3J A;  5BOY A;  1DMT A;  5D1T A;  1YQY A;  2A8H A;  1MNC A;  1GO8 P;  1PWP A;  3OHO A;  2J0T A;  4JPA A;  2OW9 A;  4DPE A;  1GXD A;  1MMQ A;  1CAQ A;  3WV3 A;  3LJT A;  1B8Y A;  1WNI A;  3L0T A;  1OS2 A;  1KAP P;  1I1I P;  3DTI A;  4WZV A;  3VTG A;  1O0T A;  2DDY A;  1ZVX A;  4G9L A;  2TCL A;  3E8R A;  3LIK A;  1I76 A;  5CZM A;  1KUH A;  1Y93 A;  1AF0 A;  3HBU P;  1BQQ M;  2O36 A;  2K9C A;  4IUW A;  5D3C A;  2PJT A;  1OMJ A;  3V96 B;  1HFC A;  3LMC A;  3UVC A;  2OW0 A;  1A86 A;  4I03 A;  2OXW A;  3MA2 A;  3ZVS A;  1JIZ A;  1BSW A;  2ERQ A;  4GWM A;  4GR8 A;  456C A;  3KEK A;  3EDZ A;  3HYG A;  4XM7 A;  1QIC A;  1UTZ A;  1D5J A;  1GE5 A;  1KUF A;  2N8R A;  3LIR A;  3EWJ A;  1BKC I;  3I7G A;  5D2B A;  3AYU A;  3N2U A;  3LJZ A;  4FU4 A;  4HX3 A;  3I7I A;  4A7B A;  1BM6 A;  3G5C A;  4GR3 A;  3WV2 A;  1PWV A;  3U1R A;  1IAD A;  3KRY A;  1YP1 A;  1G49 A;  5I12 A;  1JAQ A;  1JIW P;  1SMP A;  1FLS A;  4FXQ A;  1ROS A;  3HY7 A;  1BUD A;  3P1V A;  3KEC A;  4PKU A;  4XM8 A;  3DL1 A;  1IAA A;  1XFZ A;  1QJI A;  1ZTQ A;  2YUF A;  3K7N A;  5I2Z A;  2RJP A;  1XFU A;  1MMB A;  1SRP A;  4QKZ A;  3Q2H A;  3GBO A;  4PKR A;  1CK7 A;  1C8T A;  1UMS A;  1AYK A;  1YCM A;  2MZI A;  3KWV C;  1YOU A;  3LE9 A;  1BKC A;  3HY9 A;  2OZR A;  1CGL A;  3TT4 A;  1MMP A;  2JSD A;  2OVX A;  4DD8 A;  1GE6 A;  1XFY A;  3SHI A;  4A3W A;  4GWN A;  4JIJ A;  1KUI A;  2V4B A;  1GO7 P;  1Y8J A;  1UEA A;  2JT6 A;  1SAT A;  2FV5 A;  3F19 A;  3AIG A;  4PKS A;  4PKT A;  1GKC A;  4FVL A;  4L19 A;  5D1S A;  1ZXC A;  1BIW A;  1ND1 A;  4H82 A;  1Q3A A;  3G42 A;  4L7A A;  5B5O A;  2D1O A;  3K7L A;  5I43 A;  1IAE A;  1XUR A;  1USN A;  3HBV P;  2MLS A;  3DNG A;  4WF6 A;  2WO8 A;  4JP4 A;  1K7I A;  2OXU A;  1XFW A;  4H76 A;  4IN9 A;  1HFS A;  4GF1 A;  1Y0V A;  2QPJ A;  1JKY A;  1QIA A;  3EDH A;  1BKC E;  1O0Q A;  2X3B A;  2W13 A;  4H1Q A;  3DSL A;  2K2G A;  3HDA P;  1EAK A;  3B92 A;  1G05 A;  2JIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...