1QICA

Crystal structure of stromelysin catalytic domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
IPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (STROMELYSIN-1)
publication title X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity
pubmed rcsb
source organism Homo sapiens
total genus 41
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qicA00
2JIHA 2MLRA 4FXYP 3B8ZA 1BIWA 2OI0A 4XBHA 1JKYA 3DSLA 1GE7A 5D7WA 4H76A 5BPAA 3KMEA 2OW9A 3P1VA 2XS4A 1G4KA 4L63A 2PJTA 2D1OA 1SLNA 3V96B 4H49A 1SU3A 1SMPA 2I47A 2OZRA 2D1NA 1XFWA 1ZVXA 1B8YA 1XFZA 3RTTA 2V4BA 4WKEA 1QICA 1KUGA 3I7GA 3USNA 2CLTA 1EB6A 2E2DA 3EDHA 3I7IA 3LIRA 1BKCI 3VI1A 4GWNA 1JIWP 5JMYA 1JANA 2A8HA 1BSWA 2YB9A 5I12A 1G05A 4PKRA 1HFSA 1CK7A 1XURA 4H2EA 1FLSA 1EUBA 1ZS0A 1GO7P 5H8XA 1HV5A 3HDAP 4GR8A 1D8MA 3B2ZA 1UMTA 2K9CA 1ZXCA 5CXAA 1KBCA 4IN9A 4DV8A 2Z2DA 3ELMA 1ZP5A 4GR0A 3F19A 3G5CA 3DL1A 2OW1A 2YIGA 2W0DA 3U1RA 3LEAA 4XCTA 1C3IA 2DW0A 3VTGA 1WNIA 1OM8A 4IUWA 2OXZA 4IJOA 4XM8A 3OHLA 5D3CA 1R55A 4ON1A 5BOTA 5I3MA 3DWBA 3K7LA 3OHOA 1B3DA 1XFYA 1CAQA 1BKCE 1QIBA 2JSDA 4JPAA 1HOVA 1MMRA 4WF6A 4XM6A 1O0QA 1R54A 5I2ZA 1J7NA 1H71P 3KWVC 3LKAA 5D1SA 3P24A 1K7QA 4ILWD 1BQOA 3LK8A 4CTHA 3AYUA 1S4BP 1GKCA 1AYKA 2N8RA 3LIKA 1ATLA 1CGEA 4R3VA 3EHYA 4GUYA 3LMCA 4GQLA 4AXQA 1EAKA 2OXWA 1JK3A 1R1IA 830CA 4XM7A 2USNA 1PWPA 1MMPA 2DDFA 2OW2A 1XFUA 1XUCA 2J83A 2W13A 3KEJA 1JAOA 4FXQA 4L6TA 3GBOA 2RJQA 3KMCA 1FM1A 1ND1A 1Y0VA 3G42A 3HY9A 3KHIA 1GE5A 4G0DA 4AIGA 3LGPA 1UEAA 1JJ9A 1DMTA 1QIAA 1G49A 1UMSA 1UTZA 3HBVP 3KRYA 1K7IA 1O0TA 1K7GA 2OVXA 2CKIA 4AUOA 4WZVA 3SHIA 3LUMA 3KECA 2OW0A 5I43A 1OO9A 1L6JA 3AYKA 3Q2GA 4EFSA 4H82A 3F18A 3LQ0A 1QUAA 1Q3AA 3ZUKA 5L7FA 3HBUP 1ASTA 2L0RA 1A85A 2W15A 3HDBA 1HFCA 5D2BA 2HU6A 4Q1LA 1SRPA 1UTTA 2WO9A 2MZHA 2X3BA 3K7NA 4DD8A 2QPJA 1C7KA 3NX7A 4QKZA 1R1HA 2W12A 2EROA 4GWMA 1D7XA 3AIGA 3RTSA 2Y6CA 5D1UA 1BUVM 1XFVA 2ERQA 1SATA 1JAQA 1Y8JA 3EDGA 3TS4A 4PKSA 4A3WA 1KUIA 3WV2A 1CGLA 3EDZA 2XS3A 1OS2A 1JAPA 2O3EA 5CZMA 3HY7A 2O36A 3WV1A 4FVLA 1GE6A 5D1TA 2KRJA 1IAEA 1KUFA 3LJZA 1BUDA 1PWUA 2DW2A 1KUHA 2X3AA 1G9KA 2POJA 2ERPA 1Z3JA 1SLMA 2OVZA 1D5JA 1XFXA 2JNPA 4GR3A 1CGFA 1USNA 2WO8A 2OY2A 3Q2HA 1GXDA 2DDYA 1OM7A 1QJIA 5CUHA 5B5OA 1I1IP 1RMZA 2X7MA 4H84A 4JP4A 1IAGA 3TVCA 3HB2P 3F17A 3F1AA 3O2XA 1PWVA 1QJJA 1PWWA 4PKUA 1BZSA 1KUKA 3EWJA 1OS9A 1OM6A 1ROSA 3BA0A 4I35A 2TCLA 1JH1A 3LJGA 4JA1A 4H3XA 2J0TA 1AF0A 1GO8P 1IAAA 3N2UA 3ZXHA 1AKLA 1CQRA 3F15A 1OMJA 2OY4A 2MZIA 2JT5A 3F16A 1PWQA 1IABA 4L19A 1KAPP 3HYGA 3ZVSA 3LJTA 1I76A 2FV5A 4PKWA 4DF9A 2DW1A 1GKDA 2JT6A 4ZR5A 3O64A 2Y6DA 2SRTA 4GF1A 5I4OA 4AYKA 1CIZA 3DNGA 3LILA 1DTHA 1IACA 1CXVA 1YQYA 2W14A 4I03A 4FU4A 1C8TA 4JQGA 1XUDA 1ZXVA 2MLSA 4J4MA 3N2VA 1Y93A 1IADA 2AIGP 1MMBA 3KEKA 4JIJA 3B92A 4HMAA 3L0VA 1RM8A 1FBLA 966CA 5LABA 2OXUA 4PKQA 1YCMA 2MZEA 3MA2A 1BKCA 1YP1A 3TSKA 2WOAA 4PKVA 4H1QA 3TT4A 5BOYA 456CA 4H30A 1BM6A 2RJPA 1ZTQA 5B5PA 1BQQM 2K2GA 2FV9A 1A86A 2E3XA 3DPEA 1MMQA 1D8FA 1HY7A 5L79A 3E8RA 4WKIA 4G9LA 1MNCA 3LE9A 3LUNA 3EHXA 3WV3A 4DPEA 1JIZA 1YOUA 4PKTA 1HTDA 2X3CA 4A7BA 5I0LA 3CKIA 1G12A 1I73A 3EDIA 4WK7A 3UVCA 3DPFA 3LQBA 4HX3A 3L0TA 1R1JA 2AYKA
chains in the Genus database with same CATH superfamily
2JIHA 2MLRA 4FXYP 3B8ZA 1BIWA 2OI0A 4XBHA 1JKYA 3DSLA 1GE7A 5D7WA 4H76A 5BPAA 3KMEA 2OW9A 3P1VA 2XS4A 1G4KA 4L63A 2PJTA 2D1OA 1SLNA 3V96B 4H49A 1SU3A 1SMPA 2I47A 2OZRA 2D1NA 1XFWA 1ZVXA 1B8YA 1OZ9A 1XFZA 3RTTA 2V4BA 4WKEA 1QICA 1KUGA 3I7GA 3USNA 2CLTA 1EB6A 2E2DA 3EDHA 3I7IA 3LIRA 1BKCI 3VI1A 4GWNA 1JIWP 5JMYA 1JANA 2A8HA 1BSWA 2YB9A 5I12A 1G05A 4PKRA 1HFSA 1CK7A 1XURA 4H2EA 1FLSA 1EUBA 1ZS0A 1GO7P 5H8XA 1HV5A 3HDAP 4GR8A 1D8MA 3B2ZA 1UMTA 2K9CA 1ZXCA 5CXAA 1KBCA 4IN9A 4DV8A 2Z2DA 3ELMA 1ZP5A 4GR0A 3F19A 3G5CA 3DL1A 2OW1A 2YIGA 2W0DA 3U1RA 3LEAA 4XCTA 1C3IA 2DW0A 3VTGA 1WNIA 1OM8A 4IUWA 2OXZA 4IJOA 2YUFA 4XM8A 3OHLA 5D3CA 1R55A 1XAXA 4ON1A 5BOTA 5I3MA 3DWBA 3K7LA 3OHOA 1B3DA 1XFYA 1CAQA 1BKCE 1QIBA 2JSDA 4JPAA 1HOVA 1MMRA 4WF6A 4XM6A 1O0QA 1R54A 5I2ZA 1J7NA 1TVIA 1H71P 3KWVC 3LKAA 5D1SA 3P24A 1K7QA 4ILWD 1BQOA 3LK8A 4CTHA 3AYUA 1S4BP 1GKCA 1AYKA 2N8RA 3LIKA 1ATLA 1CGEA 4R3VA 3EHYA 4GUYA 3LMCA 4GQLA 4AXQA 1EAKA 2OXWA 1JK3A 1R1IA 830CA 4XM7A 2USNA 1PWPA 1MMPA 2DDFA 2OW2A 1XFUA 1XUCA 2J83A 2W13A 3KEJA 1JAOA 4FXQA 4L6TA 3GBOA 2RJQA 3KMCA 1FM1A 1ND1A 1Y0VA 3G42A 3HY9A 3KHIA 1GE5A 4G0DA 4AIGA 3LGPA 1UEAA 1JJ9A 1DMTA 1QIAA 1G49A 1UMSA 1UTZA 3HBVP 3KRYA 1K7IA 1O0TA 1K7GA 2OVXA 2CKIA 4AUOA 4WZVA 3SHIA 3LUMA 3KECA 2OW0A 5I43A 1OO9A 1L6JA 3AYKA 3Q2GA 4EFSA 4H82A 3F18A 3LQ0A 1QUAA 1Q3AA 3ZUKA 5L7FA 3HBUP 1ASTA 2L0RA 1A85A 2W15A 3HDBA 1HFCA 5D2BA 2HU6A 4Q1LA 1SRPA 1UTTA 2WO9A 2MZHA 2X3BA 3K7NA 4DD8A 2QPJA 1C7KA 3NX7A 4QKZA 4L7AA 1R1HA 2W12A 2EROA 4GWMA 1D7XA 3AIGA 3RTSA 2Y6CA 5D1UA 1BUVM 1XFVA 2ERQA 1SATA 1JAQA 1Y8JA 3EDGA 3TS4A 4PKSA 4A3WA 1KUIA 3WV2A 1CGLA 3EDZA 2XS3A 1OS2A 1JAPA 2O3EA 5CZMA 3HY7A 2O36A 3WV1A 4FVLA 1GE6A 5D1TA 2KRJA 3DTEA 1IAEA 1KUFA 3LJZA 1BUDA 1PWUA 2DW2A 1KUHA 2X3AA 1G9KA 2POJA 2ERPA 1Z3JA 1SLMA 2OVZA 1D5JA 1XFXA 2JNPA 4GR3A 1CGFA 1USNA 2WO8A 2OY2A 3Q2HA 1GXDA 2DDYA 1OM7A 1QJIA 5CUHA 5B5OA 1I1IP 1RMZA 2X7MA 4H84A 4JP4A 1IAGA 3TVCA 3HB2P 3F17A 3F1AA 3O2XA 1PWVA 1QJJA 1PWWA 4PKUA 1BZSA 1KUKA 3EWJA 1OS9A 1OM6A 1ROSA 3BA0A 4I35A 2TCLA 1JH1A 3LJGA 4JA1A 4H3XA 2J0TA 3DTIA 1AF0A 1GO8P 1IAAA 3N2UA 3ZXHA 1AKLA 1CQRA 3F15A 1OMJA 2OY4A 2MZIA 2JT5A 3F16A 1PWQA 1IABA 4L19A 1KAPP 3HYGA 3ZVSA 3LJTA 1I76A 2FV5A 4PKWA 4DF9A 2DW1A 1GKDA 2JT6A 4ZR5A 3O64A 2Y6DA 2SRTA 4GF1A 5I4OA 4AYKA 1CIZA 3DNGA 3LILA 1DTHA 1IACA 1CXVA 1YQYA 2W14A 4I03A 4FU4A 1C8TA 4JQGA 1XUDA 1ZXVA 2MLSA 4J4MA 3N2VA 1Y93A 1IADA 2AIGP 3DTKA 1MMBA 3KEKA 4JIJA 3B92A 4HMAA 3L0VA 1RM8A 1FBLA 966CA 5LABA 2OXUA 4PKQA 1YCMA 2MZEA 3MA2A 1BKCA 1YP1A 3TSKA 2WOAA 4PKVA 4H1QA 3TT4A 5BOYA 456CA 4H30A 1BM6A 2RJPA 1XM5A 1ZTQA 5B5PA 1BQQM 2K2GA 2FV9A 1A86A 2E3XA 3DPEA 1MMQA 1D8FA 1HY7A 5L79A 3E8RA 4WKIA 4G9LA 1MNCA 3LE9A 3LUNA 3EHXA 3WV3A 4DPEA 1JIZA 1YOUA 4PKTA 1HTDA 2X3CA 4A7BA 5I0LA 3CKIA 1G12A 1I73A 3EDIA 4WK7A 3UVCA 3DPFA 3LQBA 4HX3A 3L0TA 1R1JA 2AYKA
chains in the Genus database with same CATH topology
2JIHA 2MLRA 4FXYP 3B8ZA 1BIWA 2OI0A 4XBHA 1JKYA 3DSLA 1GE7A 5D7WA 4H76A 5BPAA 3KMEA 2OW9A 3P1VA 2XS4A 1G4KA 4L63A 2PJTA 2D1OA 1SLNA 3V96B 4H49A 1SU3A 1SMPA 2I47A 2OZRA 2D1NA 1XFWA 1ZVXA 1B8YA 1XFZA 3RTTA 2V4BA 4WKEA 1QICA 1KUGA 3I7GA 3USNA 2CLTA 1EB6A 2E2DA 3EDHA 3I7IA 3LIRA 1BKCI 3VI1A 4GWNA 1JIWP 5JMYA 1JANA 2A8HA 1BSWA 2YB9A 5I12A 1G05A 4PKRA 1HFSA 1CK7A 1XURA 4H2EA 1FLSA 1EUBA 1ZS0A 1GO7P 5H8XA 1HV5A 3HDAP 4GR8A 1D8MA 3B2ZA 1UMTA 2K9CA 1ZXCA 5CXAA 1KBCA 4IN9A 4DV8A 2Z2DA 3ELMA 1ZP5A 4GR0A 3F19A 3G5CA 3DL1A 2OW1A 2YIGA 2W0DA 3U1RA 3LEAA 4XCTA 1C3IA 2DW0A 3VTGA 1WNIA 1OM8A 4IUWA 2OXZA 4IJOA 2YUFA 4XM8A 3OHLA 5D3CA 1R55A 4ON1A 5BOTA 5I3MA 3DWBA 3K7LA 3OHOA 1B3DA 1XFYA 1CAQA 1BKCE 1QIBA 2JSDA 4JPAA 1HOVA 1MMRA 4WF6A 4XM6A 1O0QA 1R54A 5I2ZA 1J7NA 1H71P 3KWVC 3LKAA 5D1SA 3P24A 1K7QA 4ILWD 1BQOA 3LK8A 4CTHA 3AYUA 1S4BP 1GKCA 1AYKA 2N8RA 3LIKA 1ATLA 1CGEA 4R3VA 3EHYA 4GUYA 3LMCA 4GQLA 4AXQA 1EAKA 2OXWA 1JK3A 1R1IA 830CA 4XM7A 2USNA 1PWPA 1MMPA 2DDFA 2OW2A 1XFUA 1XUCA 2J83A 2W13A 3KEJA 1JAOA 4FXQA 4L6TA 3GBOA 2RJQA 3KMCA 1FM1A 1ND1A 1Y0VA 3G42A 3HY9A 3KHIA 1GE5A 4G0DA 4AIGA 3LGPA 1UEAA 1JJ9A 1DMTA 1QIAA 1G49A 1UMSA 1UTZA 3HBVP 3KRYA 1K7IA 1O0TA 1K7GA 2OVXA 2CKIA 4AUOA 4WZVA 3SHIA 3LUMA 3KECA 2OW0A 5I43A 1OO9A 1L6JA 3AYKA 3Q2GA 4EFSA 4H82A 3F18A 3LQ0A 1QUAA 1Q3AA 3ZUKA 5L7FA 3HBUP 1ASTA 2L0RA 1A85A 2W15A 3HDBA 1HFCA 5D2BA 2HU6A 4Q1LA 1SRPA 1UTTA 2WO9A 2MZHA 2X3BA 3K7NA 4DD8A 2QPJA 1C7KA 3NX7A 4QKZA 4L7AA 1R1HA 2W12A 2EROA 4GWMA 1D7XA 3AIGA 3RTSA 2Y6CA 5D1UA 1BUVM 1XFVA 2ERQA 1SATA 1JAQA 1Y8JA 3EDGA 3TS4A 4PKSA 4A3WA 1KUIA 3WV2A 1CGLA 3EDZA 2XS3A 1OS2A 1JAPA 2O3EA 5CZMA 3HY7A 2O36A 3WV1A 4FVLA 1GE6A 5D1TA 2KRJA 3DTEA 1IAEA 1KUFA 3LJZA 1BUDA 1PWUA 2DW2A 1KUHA 2X3AA 1G9KA 2POJA 2ERPA 1Z3JA 1SLMA 2OVZA 1D5JA 1XFXA 2JNPA 4GR3A 1CGFA 1USNA 2WO8A 2OY2A 3Q2HA 1GXDA 2DDYA 1OM7A 1QJIA 5CUHA 5B5OA 1I1IP 1RMZA 2X7MA 4H84A 4JP4A 1IAGA 3TVCA 3HB2P 3F17A 3F1AA 3O2XA 1PWVA 1QJJA 1PWWA 4PKUA 1BZSA 1KUKA 3EWJA 1OS9A 1OM6A 1ROSA 3BA0A 4I35A 2TCLA 1JH1A 3LJGA 4JA1A 4H3XA 2J0TA 3DTIA 1AF0A 1GO8P 1IAAA 3N2UA 3ZXHA 1AKLA 1CQRA 3F15A 1OMJA 2OY4A 2MZIA 2JT5A 3F16A 1PWQA 1IABA 4L19A 1KAPP 3HYGA 3ZVSA 3LJTA 1I76A 2FV5A 4PKWA 4DF9A 2DW1A 1GKDA 2JT6A 4ZR5A 3O64A 2Y6DA 2SRTA 4GF1A 5I4OA 4AYKA 1CIZA 3DNGA 3LILA 1DTHA 1IACA 1CXVA 1YQYA 2W14A 4I03A 4FU4A 1C8TA 4JQGA 1XUDA 1ZXVA 2MLSA 4J4MA 3N2VA 1Y93A 1IADA 2AIGP 3DTKA 1MMBA 3KEKA 4JIJA 3B92A 4HMAA 3L0VA 1RM8A 1FBLA 966CA 5LABA 2OXUA 4PKQA 1YCMA 2MZEA 3MA2A 1BKCA 1YP1A 3TSKA 2WOAA 4PKVA 4H1QA 3TT4A 5BOYA 456CA 4H30A 1BM6A 2RJPA 1ZTQA 5B5PA 1BQQM 2K2GA 2FV9A 1A86A 2E3XA 3DPEA 1MMQA 1D8FA 1HY7A 5L79A 3E8RA 4WKIA 4G9LA 1MNCA 3LE9A 3LUNA 3EHXA 3WV3A 4DPEA 1JIZA 1YOUA 4PKTA 1HTDA 2X3CA 4A7BA 5I0LA 3CKIA 1G12A 1I73A 3EDIA 4WK7A 3UVCA 3DPFA 3LQBA 4HX3A 3L0TA 1R1JA 2AYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIH A;  2MLR A;  4FXY P;  3B8Z A;  1BIW A;  2OI0 A;  4XBH A;  1JKY A;  3DSL A;  1GE7 A;  5D7W A;  4H76 A;  5BPA A;  3KME A;  2OW9 A;  3P1V A;  2XS4 A;  1G4K A;  4L63 A;  2PJT A;  2D1O A;  1SLN A;  3V96 B;  4H49 A;  1SU3 A;  1SMP A;  2I47 A;  2OZR A;  2D1N A;  1XFW A;  1ZVX A;  1B8Y A;  1XFZ A;  3RTT A;  2V4B A;  4WKE A;  1QIC A;  1KUG A;  3I7G A;  3USN A;  2CLT A;  1EB6 A;  2E2D A;  3EDH A;  3I7I A;  3LIR A;  1BKC I;  3VI1 A;  4GWN A;  1JIW P;  5JMY A;  1JAN A;  2A8H A;  1BSW A;  2YB9 A;  5I12 A;  1G05 A;  4PKR A;  1HFS A;  1CK7 A;  1XUR A;  4H2E A;  1FLS A;  1EUB A;  1ZS0 A;  1GO7 P;  5H8X A;  1HV5 A;  3HDA P;  4GR8 A;  1D8M A;  3B2Z A;  1UMT A;  2K9C A;  1ZXC A;  5CXA A;  1KBC A;  4IN9 A;  4DV8 A;  2Z2D A;  3ELM A;  1ZP5 A;  4GR0 A;  3F19 A;  3G5C A;  3DL1 A;  2OW1 A;  2YIG A;  2W0D A;  3U1R A;  3LEA A;  4XCT A;  1C3I A;  2DW0 A;  3VTG A;  1WNI A;  1OM8 A;  4IUW A;  2OXZ A;  4IJO A;  4XM8 A;  3OHL A;  5D3C A;  1R55 A;  4ON1 A;  5BOT A;  5I3M A;  3DWB A;  3K7L A;  3OHO A;  1B3D A;  1XFY A;  1CAQ A;  1BKC E;  1QIB A;  2JSD A;  4JPA A;  1HOV A;  1MMR A;  4WF6 A;  4XM6 A;  1O0Q A;  1R54 A;  5I2Z A;  1J7N A;  1H71 P;  3KWV C;  3LKA A;  5D1S A;  3P24 A;  1K7Q A;  4ILW D;  1BQO A;  3LK8 A;  4CTH A;  3AYU A;  1S4B P;  1GKC A;  1AYK A;  2N8R A;  3LIK A;  1ATL A;  1CGE A;  4R3V A;  3EHY A;  4GUY A;  3LMC A;  4GQL A;  4AXQ A;  1EAK A;  2OXW A;  1JK3 A;  1R1I A;  830C A;  4XM7 A;  2USN A;  1PWP A;  1MMP A;  2DDF A;  2OW2 A;  1XFU A;  1XUC A;  2J83 A;  2W13 A;  3KEJ A;  1JAO A;  4FXQ A;  4L6T A;  3GBO A;  2RJQ A;  3KMC A;  1FM1 A;  1ND1 A;  1Y0V A;  3G42 A;  3HY9 A;  3KHI A;  1GE5 A;  4G0D A;  4AIG A;  3LGP A;  1UEA A;  1JJ9 A;  1DMT A;  1QIA A;  1G49 A;  1UMS A;  1UTZ A;  3HBV P;  3KRY A;  1K7I A;  1O0T A;  1K7G A;  2OVX A;  2CKI A;  4AUO A;  4WZV A;  3SHI A;  3LUM A;  3KEC A;  2OW0 A;  5I43 A;  1OO9 A;  1L6J A;  3AYK A;  3Q2G A;  4EFS A;  4H82 A;  3F18 A;  3LQ0 A;  1QUA A;  1Q3A A;  3ZUK A;  5L7F A;  3HBU P;  1AST A;  2L0R A;  1A85 A;  2W15 A;  3HDB A;  1HFC A;  5D2B A;  2HU6 A;  4Q1L A;  1SRP A;  1UTT A;  2WO9 A;  2MZH A;  2X3B A;  3K7N A;  4DD8 A;  2QPJ A;  1C7K A;  3NX7 A;  4QKZ A;  1R1H A;  2W12 A;  2ERO A;  4GWM A;  1D7X A;  3AIG A;  3RTS A;  2Y6C A;  5D1U A;  1BUV M;  1XFV A;  2ERQ A;  1SAT A;  1JAQ A;  1Y8J A;  3EDG A;  3TS4 A;  4PKS A;  4A3W A;  1KUI A;  3WV2 A;  1CGL A;  3EDZ A;  2XS3 A;  1OS2 A;  1JAP A;  2O3E A;  5CZM A;  3HY7 A;  2O36 A;  3WV1 A;  4FVL A;  1GE6 A;  5D1T A;  2KRJ A;  1IAE A;  1KUF A;  3LJZ A;  1BUD A;  1PWU A;  2DW2 A;  1KUH A;  2X3A A;  1G9K A;  2POJ A;  2ERP A;  1Z3J A;  1SLM A;  2OVZ A;  1D5J A;  1XFX A;  2JNP A;  4GR3 A;  1CGF A;  1USN A;  2WO8 A;  2OY2 A;  3Q2H A;  1GXD A;  2DDY A;  1OM7 A;  1QJI A;  5CUH A;  5B5O A;  1I1I P;  1RMZ A;  2X7M A;  4H84 A;  4JP4 A;  1IAG A;  3TVC A;  3HB2 P;  3F17 A;  3F1A A;  3O2X A;  1PWV A;  1QJJ A;  1PWW A;  4PKU A;  1BZS A;  1KUK A;  3EWJ A;  1OS9 A;  1OM6 A;  1ROS A;  3BA0 A;  4I35 A;  2TCL A;  1JH1 A;  3LJG A;  4JA1 A;  4H3X A;  2J0T A;  1AF0 A;  1GO8 P;  1IAA A;  3N2U A;  3ZXH A;  1AKL A;  1CQR A;  3F15 A;  1OMJ A;  2OY4 A;  2MZI A;  2JT5 A;  3F16 A;  1PWQ A;  1IAB A;  4L19 A;  1KAP P;  3HYG A;  3ZVS A;  3LJT A;  1I76 A;  2FV5 A;  4PKW A;  4DF9 A;  2DW1 A;  1GKD A;  2JT6 A;  4ZR5 A;  3O64 A;  2Y6D A;  2SRT A;  4GF1 A;  5I4O A;  4AYK A;  1CIZ A;  3DNG A;  3LIL A;  1DTH A;  1IAC A;  1CXV A;  1YQY A;  2W14 A;  4I03 A;  4FU4 A;  1C8T A;  4JQG A;  1XUD A;  1ZXV A;  2MLS A;  4J4M A;  3N2V A;  1Y93 A;  1IAD A;  2AIG P;  1MMB A;  3KEK A;  4JIJ A;  3B92 A;  4HMA A;  3L0V A;  1RM8 A;  1FBL A;  966C A;  5LAB A;  2OXU A;  4PKQ A;  1YCM A;  2MZE A;  3MA2 A;  1BKC A;  1YP1 A;  3TSK A;  2WOA A;  4PKV A;  4H1Q A;  3TT4 A;  5BOY A;  456C A;  4H30 A;  1BM6 A;  2RJP A;  1ZTQ A;  5B5P A;  1BQQ M;  2K2G A;  2FV9 A;  1A86 A;  2E3X A;  3DPE A;  1MMQ A;  1D8F A;  1HY7 A;  5L79 A;  3E8R A;  4WKI A;  4G9L A;  1MNC A;  3LE9 A;  3LUN A;  3EHX A;  3WV3 A;  4DPE A;  1JIZ A;  1YOU A;  4PKT A;  1HTD A;  2X3C A;  4A7B A;  5I0L A;  3CKI A;  1G12 A;  1I73 A;  3EDI A;  4WK7 A;  3UVC A;  3DPF A;  3LQB A;  4HX3 A;  3L0T A;  1R1J A;  2AYK A; 
#chains in the Genus database with same CATH topology
 2JIH A;  2MLR A;  4FXY P;  3B8Z A;  1BIW A;  2OI0 A;  4XBH A;  1JKY A;  3DSL A;  1GE7 A;  5D7W A;  4H76 A;  5BPA A;  3KME A;  2OW9 A;  3P1V A;  2XS4 A;  1G4K A;  4L63 A;  2PJT A;  2D1O A;  1SLN A;  3V96 B;  4H49 A;  1SU3 A;  1SMP A;  2I47 A;  2OZR A;  2D1N A;  1XFW A;  1ZVX A;  1B8Y A;  1OZ9 A;  1XFZ A;  3RTT A;  2V4B A;  4WKE A;  1QIC A;  1KUG A;  3I7G A;  3USN A;  2CLT A;  1EB6 A;  2E2D A;  3EDH A;  3I7I A;  3LIR A;  1BKC I;  3VI1 A;  4GWN A;  1JIW P;  5JMY A;  1JAN A;  2A8H A;  1BSW A;  2YB9 A;  5I12 A;  1G05 A;  4PKR A;  1HFS A;  1CK7 A;  1XUR A;  4H2E A;  1FLS A;  1EUB A;  1ZS0 A;  1GO7 P;  5H8X A;  1HV5 A;  3HDA P;  4GR8 A;  1D8M A;  3B2Z A;  1UMT A;  2K9C A;  1ZXC A;  5CXA A;  1KBC A;  4IN9 A;  4DV8 A;  2Z2D A;  3ELM A;  1ZP5 A;  4GR0 A;  3F19 A;  3G5C A;  3DL1 A;  2OW1 A;  2YIG A;  2W0D A;  3U1R A;  3LEA A;  4XCT A;  1C3I A;  2DW0 A;  3VTG A;  1WNI A;  1OM8 A;  4IUW A;  2OXZ A;  4IJO A;  2YUF A;  4XM8 A;  3OHL A;  5D3C A;  1R55 A;  1XAX A;  4ON1 A;  5BOT A;  5I3M A;  3DWB A;  3K7L A;  3OHO A;  1B3D A;  1XFY A;  1CAQ A;  1BKC E;  1QIB A;  2JSD A;  4JPA A;  1HOV A;  1MMR A;  4WF6 A;  4XM6 A;  1O0Q A;  1R54 A;  5I2Z A;  1J7N A;  1TVI A;  1H71 P;  3KWV C;  3LKA A;  5D1S A;  3P24 A;  1K7Q A;  4ILW D;  1BQO A;  3LK8 A;  4CTH A;  3AYU A;  1S4B P;  1GKC A;  1AYK A;  2N8R A;  3LIK A;  1ATL A;  1CGE A;  4R3V A;  3EHY A;  4GUY A;  3LMC A;  4GQL A;  4AXQ A;  1EAK A;  2OXW A;  1JK3 A;  1R1I A;  830C A;  4XM7 A;  2USN A;  1PWP A;  1MMP A;  2DDF A;  2OW2 A;  1XFU A;  1XUC A;  2J83 A;  2W13 A;  3KEJ A;  1JAO A;  4FXQ A;  4L6T A;  3GBO A;  2RJQ A;  3KMC A;  1FM1 A;  1ND1 A;  1Y0V A;  3G42 A;  3HY9 A;  3KHI A;  1GE5 A;  4G0D A;  4AIG A;  3LGP A;  1UEA A;  1JJ9 A;  1DMT A;  1QIA A;  1G49 A;  1UMS A;  1UTZ A;  3HBV P;  3KRY A;  1K7I A;  1O0T A;  1K7G A;  2OVX A;  2CKI A;  4AUO A;  4WZV A;  3SHI A;  3LUM A;  3KEC A;  2OW0 A;  5I43 A;  1OO9 A;  1L6J A;  3AYK A;  3Q2G A;  4EFS A;  4H82 A;  3F18 A;  3LQ0 A;  1QUA A;  1Q3A A;  3ZUK A;  5L7F A;  3HBU P;  1AST A;  2L0R A;  1A85 A;  2W15 A;  3HDB A;  1HFC A;  5D2B A;  2HU6 A;  4Q1L A;  1SRP A;  1UTT A;  2WO9 A;  2MZH A;  2X3B A;  3K7N A;  4DD8 A;  2QPJ A;  1C7K A;  3NX7 A;  4QKZ A;  4L7A A;  1R1H A;  2W12 A;  2ERO A;  4GWM A;  1D7X A;  3AIG A;  3RTS A;  2Y6C A;  5D1U A;  1BUV M;  1XFV A;  2ERQ A;  1SAT A;  1JAQ A;  1Y8J A;  3EDG A;  3TS4 A;  4PKS A;  4A3W A;  1KUI A;  3WV2 A;  1CGL A;  3EDZ A;  2XS3 A;  1OS2 A;  1JAP A;  2O3E A;  5CZM A;  3HY7 A;  2O36 A;  3WV1 A;  4FVL A;  1GE6 A;  5D1T A;  2KRJ A;  3DTE A;  1IAE A;  1KUF A;  3LJZ A;  1BUD A;  1PWU A;  2DW2 A;  1KUH A;  2X3A A;  1G9K A;  2POJ A;  2ERP A;  1Z3J A;  1SLM A;  2OVZ A;  1D5J A;  1XFX A;  2JNP A;  4GR3 A;  1CGF A;  1USN A;  2WO8 A;  2OY2 A;  3Q2H A;  1GXD A;  2DDY A;  1OM7 A;  1QJI A;  5CUH A;  5B5O A;  1I1I P;  1RMZ A;  2X7M A;  4H84 A;  4JP4 A;  1IAG A;  3TVC A;  3HB2 P;  3F17 A;  3F1A A;  3O2X A;  1PWV A;  1QJJ A;  1PWW A;  4PKU A;  1BZS A;  1KUK A;  3EWJ A;  1OS9 A;  1OM6 A;  1ROS A;  3BA0 A;  4I35 A;  2TCL A;  1JH1 A;  3LJG A;  4JA1 A;  4H3X A;  2J0T A;  3DTI A;  1AF0 A;  1GO8 P;  1IAA A;  3N2U A;  3ZXH A;  1AKL A;  1CQR A;  3F15 A;  1OMJ A;  2OY4 A;  2MZI A;  2JT5 A;  3F16 A;  1PWQ A;  1IAB A;  4L19 A;  1KAP P;  3HYG A;  3ZVS A;  3LJT A;  1I76 A;  2FV5 A;  4PKW A;  4DF9 A;  2DW1 A;  1GKD A;  2JT6 A;  4ZR5 A;  3O64 A;  2Y6D A;  2SRT A;  4GF1 A;  5I4O A;  4AYK A;  1CIZ A;  3DNG A;  3LIL A;  1DTH A;  1IAC A;  1CXV A;  1YQY A;  2W14 A;  4I03 A;  4FU4 A;  1C8T A;  4JQG A;  1XUD A;  1ZXV A;  2MLS A;  4J4M A;  3N2V A;  1Y93 A;  1IAD A;  2AIG P;  3DTK A;  1MMB A;  3KEK A;  4JIJ A;  3B92 A;  4HMA A;  3L0V A;  1RM8 A;  1FBL A;  966C A;  5LAB A;  2OXU A;  4PKQ A;  1YCM A;  2MZE A;  3MA2 A;  1BKC A;  1YP1 A;  3TSK A;  2WOA A;  4PKV A;  4H1Q A;  3TT4 A;  5BOY A;  456C A;  4H30 A;  1BM6 A;  2RJP A;  1XM5 A;  1ZTQ A;  5B5P A;  1BQQ M;  2K2G A;  2FV9 A;  1A86 A;  2E3X A;  3DPE A;  1MMQ A;  1D8F A;  1HY7 A;  5L79 A;  3E8R A;  4WKI A;  4G9L A;  1MNC A;  3LE9 A;  3LUN A;  3EHX A;  3WV3 A;  4DPE A;  1JIZ A;  1YOU A;  4PKT A;  1HTD A;  2X3C A;  4A7B A;  5I0L A;  3CKI A;  1G12 A;  1I73 A;  3EDI A;  4WK7 A;  3UVC A;  3DPF A;  3LQB A;  4HX3 A;  3L0T A;  1R1J A;  2AYK A; 
#chains in the Genus database with same CATH homology
 2JIH A;  2MLR A;  4FXY P;  3B8Z A;  1BIW A;  2OI0 A;  4XBH A;  1JKY A;  3DSL A;  1GE7 A;  5D7W A;  4H76 A;  5BPA A;  3KME A;  2OW9 A;  3P1V A;  2XS4 A;  1G4K A;  4L63 A;  2PJT A;  2D1O A;  1SLN A;  3V96 B;  4H49 A;  1SU3 A;  1SMP A;  2I47 A;  2OZR A;  2D1N A;  1XFW A;  1ZVX A;  1B8Y A;  1XFZ A;  3RTT A;  2V4B A;  4WKE A;  1QIC A;  1KUG A;  3I7G A;  3USN A;  2CLT A;  1EB6 A;  2E2D A;  3EDH A;  3I7I A;  3LIR A;  1BKC I;  3VI1 A;  4GWN A;  1JIW P;  5JMY A;  1JAN A;  2A8H A;  1BSW A;  2YB9 A;  5I12 A;  1G05 A;  4PKR A;  1HFS A;  1CK7 A;  1XUR A;  4H2E A;  1FLS A;  1EUB A;  1ZS0 A;  1GO7 P;  5H8X A;  1HV5 A;  3HDA P;  4GR8 A;  1D8M A;  3B2Z A;  1UMT A;  2K9C A;  1ZXC A;  5CXA A;  1KBC A;  4IN9 A;  4DV8 A;  2Z2D A;  3ELM A;  1ZP5 A;  4GR0 A;  3F19 A;  3G5C A;  3DL1 A;  2OW1 A;  2YIG A;  2W0D A;  3U1R A;  3LEA A;  4XCT A;  1C3I A;  2DW0 A;  3VTG A;  1WNI A;  1OM8 A;  4IUW A;  2OXZ A;  4IJO A;  2YUF A;  4XM8 A;  3OHL A;  5D3C A;  1R55 A;  4ON1 A;  5BOT A;  5I3M A;  3DWB A;  3K7L A;  3OHO A;  1B3D A;  1XFY A;  1CAQ A;  1BKC E;  1QIB A;  2JSD A;  4JPA A;  1HOV A;  1MMR A;  4WF6 A;  4XM6 A;  1O0Q A;  1R54 A;  5I2Z A;  1J7N A;  1H71 P;  3KWV C;  3LKA A;  5D1S A;  3P24 A;  1K7Q A;  4ILW D;  1BQO A;  3LK8 A;  4CTH A;  3AYU A;  1S4B P;  1GKC A;  1AYK A;  2N8R A;  3LIK A;  1ATL A;  1CGE A;  4R3V A;  3EHY A;  4GUY A;  3LMC A;  4GQL A;  4AXQ A;  1EAK A;  2OXW A;  1JK3 A;  1R1I A;  830C A;  4XM7 A;  2USN A;  1PWP A;  1MMP A;  2DDF A;  2OW2 A;  1XFU A;  1XUC A;  2J83 A;  2W13 A;  3KEJ A;  1JAO A;  4FXQ A;  4L6T A;  3GBO A;  2RJQ A;  3KMC A;  1FM1 A;  1ND1 A;  1Y0V A;  3G42 A;  3HY9 A;  3KHI A;  1GE5 A;  4G0D A;  4AIG A;  3LGP A;  1UEA A;  1JJ9 A;  1DMT A;  1QIA A;  1G49 A;  1UMS A;  1UTZ A;  3HBV P;  3KRY A;  1K7I A;  1O0T A;  1K7G A;  2OVX A;  2CKI A;  4AUO A;  4WZV A;  3SHI A;  3LUM A;  3KEC A;  2OW0 A;  5I43 A;  1OO9 A;  1L6J A;  3AYK A;  3Q2G A;  4EFS A;  4H82 A;  3F18 A;  3LQ0 A;  1QUA A;  1Q3A A;  3ZUK A;  5L7F A;  3HBU P;  1AST A;  2L0R A;  1A85 A;  2W15 A;  3HDB A;  1HFC A;  5D2B A;  2HU6 A;  4Q1L A;  1SRP A;  1UTT A;  2WO9 A;  2MZH A;  2X3B A;  3K7N A;  4DD8 A;  2QPJ A;  1C7K A;  3NX7 A;  4QKZ A;  4L7A A;  1R1H A;  2W12 A;  2ERO A;  4GWM A;  1D7X A;  3AIG A;  3RTS A;  2Y6C A;  5D1U A;  1BUV M;  1XFV A;  2ERQ A;  1SAT A;  1JAQ A;  1Y8J A;  3EDG A;  3TS4 A;  4PKS A;  4A3W A;  1KUI A;  3WV2 A;  1CGL A;  3EDZ A;  2XS3 A;  1OS2 A;  1JAP A;  2O3E A;  5CZM A;  3HY7 A;  2O36 A;  3WV1 A;  4FVL A;  1GE6 A;  5D1T A;  2KRJ A;  3DTE A;  1IAE A;  1KUF A;  3LJZ A;  1BUD A;  1PWU A;  2DW2 A;  1KUH A;  2X3A A;  1G9K A;  2POJ A;  2ERP A;  1Z3J A;  1SLM A;  2OVZ A;  1D5J A;  1XFX A;  2JNP A;  4GR3 A;  1CGF A;  1USN A;  2WO8 A;  2OY2 A;  3Q2H A;  1GXD A;  2DDY A;  1OM7 A;  1QJI A;  5CUH A;  5B5O A;  1I1I P;  1RMZ A;  2X7M A;  4H84 A;  4JP4 A;  1IAG A;  3TVC A;  3HB2 P;  3F17 A;  3F1A A;  3O2X A;  1PWV A;  1QJJ A;  1PWW A;  4PKU A;  1BZS A;  1KUK A;  3EWJ A;  1OS9 A;  1OM6 A;  1ROS A;  3BA0 A;  4I35 A;  2TCL A;  1JH1 A;  3LJG A;  4JA1 A;  4H3X A;  2J0T A;  3DTI A;  1AF0 A;  1GO8 P;  1IAA A;  3N2U A;  3ZXH A;  1AKL A;  1CQR A;  3F15 A;  1OMJ A;  2OY4 A;  2MZI A;  2JT5 A;  3F16 A;  1PWQ A;  1IAB A;  4L19 A;  1KAP P;  3HYG A;  3ZVS A;  3LJT A;  1I76 A;  2FV5 A;  4PKW A;  4DF9 A;  2DW1 A;  1GKD A;  2JT6 A;  4ZR5 A;  3O64 A;  2Y6D A;  2SRT A;  4GF1 A;  5I4O A;  4AYK A;  1CIZ A;  3DNG A;  3LIL A;  1DTH A;  1IAC A;  1CXV A;  1YQY A;  2W14 A;  4I03 A;  4FU4 A;  1C8T A;  4JQG A;  1XUD A;  1ZXV A;  2MLS A;  4J4M A;  3N2V A;  1Y93 A;  1IAD A;  2AIG P;  3DTK A;  1MMB A;  3KEK A;  4JIJ A;  3B92 A;  4HMA A;  3L0V A;  1RM8 A;  1FBL A;  966C A;  5LAB A;  2OXU A;  4PKQ A;  1YCM A;  2MZE A;  3MA2 A;  1BKC A;  1YP1 A;  3TSK A;  2WOA A;  4PKV A;  4H1Q A;  3TT4 A;  5BOY A;  456C A;  4H30 A;  1BM6 A;  2RJP A;  1ZTQ A;  5B5P A;  1BQQ M;  2K2G A;  2FV9 A;  1A86 A;  2E3X A;  3DPE A;  1MMQ A;  1D8F A;  1HY7 A;  5L79 A;  3E8R A;  4WKI A;  4G9L A;  1MNC A;  3LE9 A;  3LUN A;  3EHX A;  3WV3 A;  4DPE A;  1JIZ A;  1YOU A;  4PKT A;  1HTD A;  2X3C A;  4A7B A;  5I0L A;  3CKI A;  1G12 A;  1I73 A;  3EDI A;  4WK7 A;  3UVC A;  3DPF A;  3LQB A;  4HX3 A;  3L0T A;  1R1J A;  2AYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...