3B2ZA

Crystal structure of adamts4 (apo form)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
293
structure length
290
Chain Sequence
SLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHQLGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHHAMCQTKHSPWADGTPCGPAQACMGGRCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADAMTS-4
publication title Crystal structures of the two major aggrecan degrading enzymes, ADAMTS4 and ADAMTS5.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 290
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.82: ADAMTS-4 endopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3b2zA01
5D3CA 2OZRA 4R3VA 1PWPA 3F1AA 4JQGA 4PKWA 4J4MA 2FV5A 5D2BA 4A3WA 1RM8A 3K7NA 4XM6A 5B5PA 2CKIA 2XS3A 1CGFA 1Y0VA 3RTTA 1JK3A 5I43A 1JH1A 2X3BA 2JNPA 4I35A 1G4KA 3DPFA 3LEAA 5CXAA 2W0DA 830CA 2JIHA 1OS9A 1IABA 3MA2A 1JAQA 1KUIA 1OM6A 1D8FA 4I03A 1R1IA 3AYUA 2XS4A 1BUVM 3LUNA 4PKUA 5L79A 1FM1A 2D1NA 3P1VA 1GXDA 4XM7A 4PKTA 1JANA 2KRJA 2MZHA 3DL1A 3LJTA 1PWWA 4ON1A 3F19A 3ZUKA 2AYKA 1GE6A 4H1QA 3WV3A 2POJA 1D8MA 3AIGA 3NX7A 3F17A 1SMPA 2MZEA 1YOUA 1JIZA 4ILWD 1CGLA 1UEAA 2AIGP 1ND1A 2X3AA 2TCLA 3USNA 2MZIA 3KEJA 1JIWP 1XUCA 3LKAA 1UTZA 3LUMA 3V96B 3I7IA 3DPEA 2OXUA 1BKCI 2JT5A 1J7NA 4AYKA 1XURA 1R55A 4WKEA 1CK7A 1B3DA 4Q1LA 4WZVA 3HDAP 4JIJA 3P24A 2WO8A 2PJTA 1SATA 1AF0A 2O3EA 3L0VA 1ZTQA 1MMBA 1SRPA 2WO9A 2Z2DA 2J83A 4JPAA 2W14A 1DMTA 5CUHA 3LQBA 4H30A 1G12A 3TVCA 1DTHA 1G05A 2RJQA 3GBOA 2WOAA 3LQ0A 1XFYA 1OM7A 1Z3JA 4WF6A 1QJJA 3L0TA 4GR3A 4GR8A 4G0DA 1Y93A 3LJZA 3BA0A 1IAEA 1RMZA 3TT4A 4L19A 4PKSA 1B8YA 3RTSA 5BOTA 4FU4A 1OO9A 4GR0A 2W13A 4H76A 1UMSA 3F15A 4H2EA 3WV2A 4FVLA 5LABA 4GUYA 3ELMA 1XUDA 2JSDA 3HB2P 1MMQA 3HBUP 1D7XA 1S4BP 2A8HA 3O2XA 3EDZA 3KEKA 2K2GA 3ZXHA 3DSLA 1CXVA 1HTDA 3KWVC 1MNCA 1I76A 2JT6A 4JP4A 1PWVA 5I3MA 4G9LA 2W12A 3EHYA 2CLTA 1C3IA 3LJGA 1R1HA 3LGPA 3OHLA 1GE5A 1ROSA 1I1IP 1XFXA 1JAOA 4GF1A 4AIGA 1ATLA 4DV8A 1R54A 3ZVSA 3DNGA 3OHOA 2V4BA 3HY9A 3O64A 3LILA 1GKCA 3AYKA 2L0RA 1YCMA 1OM8A 1KUGA 2OXWA 2OY2A 2YIGA 1Q3AA 1GO7P 3KECA 1QIBA 1QIAA 1H71P 2ERQA 1GE7A 1QJIA 1CIZA 1O0QA 1D5JA 4IN9A 1MMPA 3F18A 3KMEA 3EWJA 2YB9A 3B92A 2Y6CA 2OXZA 4A7BA 3LE9A 4PKVA 3B2ZA 4DPEA 2OW0A 4DD8A 1QICA 3TSKA 3U1RA 3UVCA 1KUKA 1K7QA 1PWUA 2OVZA 1BIWA 1YP1A 1EUBA 2E2DA 1ZP5A 3Q2GA 1SU3A 2ERPA 4PKQA 4CTHA 3EHXA 3LK8A 5I2ZA 2DW2A 1CGEA 4IUWA 1KAPP 1AYKA 1EAKA 1O0TA 3EDHA 1SLMA 2I47A 5H8XA 4HMAA 3KMCA 3HDBA 3LIRA 3DWBA 4AUOA 1ZVXA 1EB6A 2D1OA 2USNA 4PKRA 3B8ZA 4WK7A 2W15A 1HFSA 3CKIA 2HU6A 1AKLA 2SRTA 1UMTA 2EROA 4DF9A 1L6JA 3VTGA 3EDIA 1USNA 2Y6DA 4H82A 1OMJA 4H49A 5JMYA 1OS2A 1HOVA 1R1JA 1C8TA 5D1TA 2OW1A 1BKCE 1CAQA 4HX3A 3TS4A 2OW9A 2E3XA 2OY4A 4ZR5A 1KBCA 1G9KA 3KHIA 4AXQA 1FBLA 4L6TA 456CA 1IACA 4L63A 4EFSA 2OW2A 5D7WA 5I4OA 5CZMA 1I73A 1XFZA 1WNIA 1C7KA 1BSWA 1XFVA 1Y8JA 3EDGA 1ASTA 1GKDA 1UTTA 2MLRA 2N8RA 1KUHA 1JAPA 5B5OA 5I12A 1XFUA 1BM6A 1HV5A 5D1UA 1K7IA 2OVXA 2DDFA 4H3XA 3I7GA 1KUFA 1ZXCA 2RJPA 2QPJA 1JKYA 2DW0A 3HY7A 3WV1A 1BUDA 5D1SA 3K7LA 1ZXVA 1PWQA 1BZSA 2DDYA 4WKIA 4FXYP 4H84A 3N2VA 3HYGA 1IADA 5BOYA 1CQRA 2MLSA 2X3CA 1BQQM 1GO8P 1QUAA 3G5CA 1YQYA 3LIKA 4FXQA 2DW1A 2FV9A 5L7FA 1HY7A 3KRYA 3SHIA 4QKZA 1BQOA 3VI1A 2K9CA 3E8RA 1JJ9A 1IAAA 4IJOA 2O36A 2J0TA 3G42A 1K7GA 4XBHA 966CA 2OI0A 1IAGA 4GWNA 4GWMA 3F16A 3LMCA 1SLNA 1FLSA 4JA1A 1A85A 1ZS0A 3N2UA 3HBVP 3Q2HA 1XFWA 1A86A 4GQLA 4XCTA 4XM8A 1G49A 5I0LA 1MMRA 1BKCA 2X7MA 1HFCA 5BPAA
chains in the Genus database with same CATH superfamily
5D3CA 2OZRA 4R3VA 1PWPA 3F1AA 4JQGA 4PKWA 4J4MA 2FV5A 5D2BA 4A3WA 1RM8A 3K7NA 4XM6A 5B5PA 2CKIA 2XS3A 1CGFA 1Y0VA 3RTTA 1JK3A 5I43A 1JH1A 2X3BA 2JNPA 4I35A 1G4KA 3DPFA 3LEAA 5CXAA 2W0DA 4L7AA 830CA 2JIHA 1OS9A 1IABA 3MA2A 1JAQA 1KUIA 1OM6A 1D8FA 4I03A 1R1IA 3AYUA 2XS4A 1BUVM 3LUNA 4PKUA 5L79A 1FM1A 2D1NA 3P1VA 1GXDA 4XM7A 4PKTA 1JANA 2KRJA 2MZHA 3DL1A 3LJTA 1PWWA 4ON1A 3F19A 3ZUKA 2AYKA 1GE6A 4H1QA 3WV3A 2POJA 1D8MA 3AIGA 3NX7A 3F17A 1SMPA 2MZEA 1YOUA 1JIZA 4ILWD 1CGLA 1UEAA 2AIGP 1ND1A 2X3AA 2TCLA 3USNA 2MZIA 3KEJA 1JIWP 1XUCA 3LKAA 1UTZA 3LUMA 3V96B 3I7IA 3DPEA 2OXUA 1BKCI 2JT5A 1J7NA 4AYKA 1XURA 1R55A 4WKEA 1CK7A 1B3DA 4Q1LA 4WZVA 3HDAP 4JIJA 3P24A 2WO8A 2PJTA 1SATA 1AF0A 2O3EA 3L0VA 1ZTQA 1MMBA 1SRPA 2WO9A 2Z2DA 2J83A 4JPAA 2W14A 1DMTA 5CUHA 3LQBA 4H30A 1G12A 3TVCA 1DTHA 1G05A 2RJQA 3GBOA 2WOAA 3LQ0A 1XFYA 1OM7A 1Z3JA 4WF6A 1QJJA 3L0TA 4GR3A 4GR8A 4G0DA 1Y93A 3LJZA 3BA0A 1IAEA 1RMZA 3TT4A 4L19A 4PKSA 1B8YA 3RTSA 5BOTA 4FU4A 1OO9A 4GR0A 2W13A 4H76A 1UMSA 3F15A 4H2EA 3WV2A 4FVLA 5LABA 4GUYA 3ELMA 1XUDA 2JSDA 3HB2P 1MMQA 3HBUP 1D7XA 1S4BP 2A8HA 3O2XA 3EDZA 3KEKA 2K2GA 3ZXHA 3DSLA 1CXVA 1HTDA 3KWVC 1MNCA 1I76A 2JT6A 4JP4A 1PWVA 5I3MA 4G9LA 2W12A 3EHYA 2CLTA 1C3IA 3LJGA 1R1HA 3LGPA 3OHLA 1GE5A 1ROSA 1I1IP 1XFXA 1JAOA 4GF1A 4AIGA 1ATLA 4DV8A 1R54A 1XAXA 3ZVSA 3DNGA 3OHOA 2V4BA 3HY9A 3O64A 3LILA 3DTKA 1GKCA 3AYKA 2L0RA 1YCMA 1OM8A 1KUGA 2OXWA 2OY2A 2YIGA 1Q3AA 1GO7P 3KECA 1QIBA 1QIAA 1H71P 2ERQA 1GE7A 1QJIA 1CIZA 1O0QA 1D5JA 4IN9A 1MMPA 3F18A 3KMEA 3EWJA 2YB9A 3B92A 2Y6CA 2OXZA 4A7BA 3LE9A 4PKVA 3B2ZA 4DPEA 2OW0A 4DD8A 1QICA 3TSKA 3U1RA 3UVCA 1KUKA 1K7QA 1PWUA 2OVZA 1BIWA 1YP1A 1EUBA 2E2DA 1ZP5A 3Q2GA 1SU3A 2ERPA 4PKQA 4CTHA 3EHXA 3LK8A 5I2ZA 2DW2A 1CGEA 4IUWA 1KAPP 1AYKA 1EAKA 1O0TA 3EDHA 1SLMA 2I47A 5H8XA 4HMAA 3KMCA 3HDBA 3LIRA 3DWBA 4AUOA 1ZVXA 1EB6A 2D1OA 2USNA 4PKRA 3B8ZA 4WK7A 2W15A 1HFSA 3CKIA 2HU6A 1OZ9A 1AKLA 2YUFA 1TVIA 2SRTA 1UMTA 2EROA 4DF9A 1L6JA 3VTGA 3EDIA 1USNA 2Y6DA 4H82A 1OMJA 4H49A 5JMYA 1OS2A 1HOVA 1R1JA 1C8TA 5D1TA 2OW1A 1BKCE 1CAQA 4HX3A 3TS4A 2OW9A 2E3XA 2OY4A 4ZR5A 1KBCA 1G9KA 3KHIA 4AXQA 1FBLA 4L6TA 456CA 1IACA 4L63A 4EFSA 2OW2A 5D7WA 5I4OA 5CZMA 1I73A 1XFZA 1WNIA 1C7KA 1BSWA 1XFVA 1Y8JA 3EDGA 1ASTA 1GKDA 1UTTA 2MLRA 2N8RA 1KUHA 1JAPA 5B5OA 5I12A 1XFUA 1BM6A 1HV5A 3DTEA 5D1UA 1K7IA 2OVXA 2DDFA 4H3XA 3I7GA 1KUFA 1ZXCA 2RJPA 2QPJA 1JKYA 2DW0A 3HY7A 3WV1A 1BUDA 5D1SA 3K7LA 1ZXVA 1PWQA 1BZSA 2DDYA 4WKIA 4FXYP 4H84A 3N2VA 3HYGA 1IADA 1XM5A 5BOYA 1CQRA 2MLSA 2X3CA 1BQQM 1GO8P 1QUAA 3G5CA 1YQYA 3LIKA 4FXQA 2DW1A 2FV9A 5L7FA 1HY7A 3KRYA 3SHIA 4QKZA 1BQOA 3VI1A 2K9CA 3E8RA 1JJ9A 1IAAA 4IJOA 2O36A 2J0TA 3G42A 1K7GA 4XBHA 966CA 2OI0A 1IAGA 4GWNA 4GWMA 3DTIA 3F16A 3LMCA 1SLNA 1FLSA 4JA1A 1A85A 1ZS0A 3N2UA 3HBVP 3Q2HA 1XFWA 1A86A 4GQLA 4XCTA 4XM8A 1G49A 5I0LA 1MMRA 1BKCA 2X7MA 1HFCA 5BPAA
chains in the Genus database with same CATH topology
5D3CA 2OZRA 4R3VA 1PWPA 3F1AA 4JQGA 4PKWA 4J4MA 2FV5A 5D2BA 4A3WA 1RM8A 3K7NA 4XM6A 5B5PA 2CKIA 2XS3A 1CGFA 1Y0VA 3RTTA 1JK3A 5I43A 1JH1A 2X3BA 2JNPA 4I35A 1G4KA 3DPFA 3LEAA 5CXAA 2W0DA 4L7AA 830CA 2JIHA 1OS9A 1IABA 3MA2A 1JAQA 1KUIA 1OM6A 1D8FA 4I03A 1R1IA 3AYUA 2XS4A 1BUVM 3LUNA 4PKUA 5L79A 1FM1A 2D1NA 3P1VA 1GXDA 4XM7A 4PKTA 1JANA 2KRJA 2MZHA 3DL1A 3LJTA 1PWWA 4ON1A 3F19A 3ZUKA 2AYKA 1GE6A 4H1QA 3WV3A 2POJA 1D8MA 3AIGA 3NX7A 3F17A 1SMPA 2MZEA 1YOUA 1JIZA 4ILWD 1CGLA 1UEAA 2AIGP 1ND1A 2X3AA 2TCLA 3USNA 2MZIA 3KEJA 1JIWP 1XUCA 3LKAA 1UTZA 3LUMA 3V96B 3I7IA 3DPEA 2OXUA 1BKCI 2JT5A 1J7NA 4AYKA 1XURA 1R55A 4WKEA 1CK7A 1B3DA 4Q1LA 4WZVA 3HDAP 4JIJA 3P24A 2WO8A 2PJTA 1SATA 1AF0A 2O3EA 3L0VA 1ZTQA 1MMBA 1SRPA 2WO9A 2Z2DA 2J83A 4JPAA 2W14A 1DMTA 5CUHA 3LQBA 4H30A 1G12A 3TVCA 1DTHA 1G05A 2RJQA 3GBOA 2WOAA 3LQ0A 1XFYA 1OM7A 1Z3JA 4WF6A 1QJJA 3L0TA 4GR3A 4GR8A 4G0DA 1Y93A 3LJZA 3BA0A 1IAEA 1RMZA 3TT4A 4L19A 4PKSA 1B8YA 3RTSA 5BOTA 4FU4A 1OO9A 4GR0A 2W13A 4H76A 1UMSA 3F15A 4H2EA 3WV2A 4FVLA 5LABA 4GUYA 3ELMA 1XUDA 2JSDA 3HB2P 1MMQA 3HBUP 1D7XA 1S4BP 2A8HA 3O2XA 3EDZA 3KEKA 2K2GA 3ZXHA 3DSLA 1CXVA 1HTDA 3KWVC 1MNCA 1I76A 2JT6A 4JP4A 1PWVA 5I3MA 4G9LA 2W12A 3EHYA 2CLTA 1C3IA 3LJGA 1R1HA 3LGPA 3OHLA 1GE5A 1ROSA 1I1IP 1XFXA 1JAOA 4GF1A 4AIGA 1ATLA 4DV8A 1R54A 3ZVSA 3DNGA 3OHOA 2V4BA 3HY9A 3O64A 3LILA 3DTKA 1GKCA 3AYKA 2L0RA 1YCMA 1OM8A 1KUGA 2OXWA 2OY2A 2YIGA 1Q3AA 1GO7P 3KECA 1QIBA 1QIAA 1H71P 2ERQA 1GE7A 1QJIA 1CIZA 1O0QA 1D5JA 4IN9A 1MMPA 3F18A 3KMEA 3EWJA 2YB9A 3B92A 2Y6CA 2OXZA 4A7BA 3LE9A 4PKVA 3B2ZA 4DPEA 2OW0A 4DD8A 1QICA 3TSKA 3U1RA 3UVCA 1KUKA 1K7QA 1PWUA 2OVZA 1BIWA 1YP1A 1EUBA 2E2DA 1ZP5A 3Q2GA 1SU3A 2ERPA 4PKQA 4CTHA 3EHXA 3LK8A 5I2ZA 2DW2A 1CGEA 4IUWA 1KAPP 1AYKA 1EAKA 1O0TA 3EDHA 1SLMA 2I47A 5H8XA 4HMAA 3KMCA 3HDBA 3LIRA 3DWBA 4AUOA 1ZVXA 1EB6A 2D1OA 2USNA 4PKRA 3B8ZA 4WK7A 2W15A 1HFSA 3CKIA 2HU6A 1AKLA 2YUFA 2SRTA 1UMTA 2EROA 4DF9A 1L6JA 3VTGA 3EDIA 1USNA 2Y6DA 4H82A 1OMJA 4H49A 5JMYA 1OS2A 1HOVA 1R1JA 1C8TA 5D1TA 2OW1A 1BKCE 1CAQA 4HX3A 3TS4A 2OW9A 2E3XA 2OY4A 4ZR5A 1KBCA 1G9KA 3KHIA 4AXQA 1FBLA 4L6TA 456CA 1IACA 4L63A 4EFSA 2OW2A 5D7WA 5I4OA 5CZMA 1I73A 1XFZA 1WNIA 1C7KA 1BSWA 1XFVA 1Y8JA 3EDGA 1ASTA 1GKDA 1UTTA 2MLRA 2N8RA 1KUHA 1JAPA 5B5OA 5I12A 1XFUA 1BM6A 1HV5A 3DTEA 5D1UA 1K7IA 2OVXA 2DDFA 4H3XA 3I7GA 1KUFA 1ZXCA 2RJPA 2QPJA 1JKYA 2DW0A 3HY7A 3WV1A 1BUDA 5D1SA 3K7LA 1ZXVA 1PWQA 1BZSA 2DDYA 4WKIA 4FXYP 4H84A 3N2VA 3HYGA 1IADA 5BOYA 1CQRA 2MLSA 2X3CA 1BQQM 1GO8P 1QUAA 3G5CA 1YQYA 3LIKA 4FXQA 2DW1A 2FV9A 5L7FA 1HY7A 3KRYA 3SHIA 4QKZA 1BQOA 3VI1A 2K9CA 3E8RA 1JJ9A 1IAAA 4IJOA 2O36A 2J0TA 3G42A 1K7GA 4XBHA 966CA 2OI0A 1IAGA 4GWNA 4GWMA 3DTIA 3F16A 3LMCA 1SLNA 1FLSA 4JA1A 1A85A 1ZS0A 3N2UA 3HBVP 3Q2HA 1XFWA 1A86A 4GQLA 4XCTA 4XM8A 1G49A 5I0LA 1MMRA 1BKCA 2X7MA 1HFCA 5BPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3C A;  2OZR A;  4R3V A;  1PWP A;  3F1A A;  4JQG A;  4PKW A;  4J4M A;  2FV5 A;  5D2B A;  4A3W A;  1RM8 A;  3K7N A;  4XM6 A;  5B5P A;  2CKI A;  2XS3 A;  1CGF A;  1Y0V A;  3RTT A;  1JK3 A;  5I43 A;  1JH1 A;  2X3B A;  2JNP A;  4I35 A;  1G4K A;  3DPF A;  3LEA A;  5CXA A;  2W0D A;  830C A;  2JIH A;  1OS9 A;  1IAB A;  3MA2 A;  1JAQ A;  1KUI A;  1OM6 A;  1D8F A;  4I03 A;  1R1I A;  3AYU A;  2XS4 A;  1BUV M;  3LUN A;  4PKU A;  5L79 A;  1FM1 A;  2D1N A;  3P1V A;  1GXD A;  4XM7 A;  4PKT A;  1JAN A;  2KRJ A;  2MZH A;  3DL1 A;  3LJT A;  1PWW A;  4ON1 A;  3F19 A;  3ZUK A;  2AYK A;  1GE6 A;  4H1Q A;  3WV3 A;  2POJ A;  1D8M A;  3AIG A;  3NX7 A;  3F17 A;  1SMP A;  2MZE A;  1YOU A;  1JIZ A;  4ILW D;  1CGL A;  1UEA A;  2AIG P;  1ND1 A;  2X3A A;  2TCL A;  3USN A;  2MZI A;  3KEJ A;  1JIW P;  1XUC A;  3LKA A;  1UTZ A;  3LUM A;  3V96 B;  3I7I A;  3DPE A;  2OXU A;  1BKC I;  2JT5 A;  1J7N A;  4AYK A;  1XUR A;  1R55 A;  4WKE A;  1CK7 A;  1B3D A;  4Q1L A;  4WZV A;  3HDA P;  4JIJ A;  3P24 A;  2WO8 A;  2PJT A;  1SAT A;  1AF0 A;  2O3E A;  3L0V A;  1ZTQ A;  1MMB A;  1SRP A;  2WO9 A;  2Z2D A;  2J83 A;  4JPA A;  2W14 A;  1DMT A;  5CUH A;  3LQB A;  4H30 A;  1G12 A;  3TVC A;  1DTH A;  1G05 A;  2RJQ A;  3GBO A;  2WOA A;  3LQ0 A;  1XFY A;  1OM7 A;  1Z3J A;  4WF6 A;  1QJJ A;  3L0T A;  4GR3 A;  4GR8 A;  4G0D A;  1Y93 A;  3LJZ A;  3BA0 A;  1IAE A;  1RMZ A;  3TT4 A;  4L19 A;  4PKS A;  1B8Y A;  3RTS A;  5BOT A;  4FU4 A;  1OO9 A;  4GR0 A;  2W13 A;  4H76 A;  1UMS A;  3F15 A;  4H2E A;  3WV2 A;  4FVL A;  5LAB A;  4GUY A;  3ELM A;  1XUD A;  2JSD A;  3HB2 P;  1MMQ A;  3HBU P;  1D7X A;  1S4B P;  2A8H A;  3O2X A;  3EDZ A;  3KEK A;  2K2G A;  3ZXH A;  3DSL A;  1CXV A;  1HTD A;  3KWV C;  1MNC A;  1I76 A;  2JT6 A;  4JP4 A;  1PWV A;  5I3M A;  4G9L A;  2W12 A;  3EHY A;  2CLT A;  1C3I A;  3LJG A;  1R1H A;  3LGP A;  3OHL A;  1GE5 A;  1ROS A;  1I1I P;  1XFX A;  1JAO A;  4GF1 A;  4AIG A;  1ATL A;  4DV8 A;  1R54 A;  3ZVS A;  3DNG A;  3OHO A;  2V4B A;  3HY9 A;  3O64 A;  3LIL A;  1GKC A;  3AYK A;  2L0R A;  1YCM A;  1OM8 A;  1KUG A;  2OXW A;  2OY2 A;  2YIG A;  1Q3A A;  1GO7 P;  3KEC A;  1QIB A;  1QIA A;  1H71 P;  2ERQ A;  1GE7 A;  1QJI A;  1CIZ A;  1O0Q A;  1D5J A;  4IN9 A;  1MMP A;  3F18 A;  3KME A;  3EWJ A;  2YB9 A;  3B92 A;  2Y6C A;  2OXZ A;  4A7B A;  3LE9 A;  4PKV A;  3B2Z A;  4DPE A;  2OW0 A;  4DD8 A;  1QIC A;  3TSK A;  3U1R A;  3UVC A;  1KUK A;  1K7Q A;  1PWU A;  2OVZ A;  1BIW A;  1YP1 A;  1EUB A;  2E2D A;  1ZP5 A;  3Q2G A;  1SU3 A;  2ERP A;  4PKQ A;  4CTH A;  3EHX A;  3LK8 A;  5I2Z A;  2DW2 A;  1CGE A;  4IUW A;  1KAP P;  1AYK A;  1EAK A;  1O0T A;  3EDH A;  1SLM A;  2I47 A;  5H8X A;  4HMA A;  3KMC A;  3HDB A;  3LIR A;  3DWB A;  4AUO A;  1ZVX A;  1EB6 A;  2D1O A;  2USN A;  4PKR A;  3B8Z A;  4WK7 A;  2W15 A;  1HFS A;  3CKI A;  2HU6 A;  1AKL A;  2SRT A;  1UMT A;  2ERO A;  4DF9 A;  1L6J A;  3VTG A;  3EDI A;  1USN A;  2Y6D A;  4H82 A;  1OMJ A;  4H49 A;  5JMY A;  1OS2 A;  1HOV A;  1R1J A;  1C8T A;  5D1T A;  2OW1 A;  1BKC E;  1CAQ A;  4HX3 A;  3TS4 A;  2OW9 A;  2E3X A;  2OY4 A;  4ZR5 A;  1KBC A;  1G9K A;  3KHI A;  4AXQ A;  1FBL A;  4L6T A;  456C A;  1IAC A;  4L63 A;  4EFS A;  2OW2 A;  5D7W A;  5I4O A;  5CZM A;  1I73 A;  1XFZ A;  1WNI A;  1C7K A;  1BSW A;  1XFV A;  1Y8J A;  3EDG A;  1AST A;  1GKD A;  1UTT A;  2MLR A;  2N8R A;  1KUH A;  1JAP A;  5B5O A;  5I12 A;  1XFU A;  1BM6 A;  1HV5 A;  5D1U A;  1K7I A;  2OVX A;  2DDF A;  4H3X A;  3I7G A;  1KUF A;  1ZXC A;  2RJP A;  2QPJ A;  1JKY A;  2DW0 A;  3HY7 A;  3WV1 A;  1BUD A;  5D1S A;  3K7L A;  1ZXV A;  1PWQ A;  1BZS A;  2DDY A;  4WKI A;  4FXY P;  4H84 A;  3N2V A;  3HYG A;  1IAD A;  5BOY A;  1CQR A;  2MLS A;  2X3C A;  1BQQ M;  1GO8 P;  1QUA A;  3G5C A;  1YQY A;  3LIK A;  4FXQ A;  2DW1 A;  2FV9 A;  5L7F A;  1HY7 A;  3KRY A;  3SHI A;  4QKZ A;  1BQO A;  3VI1 A;  2K9C A;  3E8R A;  1JJ9 A;  1IAA A;  4IJO A;  2O36 A;  2J0T A;  3G42 A;  1K7G A;  4XBH A;  966C A;  2OI0 A;  1IAG A;  4GWN A;  4GWM A;  3F16 A;  3LMC A;  1SLN A;  1FLS A;  4JA1 A;  1A85 A;  1ZS0 A;  3N2U A;  3HBV P;  3Q2H A;  1XFW A;  1A86 A;  4GQL A;  4XCT A;  4XM8 A;  1G49 A;  5I0L A;  1MMR A;  1BKC A;  2X7M A;  1HFC A;  5BPA A; 
#chains in the Genus database with same CATH topology
 5D3C A;  2OZR A;  4R3V A;  1PWP A;  3F1A A;  4JQG A;  4PKW A;  4J4M A;  2FV5 A;  5D2B A;  4A3W A;  1RM8 A;  3K7N A;  4XM6 A;  5B5P A;  2CKI A;  2XS3 A;  1CGF A;  1Y0V A;  3RTT A;  1JK3 A;  5I43 A;  1JH1 A;  2X3B A;  2JNP A;  4I35 A;  1G4K A;  3DPF A;  3LEA A;  5CXA A;  2W0D A;  4L7A A;  830C A;  2JIH A;  1OS9 A;  1IAB A;  3MA2 A;  1JAQ A;  1KUI A;  1OM6 A;  1D8F A;  4I03 A;  1R1I A;  3AYU A;  2XS4 A;  1BUV M;  3LUN A;  4PKU A;  5L79 A;  1FM1 A;  2D1N A;  3P1V A;  1GXD A;  4XM7 A;  4PKT A;  1JAN A;  2KRJ A;  2MZH A;  3DL1 A;  3LJT A;  1PWW A;  4ON1 A;  3F19 A;  3ZUK A;  2AYK A;  1GE6 A;  4H1Q A;  3WV3 A;  2POJ A;  1D8M A;  3AIG A;  3NX7 A;  3F17 A;  1SMP A;  2MZE A;  1YOU A;  1JIZ A;  4ILW D;  1CGL A;  1UEA A;  2AIG P;  1ND1 A;  2X3A A;  2TCL A;  3USN A;  2MZI A;  3KEJ A;  1JIW P;  1XUC A;  3LKA A;  1UTZ A;  3LUM A;  3V96 B;  3I7I A;  3DPE A;  2OXU A;  1BKC I;  2JT5 A;  1J7N A;  4AYK A;  1XUR A;  1R55 A;  4WKE A;  1CK7 A;  1B3D A;  4Q1L A;  4WZV A;  3HDA P;  4JIJ A;  3P24 A;  2WO8 A;  2PJT A;  1SAT A;  1AF0 A;  2O3E A;  3L0V A;  1ZTQ A;  1MMB A;  1SRP A;  2WO9 A;  2Z2D A;  2J83 A;  4JPA A;  2W14 A;  1DMT A;  5CUH A;  3LQB A;  4H30 A;  1G12 A;  3TVC A;  1DTH A;  1G05 A;  2RJQ A;  3GBO A;  2WOA A;  3LQ0 A;  1XFY A;  1OM7 A;  1Z3J A;  4WF6 A;  1QJJ A;  3L0T A;  4GR3 A;  4GR8 A;  4G0D A;  1Y93 A;  3LJZ A;  3BA0 A;  1IAE A;  1RMZ A;  3TT4 A;  4L19 A;  4PKS A;  1B8Y A;  3RTS A;  5BOT A;  4FU4 A;  1OO9 A;  4GR0 A;  2W13 A;  4H76 A;  1UMS A;  3F15 A;  4H2E A;  3WV2 A;  4FVL A;  5LAB A;  4GUY A;  3ELM A;  1XUD A;  2JSD A;  3HB2 P;  1MMQ A;  3HBU P;  1D7X A;  1S4B P;  2A8H A;  3O2X A;  3EDZ A;  3KEK A;  2K2G A;  3ZXH A;  3DSL A;  1CXV A;  1HTD A;  3KWV C;  1MNC A;  1I76 A;  2JT6 A;  4JP4 A;  1PWV A;  5I3M A;  4G9L A;  2W12 A;  3EHY A;  2CLT A;  1C3I A;  3LJG A;  1R1H A;  3LGP A;  3OHL A;  1GE5 A;  1ROS A;  1I1I P;  1XFX A;  1JAO A;  4GF1 A;  4AIG A;  1ATL A;  4DV8 A;  1R54 A;  1XAX A;  3ZVS A;  3DNG A;  3OHO A;  2V4B A;  3HY9 A;  3O64 A;  3LIL A;  3DTK A;  1GKC A;  3AYK A;  2L0R A;  1YCM A;  1OM8 A;  1KUG A;  2OXW A;  2OY2 A;  2YIG A;  1Q3A A;  1GO7 P;  3KEC A;  1QIB A;  1QIA A;  1H71 P;  2ERQ A;  1GE7 A;  1QJI A;  1CIZ A;  1O0Q A;  1D5J A;  4IN9 A;  1MMP A;  3F18 A;  3KME A;  3EWJ A;  2YB9 A;  3B92 A;  2Y6C A;  2OXZ A;  4A7B A;  3LE9 A;  4PKV A;  3B2Z A;  4DPE A;  2OW0 A;  4DD8 A;  1QIC A;  3TSK A;  3U1R A;  3UVC A;  1KUK A;  1K7Q A;  1PWU A;  2OVZ A;  1BIW A;  1YP1 A;  1EUB A;  2E2D A;  1ZP5 A;  3Q2G A;  1SU3 A;  2ERP A;  4PKQ A;  4CTH A;  3EHX A;  3LK8 A;  5I2Z A;  2DW2 A;  1CGE A;  4IUW A;  1KAP P;  1AYK A;  1EAK A;  1O0T A;  3EDH A;  1SLM A;  2I47 A;  5H8X A;  4HMA A;  3KMC A;  3HDB A;  3LIR A;  3DWB A;  4AUO A;  1ZVX A;  1EB6 A;  2D1O A;  2USN A;  4PKR A;  3B8Z A;  4WK7 A;  2W15 A;  1HFS A;  3CKI A;  2HU6 A;  1OZ9 A;  1AKL A;  2YUF A;  1TVI A;  2SRT A;  1UMT A;  2ERO A;  4DF9 A;  1L6J A;  3VTG A;  3EDI A;  1USN A;  2Y6D A;  4H82 A;  1OMJ A;  4H49 A;  5JMY A;  1OS2 A;  1HOV A;  1R1J A;  1C8T A;  5D1T A;  2OW1 A;  1BKC E;  1CAQ A;  4HX3 A;  3TS4 A;  2OW9 A;  2E3X A;  2OY4 A;  4ZR5 A;  1KBC A;  1G9K A;  3KHI A;  4AXQ A;  1FBL A;  4L6T A;  456C A;  1IAC A;  4L63 A;  4EFS A;  2OW2 A;  5D7W A;  5I4O A;  5CZM A;  1I73 A;  1XFZ A;  1WNI A;  1C7K A;  1BSW A;  1XFV A;  1Y8J A;  3EDG A;  1AST A;  1GKD A;  1UTT A;  2MLR A;  2N8R A;  1KUH A;  1JAP A;  5B5O A;  5I12 A;  1XFU A;  1BM6 A;  1HV5 A;  3DTE A;  5D1U A;  1K7I A;  2OVX A;  2DDF A;  4H3X A;  3I7G A;  1KUF A;  1ZXC A;  2RJP A;  2QPJ A;  1JKY A;  2DW0 A;  3HY7 A;  3WV1 A;  1BUD A;  5D1S A;  3K7L A;  1ZXV A;  1PWQ A;  1BZS A;  2DDY A;  4WKI A;  4FXY P;  4H84 A;  3N2V A;  3HYG A;  1IAD A;  1XM5 A;  5BOY A;  1CQR A;  2MLS A;  2X3C A;  1BQQ M;  1GO8 P;  1QUA A;  3G5C A;  1YQY A;  3LIK A;  4FXQ A;  2DW1 A;  2FV9 A;  5L7F A;  1HY7 A;  3KRY A;  3SHI A;  4QKZ A;  1BQO A;  3VI1 A;  2K9C A;  3E8R A;  1JJ9 A;  1IAA A;  4IJO A;  2O36 A;  2J0T A;  3G42 A;  1K7G A;  4XBH A;  966C A;  2OI0 A;  1IAG A;  4GWN A;  4GWM A;  3DTI A;  3F16 A;  3LMC A;  1SLN A;  1FLS A;  4JA1 A;  1A85 A;  1ZS0 A;  3N2U A;  3HBV P;  3Q2H A;  1XFW A;  1A86 A;  4GQL A;  4XCT A;  4XM8 A;  1G49 A;  5I0L A;  1MMR A;  1BKC A;  2X7M A;  1HFC A;  5BPA A; 
#chains in the Genus database with same CATH homology
 5D3C A;  2OZR A;  4R3V A;  1PWP A;  3F1A A;  4JQG A;  4PKW A;  4J4M A;  2FV5 A;  5D2B A;  4A3W A;  1RM8 A;  3K7N A;  4XM6 A;  5B5P A;  2CKI A;  2XS3 A;  1CGF A;  1Y0V A;  3RTT A;  1JK3 A;  5I43 A;  1JH1 A;  2X3B A;  2JNP A;  4I35 A;  1G4K A;  3DPF A;  3LEA A;  5CXA A;  2W0D A;  4L7A A;  830C A;  2JIH A;  1OS9 A;  1IAB A;  3MA2 A;  1JAQ A;  1KUI A;  1OM6 A;  1D8F A;  4I03 A;  1R1I A;  3AYU A;  2XS4 A;  1BUV M;  3LUN A;  4PKU A;  5L79 A;  1FM1 A;  2D1N A;  3P1V A;  1GXD A;  4XM7 A;  4PKT A;  1JAN A;  2KRJ A;  2MZH A;  3DL1 A;  3LJT A;  1PWW A;  4ON1 A;  3F19 A;  3ZUK A;  2AYK A;  1GE6 A;  4H1Q A;  3WV3 A;  2POJ A;  1D8M A;  3AIG A;  3NX7 A;  3F17 A;  1SMP A;  2MZE A;  1YOU A;  1JIZ A;  4ILW D;  1CGL A;  1UEA A;  2AIG P;  1ND1 A;  2X3A A;  2TCL A;  3USN A;  2MZI A;  3KEJ A;  1JIW P;  1XUC A;  3LKA A;  1UTZ A;  3LUM A;  3V96 B;  3I7I A;  3DPE A;  2OXU A;  1BKC I;  2JT5 A;  1J7N A;  4AYK A;  1XUR A;  1R55 A;  4WKE A;  1CK7 A;  1B3D A;  4Q1L A;  4WZV A;  3HDA P;  4JIJ A;  3P24 A;  2WO8 A;  2PJT A;  1SAT A;  1AF0 A;  2O3E A;  3L0V A;  1ZTQ A;  1MMB A;  1SRP A;  2WO9 A;  2Z2D A;  2J83 A;  4JPA A;  2W14 A;  1DMT A;  5CUH A;  3LQB A;  4H30 A;  1G12 A;  3TVC A;  1DTH A;  1G05 A;  2RJQ A;  3GBO A;  2WOA A;  3LQ0 A;  1XFY A;  1OM7 A;  1Z3J A;  4WF6 A;  1QJJ A;  3L0T A;  4GR3 A;  4GR8 A;  4G0D A;  1Y93 A;  3LJZ A;  3BA0 A;  1IAE A;  1RMZ A;  3TT4 A;  4L19 A;  4PKS A;  1B8Y A;  3RTS A;  5BOT A;  4FU4 A;  1OO9 A;  4GR0 A;  2W13 A;  4H76 A;  1UMS A;  3F15 A;  4H2E A;  3WV2 A;  4FVL A;  5LAB A;  4GUY A;  3ELM A;  1XUD A;  2JSD A;  3HB2 P;  1MMQ A;  3HBU P;  1D7X A;  1S4B P;  2A8H A;  3O2X A;  3EDZ A;  3KEK A;  2K2G A;  3ZXH A;  3DSL A;  1CXV A;  1HTD A;  3KWV C;  1MNC A;  1I76 A;  2JT6 A;  4JP4 A;  1PWV A;  5I3M A;  4G9L A;  2W12 A;  3EHY A;  2CLT A;  1C3I A;  3LJG A;  1R1H A;  3LGP A;  3OHL A;  1GE5 A;  1ROS A;  1I1I P;  1XFX A;  1JAO A;  4GF1 A;  4AIG A;  1ATL A;  4DV8 A;  1R54 A;  3ZVS A;  3DNG A;  3OHO A;  2V4B A;  3HY9 A;  3O64 A;  3LIL A;  3DTK A;  1GKC A;  3AYK A;  2L0R A;  1YCM A;  1OM8 A;  1KUG A;  2OXW A;  2OY2 A;  2YIG A;  1Q3A A;  1GO7 P;  3KEC A;  1QIB A;  1QIA A;  1H71 P;  2ERQ A;  1GE7 A;  1QJI A;  1CIZ A;  1O0Q A;  1D5J A;  4IN9 A;  1MMP A;  3F18 A;  3KME A;  3EWJ A;  2YB9 A;  3B92 A;  2Y6C A;  2OXZ A;  4A7B A;  3LE9 A;  4PKV A;  3B2Z A;  4DPE A;  2OW0 A;  4DD8 A;  1QIC A;  3TSK A;  3U1R A;  3UVC A;  1KUK A;  1K7Q A;  1PWU A;  2OVZ A;  1BIW A;  1YP1 A;  1EUB A;  2E2D A;  1ZP5 A;  3Q2G A;  1SU3 A;  2ERP A;  4PKQ A;  4CTH A;  3EHX A;  3LK8 A;  5I2Z A;  2DW2 A;  1CGE A;  4IUW A;  1KAP P;  1AYK A;  1EAK A;  1O0T A;  3EDH A;  1SLM A;  2I47 A;  5H8X A;  4HMA A;  3KMC A;  3HDB A;  3LIR A;  3DWB A;  4AUO A;  1ZVX A;  1EB6 A;  2D1O A;  2USN A;  4PKR A;  3B8Z A;  4WK7 A;  2W15 A;  1HFS A;  3CKI A;  2HU6 A;  1AKL A;  2YUF A;  2SRT A;  1UMT A;  2ERO A;  4DF9 A;  1L6J A;  3VTG A;  3EDI A;  1USN A;  2Y6D A;  4H82 A;  1OMJ A;  4H49 A;  5JMY A;  1OS2 A;  1HOV A;  1R1J A;  1C8T A;  5D1T A;  2OW1 A;  1BKC E;  1CAQ A;  4HX3 A;  3TS4 A;  2OW9 A;  2E3X A;  2OY4 A;  4ZR5 A;  1KBC A;  1G9K A;  3KHI A;  4AXQ A;  1FBL A;  4L6T A;  456C A;  1IAC A;  4L63 A;  4EFS A;  2OW2 A;  5D7W A;  5I4O A;  5CZM A;  1I73 A;  1XFZ A;  1WNI A;  1C7K A;  1BSW A;  1XFV A;  1Y8J A;  3EDG A;  1AST A;  1GKD A;  1UTT A;  2MLR A;  2N8R A;  1KUH A;  1JAP A;  5B5O A;  5I12 A;  1XFU A;  1BM6 A;  1HV5 A;  3DTE A;  5D1U A;  1K7I A;  2OVX A;  2DDF A;  4H3X A;  3I7G A;  1KUF A;  1ZXC A;  2RJP A;  2QPJ A;  1JKY A;  2DW0 A;  3HY7 A;  3WV1 A;  1BUD A;  5D1S A;  3K7L A;  1ZXV A;  1PWQ A;  1BZS A;  2DDY A;  4WKI A;  4FXY P;  4H84 A;  3N2V A;  3HYG A;  1IAD A;  5BOY A;  1CQR A;  2MLS A;  2X3C A;  1BQQ M;  1GO8 P;  1QUA A;  3G5C A;  1YQY A;  3LIK A;  4FXQ A;  2DW1 A;  2FV9 A;  5L7F A;  1HY7 A;  3KRY A;  3SHI A;  4QKZ A;  1BQO A;  3VI1 A;  2K9C A;  3E8R A;  1JJ9 A;  1IAA A;  4IJO A;  2O36 A;  2J0T A;  3G42 A;  1K7G A;  4XBH A;  966C A;  2OI0 A;  1IAG A;  4GWN A;  4GWM A;  3DTI A;  3F16 A;  3LMC A;  1SLN A;  1FLS A;  4JA1 A;  1A85 A;  1ZS0 A;  3N2U A;  3HBV P;  3Q2H A;  1XFW A;  1A86 A;  4GQL A;  4XCT A;  4XM8 A;  1G49 A;  5I0L A;  1MMR A;  1BKC A;  2X7M A;  1HFC A;  5BPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...