4AIGA

Adamalysin ii with phosphonate inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
NLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLNSFGEWRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metalloendopeptidase
molecule keywords ADAMALYSIN II
publication title 2 angstrom X-ray structure of adamalysin II complexed with a peptide phosphonate inhibitor adopting a retro-binding mode.
pubmed doi rcsb
total genus 73
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.46: Adamalysin.
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4aigA00
1GO8P 1AYKA 3DSLA 1Z3JA 2D1OA 3EHXA 3F19A 5L79A 1R54A 1BIWA 2OI0A 1KUFA 1GE5A 2DDYA 1HY7A 3KEJA 4AXQA 3HYGA 4DPEA 2Z2DA 2HU6A 3I7GA 1QJIA 3AYKA 1H71P 1MMQA 4FXYP 3LGPA 2OXWA 1OM6A 2DDFA 2POJA 1HV5A 2CLTA 3EHYA 1I73A 4XM6A 1UEAA 3LUNA 4GQLA 2A8HA 2W12A 1R55A 4PKRA 2JSDA 1R1IA 3USNA 3N2VA 1G05A 1MMBA 1MMRA 2OY4A 1QUAA 3P24A 1B8YA 4H76A 1UMTA 4IJOA 1R1HA 1KUIA 4GR8A 4Q1LA 4H2EA 3HDAP 1A85A 4GWMA 1RM8A 3LQBA 1MMPA 1AKLA 3HB2P 1OS9A 1JK3A 2FV9A 3KEKA 3HBVP 2QPJA 4EFSA 5CZMA 1OM7A 1B3DA 2MLSA 3K7NA 3N2UA 3KRYA 4G0DA 3VI1A 5D1SA 2KRJA 3B8ZA 3TS4A 2WO8A 3TVCA 1QIAA 1K7QA 5LABA 2L0RA 3DL1A 3LIRA 2XS3A 4WKEA 1QICA 1HOVA 1ASTA 1S4BP 3G5CA 5D7WA 4WK7A 3K7LA 1DTHA 1IAGA 3EDGA 3KMCA 3KHIA 4A7BA 2DW0A 4H3XA 4GUYA 3B2ZA 1SU3A 2OW1A 3DWBA 2RJQA 1K7IA 1CGFA 1UTTA 2ERQA 3RTSA 2OY2A 3F18A 2X3BA 5I4OA 1SATA 4ON1A 3LE9A 1I1IP 1OM8A 1UMSA 4FXQA 3B92A 1YOUA 4GF1A 4FU4A 5B5OA 2ERPA 5D3CA 1JAPA 2AYKA 1I76A 3ZVSA 2K2GA 1GXDA 1K7GA 1SLNA 2JT5A 2FV5A 1CK7A 1JIWP 4GR3A 2W13A 3I7IA 3Q2GA 1AF0A 2MZEA 2W14A 1CIZA 3DNGA 1YQYA 3LUMA 4L6TA 1GE6A 2X7MA 2OXUA 1OO9A 1OS2A 1CQRA 1JAQA 3LK8A 3LMCA 1ZXCA 5D1TA 1L6JA 3OHOA 4H49A 1D8MA 3EDHA 3WV1A 4I35A 2W15A 4I03A 5I12A 4WZVA 1JANA 3EDZA 4AYKA 1JH1A 1KBCA 2USNA 4JA1A 1FLSA 4IUWA 3F17A 2AIGP 3P1VA 1J7NA 2DW2A 1BKCA 3MA2A 5BOYA 5BPAA 4HMAA 4JIJA 2O3EA 4CTHA 1MNCA 4GR0A 4H84A 1BQQM 1RMZA 3SHIA 1XFWA 1GKCA 1ND1A 1O0TA 3EDIA 4QKZA 4XBHA 4JQGA 5I3MA 4ZR5A 1BM6A 1FBLA 1BZSA 1IAAA 2X3CA 4H82A 2OW9A 4IN9A 2I47A 1ZP5A 1HTDA 1PWUA 1YCMA 3U1RA 4PKTA 1SRPA 4DF9A 1JJ9A 2OXZA 1ZXVA 456CA 2OZRA 2JNPA 2YB9A 1PWQA 5CUHA 1PWVA 1CGLA 1USNA 4PKVA 4PKSA 3V96B 2D1NA 1CAQA 4L63A 2EROA 1BUVM 4WKIA 3ELMA 3AIGA 1GO7P 3HY7A 1QIBA 2E3XA 1SLMA 1KUHA 3LILA 1IAEA 4L19A 4WF6A 1G4KA 3KECA 5H8XA 5L7FA 1HFSA 1UTZA 1BKCI 1C7KA 2XS4A 5B5PA 1JIZA 1XUDA 4FVLA 1CXVA 2O36A 4JPAA 1G49A 1XFVA 2TCLA 3HDBA 4XM7A 2MLRA 3O2XA 4AUOA 1XURA 1XFUA 2J83A 3L0VA 3LIKA 1C3IA 3CKIA 1GE7A 1JAOA 1XFYA 1ATLA 3E8RA 1G9KA 1D5JA 2SRTA 2Y6CA 5CXAA 3ZUKA 3LJGA 5I2ZA 1XFZA 3DPEA 1IADA 2PJTA 1GKDA 2MZIA 3RTTA 1JKYA 2K9CA 1R1JA 3LJTA 3KWVC 3LJZA 4H30A 1EB6A 1PWWA 4ILWD 1BKCE 1KAPP 5D2BA 1OMJA 2WOAA 3HY9A 4H1QA 2CKIA 2OW2A 2V4BA 3TT4A 3TSKA 1QJJA 1KUGA 1D7XA 4XCTA 4XM8A 3Q2HA 1EUBA 3F1AA 3LEAA 1WNIA 2MZHA 3WV3A 4J4MA 2JT6A 3BA0A 1ZS0A 3F16A 3WV2A 2J0TA 5I43A 1IABA 1Y8JA 1Q3AA 2OVXA 1ZTQA 2X3AA 3UVCA 3OHLA 1BQOA 1HFCA 3AYUA 1C8TA 1Y0VA 4DV8A 4PKQA 2WO9A 966CA 1BUDA 5JMYA 1XFXA 1FM1A 4PKWA 1IACA 2Y6DA 3F15A 3ZXHA 2RJPA 1SMPA 1ROSA 3LKAA 4GWNA 1O0QA 3L0TA 5D1UA 4R3VA 2W0DA 1DMTA 2JIHA 1G12A 1D8FA 4PKUA 4DD8A 3DPFA 3GBOA 4A3WA 1EAKA 2OW0A 3O64A 1KUKA 4JP4A 4G9LA 1BSWA 1CGEA 5I0LA 5BOTA 1ZVXA 3HBUP 3LQ0A 4HX3A 1YP1A 3EWJA 1Y93A 3NX7A 830CA 1PWPA 2OVZA 1XUCA 2DW1A 2E2DA 3KMEA 3VTGA 1A86A 4AIGA 3G42A 2YIGA 2N8RA
chains in the Genus database with same CATH superfamily
1GO8P 1AYKA 3DSLA 1Z3JA 2D1OA 3EHXA 3F19A 5L79A 1R54A 1BIWA 2OI0A 1KUFA 1GE5A 2DDYA 1HY7A 3KEJA 4AXQA 3HYGA 4DPEA 2Z2DA 2HU6A 3I7GA 1QJIA 3AYKA 1H71P 1MMQA 4FXYP 3LGPA 2OXWA 1OM6A 2DDFA 2POJA 1HV5A 2CLTA 3EHYA 1I73A 4XM6A 1UEAA 3LUNA 4GQLA 2A8HA 2W12A 1R55A 4PKRA 2JSDA 1R1IA 3USNA 3N2VA 1G05A 1MMBA 1MMRA 2OY4A 1QUAA 3P24A 1B8YA 4H76A 1UMTA 4IJOA 1R1HA 1KUIA 4GR8A 4Q1LA 4H2EA 3HDAP 1XM5A 1A85A 4GWMA 1RM8A 3LQBA 1MMPA 1AKLA 3HB2P 1OS9A 1JK3A 2FV9A 3KEKA 3HBVP 2QPJA 4EFSA 5CZMA 1OM7A 1B3DA 2MLSA 3K7NA 3N2UA 3KRYA 4G0DA 3VI1A 5D1SA 2KRJA 3B8ZA 3TS4A 2WO8A 3TVCA 1QIAA 1K7QA 5LABA 2L0RA 3DL1A 3LIRA 2XS3A 4WKEA 1QICA 1HOVA 1ASTA 3DTIA 1S4BP 3G5CA 5D7WA 4WK7A 3K7LA 1DTHA 1IAGA 3EDGA 3KMCA 3KHIA 4A7BA 2DW0A 4H3XA 4GUYA 3B2ZA 1SU3A 2OW1A 3DWBA 2RJQA 1K7IA 1CGFA 2YUFA 1UTTA 2ERQA 3RTSA 2OY2A 3F18A 2X3BA 5I4OA 1SATA 4ON1A 3LE9A 1I1IP 1OM8A 1UMSA 4FXQA 3B92A 1YOUA 4GF1A 4FU4A 5B5OA 3DTEA 2ERPA 5D3CA 1JAPA 2AYKA 1I76A 3ZVSA 2K2GA 1GXDA 1K7GA 1SLNA 2JT5A 2FV5A 1CK7A 1JIWP 4GR3A 2W13A 3I7IA 3Q2GA 1AF0A 2MZEA 2W14A 1CIZA 3DNGA 1YQYA 3LUMA 4L6TA 1GE6A 2X7MA 2OXUA 1OO9A 1OS2A 1CQRA 1JAQA 3LK8A 3LMCA 1ZXCA 5D1TA 1L6JA 3OHOA 4H49A 1D8MA 3EDHA 3WV1A 4I35A 2W15A 4I03A 5I12A 4WZVA 1JANA 3EDZA 4AYKA 1JH1A 1KBCA 2USNA 4JA1A 1FLSA 4IUWA 3F17A 2AIGP 3P1VA 1J7NA 2DW2A 1BKCA 3MA2A 5BOYA 5BPAA 4HMAA 4JIJA 2O3EA 4CTHA 1MNCA 4GR0A 4H84A 1BQQM 1RMZA 3SHIA 1XFWA 1GKCA 1ND1A 1O0TA 3EDIA 4QKZA 4XBHA 4JQGA 5I3MA 4ZR5A 1BM6A 1FBLA 1BZSA 1IAAA 2X3CA 4H82A 2OW9A 4IN9A 2I47A 1ZP5A 1HTDA 1PWUA 1YCMA 3U1RA 4PKTA 1SRPA 4DF9A 1JJ9A 2OXZA 1ZXVA 456CA 2OZRA 2JNPA 2YB9A 1PWQA 5CUHA 1PWVA 1CGLA 1USNA 4PKVA 4PKSA 1XAXA 3V96B 2D1NA 1CAQA 4L63A 2EROA 1BUVM 4WKIA 3ELMA 3AIGA 1GO7P 3HY7A 1QIBA 2E3XA 1SLMA 1KUHA 3LILA 1IAEA 4L19A 4WF6A 1G4KA 3KECA 5H8XA 5L7FA 1HFSA 1UTZA 1BKCI 1C7KA 2XS4A 5B5PA 1JIZA 1XUDA 4FVLA 1CXVA 2O36A 4JPAA 1G49A 1XFVA 2TCLA 3HDBA 4XM7A 2MLRA 3O2XA 4AUOA 1XURA 1XFUA 2J83A 3L0VA 3LIKA 1C3IA 3CKIA 1GE7A 1JAOA 1XFYA 1ATLA 3E8RA 1G9KA 1D5JA 2SRTA 2Y6CA 5CXAA 3ZUKA 3LJGA 5I2ZA 1XFZA 3DPEA 1OZ9A 1IADA 2PJTA 1GKDA 2MZIA 3RTTA 3DTKA 1JKYA 2K9CA 1R1JA 3LJTA 3KWVC 3LJZA 4H30A 1EB6A 1PWWA 4ILWD 1BKCE 1KAPP 5D2BA 1OMJA 2WOAA 3HY9A 4H1QA 2CKIA 2OW2A 2V4BA 3TT4A 3TSKA 1QJJA 1KUGA 1D7XA 4XCTA 4XM8A 3Q2HA 1EUBA 3F1AA 3LEAA 1WNIA 2MZHA 3WV3A 4J4MA 2JT6A 3BA0A 1ZS0A 3F16A 3WV2A 2J0TA 5I43A 1IABA 1Y8JA 1Q3AA 2OVXA 1ZTQA 2X3AA 1TVIA 3UVCA 3OHLA 1BQOA 1HFCA 3AYUA 1C8TA 1Y0VA 4DV8A 4PKQA 2WO9A 966CA 1BUDA 5JMYA 1XFXA 1FM1A 4PKWA 1IACA 2Y6DA 3F15A 3ZXHA 2RJPA 1SMPA 1ROSA 3LKAA 4GWNA 1O0QA 3L0TA 5D1UA 4L7AA 4R3VA 2W0DA 1DMTA 2JIHA 1G12A 1D8FA 4PKUA 4DD8A 3DPFA 3GBOA 4A3WA 1EAKA 2OW0A 3O64A 1KUKA 4JP4A 4G9LA 1BSWA 1CGEA 5I0LA 5BOTA 1ZVXA 3HBUP 3LQ0A 4HX3A 1YP1A 3EWJA 1Y93A 3NX7A 830CA 1PWPA 2OVZA 1XUCA 2DW1A 2E2DA 3KMEA 3VTGA 1A86A 4AIGA 3G42A 2YIGA 2N8RA
chains in the Genus database with same CATH topology
1GO8P 1AYKA 3DSLA 1Z3JA 2D1OA 3EHXA 3F19A 5L79A 1R54A 1BIWA 2OI0A 1KUFA 1GE5A 2DDYA 1HY7A 3KEJA 4AXQA 3HYGA 4DPEA 2Z2DA 2HU6A 3I7GA 1QJIA 3AYKA 1H71P 1MMQA 4FXYP 3LGPA 2OXWA 1OM6A 2DDFA 2POJA 1HV5A 2CLTA 3EHYA 1I73A 4XM6A 1UEAA 3LUNA 4GQLA 2A8HA 2W12A 1R55A 4PKRA 2JSDA 1R1IA 3USNA 3N2VA 1G05A 1MMBA 1MMRA 2OY4A 1QUAA 3P24A 1B8YA 4H76A 1UMTA 4IJOA 1R1HA 1KUIA 4GR8A 4Q1LA 4H2EA 3HDAP 1A85A 4GWMA 1RM8A 3LQBA 1MMPA 1AKLA 3HB2P 1OS9A 1JK3A 2FV9A 3KEKA 3HBVP 2QPJA 4EFSA 5CZMA 1OM7A 1B3DA 2MLSA 3K7NA 3N2UA 3KRYA 4G0DA 3VI1A 5D1SA 2KRJA 3B8ZA 3TS4A 2WO8A 3TVCA 1QIAA 1K7QA 5LABA 2L0RA 3DL1A 3LIRA 2XS3A 4WKEA 1QICA 1HOVA 1ASTA 3DTIA 1S4BP 3G5CA 5D7WA 4WK7A 3K7LA 1DTHA 1IAGA 3EDGA 3KMCA 3KHIA 4A7BA 2DW0A 4H3XA 4GUYA 3B2ZA 1SU3A 2OW1A 3DWBA 2RJQA 1K7IA 1CGFA 2YUFA 1UTTA 2ERQA 3RTSA 2OY2A 3F18A 2X3BA 5I4OA 1SATA 4ON1A 3LE9A 1I1IP 1OM8A 1UMSA 4FXQA 3B92A 1YOUA 4GF1A 4FU4A 5B5OA 3DTEA 2ERPA 5D3CA 1JAPA 2AYKA 1I76A 3ZVSA 2K2GA 1GXDA 1K7GA 1SLNA 2JT5A 2FV5A 1CK7A 1JIWP 4GR3A 2W13A 3I7IA 3Q2GA 1AF0A 2MZEA 2W14A 1CIZA 3DNGA 1YQYA 3LUMA 4L6TA 1GE6A 2X7MA 2OXUA 1OO9A 1OS2A 1CQRA 1JAQA 3LK8A 3LMCA 1ZXCA 5D1TA 1L6JA 3OHOA 4H49A 1D8MA 3EDHA 3WV1A 4I35A 2W15A 4I03A 5I12A 4WZVA 1JANA 3EDZA 4AYKA 1JH1A 1KBCA 2USNA 4JA1A 1FLSA 4IUWA 3F17A 2AIGP 3P1VA 1J7NA 2DW2A 1BKCA 3MA2A 5BOYA 5BPAA 4HMAA 4JIJA 2O3EA 4CTHA 1MNCA 4GR0A 4H84A 1BQQM 1RMZA 3SHIA 1XFWA 1GKCA 1ND1A 1O0TA 3EDIA 4QKZA 4XBHA 4JQGA 5I3MA 4ZR5A 1BM6A 1FBLA 1BZSA 1IAAA 2X3CA 4H82A 2OW9A 4IN9A 2I47A 1ZP5A 1HTDA 1PWUA 1YCMA 3U1RA 4PKTA 1SRPA 4DF9A 1JJ9A 2OXZA 1ZXVA 456CA 2OZRA 2JNPA 2YB9A 1PWQA 5CUHA 1PWVA 1CGLA 1USNA 4PKVA 4PKSA 3V96B 2D1NA 1CAQA 4L63A 2EROA 1BUVM 4WKIA 3ELMA 3AIGA 1GO7P 3HY7A 1QIBA 2E3XA 1SLMA 1KUHA 3LILA 1IAEA 4L19A 4WF6A 1G4KA 3KECA 5H8XA 5L7FA 1HFSA 1UTZA 1BKCI 1C7KA 2XS4A 5B5PA 1JIZA 1XUDA 4FVLA 1CXVA 2O36A 4JPAA 1G49A 1XFVA 2TCLA 3HDBA 4XM7A 2MLRA 3O2XA 4AUOA 1XURA 1XFUA 2J83A 3L0VA 3LIKA 1C3IA 3CKIA 1GE7A 1JAOA 1XFYA 1ATLA 3E8RA 1G9KA 1D5JA 2SRTA 2Y6CA 5CXAA 3ZUKA 3LJGA 5I2ZA 1XFZA 3DPEA 1IADA 2PJTA 1GKDA 2MZIA 3RTTA 3DTKA 1JKYA 2K9CA 1R1JA 3LJTA 3KWVC 3LJZA 4H30A 1EB6A 1PWWA 4ILWD 1BKCE 1KAPP 5D2BA 1OMJA 2WOAA 3HY9A 4H1QA 2CKIA 2OW2A 2V4BA 3TT4A 3TSKA 1QJJA 1KUGA 1D7XA 4XCTA 4XM8A 3Q2HA 1EUBA 3F1AA 3LEAA 1WNIA 2MZHA 3WV3A 4J4MA 2JT6A 3BA0A 1ZS0A 3F16A 3WV2A 2J0TA 5I43A 1IABA 1Y8JA 1Q3AA 2OVXA 1ZTQA 2X3AA 3UVCA 3OHLA 1BQOA 1HFCA 3AYUA 1C8TA 1Y0VA 4DV8A 4PKQA 2WO9A 966CA 1BUDA 5JMYA 1XFXA 1FM1A 4PKWA 1IACA 2Y6DA 3F15A 3ZXHA 2RJPA 1SMPA 1ROSA 3LKAA 4GWNA 1O0QA 3L0TA 5D1UA 4L7AA 4R3VA 2W0DA 1DMTA 2JIHA 1G12A 1D8FA 4PKUA 4DD8A 3DPFA 3GBOA 4A3WA 1EAKA 2OW0A 3O64A 1KUKA 4JP4A 4G9LA 1BSWA 1CGEA 5I0LA 5BOTA 1ZVXA 3HBUP 3LQ0A 4HX3A 1YP1A 3EWJA 1Y93A 3NX7A 830CA 1PWPA 2OVZA 1XUCA 2DW1A 2E2DA 3KMEA 3VTGA 1A86A 4AIGA 3G42A 2YIGA 2N8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO8 P;  1AYK A;  3DSL A;  1Z3J A;  2D1O A;  3EHX A;  3F19 A;  5L79 A;  1R54 A;  1BIW A;  2OI0 A;  1KUF A;  1GE5 A;  2DDY A;  1HY7 A;  3KEJ A;  4AXQ A;  3HYG A;  4DPE A;  2Z2D A;  2HU6 A;  3I7G A;  1QJI A;  3AYK A;  1H71 P;  1MMQ A;  4FXY P;  3LGP A;  2OXW A;  1OM6 A;  2DDF A;  2POJ A;  1HV5 A;  2CLT A;  3EHY A;  1I73 A;  4XM6 A;  1UEA A;  3LUN A;  4GQL A;  2A8H A;  2W12 A;  1R55 A;  4PKR A;  2JSD A;  1R1I A;  3USN A;  3N2V A;  1G05 A;  1MMB A;  1MMR A;  2OY4 A;  1QUA A;  3P24 A;  1B8Y A;  4H76 A;  1UMT A;  4IJO A;  1R1H A;  1KUI A;  4GR8 A;  4Q1L A;  4H2E A;  3HDA P;  1A85 A;  4GWM A;  1RM8 A;  3LQB A;  1MMP A;  1AKL A;  3HB2 P;  1OS9 A;  1JK3 A;  2FV9 A;  3KEK A;  3HBV P;  2QPJ A;  4EFS A;  5CZM A;  1OM7 A;  1B3D A;  2MLS A;  3K7N A;  3N2U A;  3KRY A;  4G0D A;  3VI1 A;  5D1S A;  2KRJ A;  3B8Z A;  3TS4 A;  2WO8 A;  3TVC A;  1QIA A;  1K7Q A;  5LAB A;  2L0R A;  3DL1 A;  3LIR A;  2XS3 A;  4WKE A;  1QIC A;  1HOV A;  1AST A;  1S4B P;  3G5C A;  5D7W A;  4WK7 A;  3K7L A;  1DTH A;  1IAG A;  3EDG A;  3KMC A;  3KHI A;  4A7B A;  2DW0 A;  4H3X A;  4GUY A;  3B2Z A;  1SU3 A;  2OW1 A;  3DWB A;  2RJQ A;  1K7I A;  1CGF A;  1UTT A;  2ERQ A;  3RTS A;  2OY2 A;  3F18 A;  2X3B A;  5I4O A;  1SAT A;  4ON1 A;  3LE9 A;  1I1I P;  1OM8 A;  1UMS A;  4FXQ A;  3B92 A;  1YOU A;  4GF1 A;  4FU4 A;  5B5O A;  2ERP A;  5D3C A;  1JAP A;  2AYK A;  1I76 A;  3ZVS A;  2K2G A;  1GXD A;  1K7G A;  1SLN A;  2JT5 A;  2FV5 A;  1CK7 A;  1JIW P;  4GR3 A;  2W13 A;  3I7I A;  3Q2G A;  1AF0 A;  2MZE A;  2W14 A;  1CIZ A;  3DNG A;  1YQY A;  3LUM A;  4L6T A;  1GE6 A;  2X7M A;  2OXU A;  1OO9 A;  1OS2 A;  1CQR A;  1JAQ A;  3LK8 A;  3LMC A;  1ZXC A;  5D1T A;  1L6J A;  3OHO A;  4H49 A;  1D8M A;  3EDH A;  3WV1 A;  4I35 A;  2W15 A;  4I03 A;  5I12 A;  4WZV A;  1JAN A;  3EDZ A;  4AYK A;  1JH1 A;  1KBC A;  2USN A;  4JA1 A;  1FLS A;  4IUW A;  3F17 A;  2AIG P;  3P1V A;  1J7N A;  2DW2 A;  1BKC A;  3MA2 A;  5BOY A;  5BPA A;  4HMA A;  4JIJ A;  2O3E A;  4CTH A;  1MNC A;  4GR0 A;  4H84 A;  1BQQ M;  1RMZ A;  3SHI A;  1XFW A;  1GKC A;  1ND1 A;  1O0T A;  3EDI A;  4QKZ A;  4XBH A;  4JQG A;  5I3M A;  4ZR5 A;  1BM6 A;  1FBL A;  1BZS A;  1IAA A;  2X3C A;  4H82 A;  2OW9 A;  4IN9 A;  2I47 A;  1ZP5 A;  1HTD A;  1PWU A;  1YCM A;  3U1R A;  4PKT A;  1SRP A;  4DF9 A;  1JJ9 A;  2OXZ A;  1ZXV A;  456C A;  2OZR A;  2JNP A;  2YB9 A;  1PWQ A;  5CUH A;  1PWV A;  1CGL A;  1USN A;  4PKV A;  4PKS A;  3V96 B;  2D1N A;  1CAQ A;  4L63 A;  2ERO A;  1BUV M;  4WKI A;  3ELM A;  3AIG A;  1GO7 P;  3HY7 A;  1QIB A;  2E3X A;  1SLM A;  1KUH A;  3LIL A;  1IAE A;  4L19 A;  4WF6 A;  1G4K A;  3KEC A;  5H8X A;  5L7F A;  1HFS A;  1UTZ A;  1BKC I;  1C7K A;  2XS4 A;  5B5P A;  1JIZ A;  1XUD A;  4FVL A;  1CXV A;  2O36 A;  4JPA A;  1G49 A;  1XFV A;  2TCL A;  3HDB A;  4XM7 A;  2MLR A;  3O2X A;  4AUO A;  1XUR A;  1XFU A;  2J83 A;  3L0V A;  3LIK A;  1C3I A;  3CKI A;  1GE7 A;  1JAO A;  1XFY A;  1ATL A;  3E8R A;  1G9K A;  1D5J A;  2SRT A;  2Y6C A;  5CXA A;  3ZUK A;  3LJG A;  5I2Z A;  1XFZ A;  3DPE A;  1IAD A;  2PJT A;  1GKD A;  2MZI A;  3RTT A;  1JKY A;  2K9C A;  1R1J A;  3LJT A;  3KWV C;  3LJZ A;  4H30 A;  1EB6 A;  1PWW A;  4ILW D;  1BKC E;  1KAP P;  5D2B A;  1OMJ A;  2WOA A;  3HY9 A;  4H1Q A;  2CKI A;  2OW2 A;  2V4B A;  3TT4 A;  3TSK A;  1QJJ A;  1KUG A;  1D7X A;  4XCT A;  4XM8 A;  3Q2H A;  1EUB A;  3F1A A;  3LEA A;  1WNI A;  2MZH A;  3WV3 A;  4J4M A;  2JT6 A;  3BA0 A;  1ZS0 A;  3F16 A;  3WV2 A;  2J0T A;  5I43 A;  1IAB A;  1Y8J A;  1Q3A A;  2OVX A;  1ZTQ A;  2X3A A;  3UVC A;  3OHL A;  1BQO A;  1HFC A;  3AYU A;  1C8T A;  1Y0V A;  4DV8 A;  4PKQ A;  2WO9 A;  966C A;  1BUD A;  5JMY A;  1XFX A;  1FM1 A;  4PKW A;  1IAC A;  2Y6D A;  3F15 A;  3ZXH A;  2RJP A;  1SMP A;  1ROS A;  3LKA A;  4GWN A;  1O0Q A;  3L0T A;  5D1U A;  4R3V A;  2W0D A;  1DMT A;  2JIH A;  1G12 A;  1D8F A;  4PKU A;  4DD8 A;  3DPF A;  3GBO A;  4A3W A;  1EAK A;  2OW0 A;  3O64 A;  1KUK A;  4JP4 A;  4G9L A;  1BSW A;  1CGE A;  5I0L A;  5BOT A;  1ZVX A;  3HBU P;  3LQ0 A;  4HX3 A;  1YP1 A;  3EWJ A;  1Y93 A;  3NX7 A;  830C A;  1PWP A;  2OVZ A;  1XUC A;  2DW1 A;  2E2D A;  3KME A;  3VTG A;  1A86 A;  4AIG A;  3G42 A;  2YIG A;  2N8R A; 
#chains in the Genus database with same CATH topology
 1GO8 P;  1AYK A;  3DSL A;  1Z3J A;  2D1O A;  3EHX A;  3F19 A;  5L79 A;  1R54 A;  1BIW A;  2OI0 A;  1KUF A;  1GE5 A;  2DDY A;  1HY7 A;  3KEJ A;  4AXQ A;  3HYG A;  4DPE A;  2Z2D A;  2HU6 A;  3I7G A;  1QJI A;  3AYK A;  1H71 P;  1MMQ A;  4FXY P;  3LGP A;  2OXW A;  1OM6 A;  2DDF A;  2POJ A;  1HV5 A;  2CLT A;  3EHY A;  1I73 A;  4XM6 A;  1UEA A;  3LUN A;  4GQL A;  2A8H A;  2W12 A;  1R55 A;  4PKR A;  2JSD A;  1R1I A;  3USN A;  3N2V A;  1G05 A;  1MMB A;  1MMR A;  2OY4 A;  1QUA A;  3P24 A;  1B8Y A;  4H76 A;  1UMT A;  4IJO A;  1R1H A;  1KUI A;  4GR8 A;  4Q1L A;  4H2E A;  3HDA P;  1XM5 A;  1A85 A;  4GWM A;  1RM8 A;  3LQB A;  1MMP A;  1AKL A;  3HB2 P;  1OS9 A;  1JK3 A;  2FV9 A;  3KEK A;  3HBV P;  2QPJ A;  4EFS A;  5CZM A;  1OM7 A;  1B3D A;  2MLS A;  3K7N A;  3N2U A;  3KRY A;  4G0D A;  3VI1 A;  5D1S A;  2KRJ A;  3B8Z A;  3TS4 A;  2WO8 A;  3TVC A;  1QIA A;  1K7Q A;  5LAB A;  2L0R A;  3DL1 A;  3LIR A;  2XS3 A;  4WKE A;  1QIC A;  1HOV A;  1AST A;  3DTI A;  1S4B P;  3G5C A;  5D7W A;  4WK7 A;  3K7L A;  1DTH A;  1IAG A;  3EDG A;  3KMC A;  3KHI A;  4A7B A;  2DW0 A;  4H3X A;  4GUY A;  3B2Z A;  1SU3 A;  2OW1 A;  3DWB A;  2RJQ A;  1K7I A;  1CGF A;  2YUF A;  1UTT A;  2ERQ A;  3RTS A;  2OY2 A;  3F18 A;  2X3B A;  5I4O A;  1SAT A;  4ON1 A;  3LE9 A;  1I1I P;  1OM8 A;  1UMS A;  4FXQ A;  3B92 A;  1YOU A;  4GF1 A;  4FU4 A;  5B5O A;  3DTE A;  2ERP A;  5D3C A;  1JAP A;  2AYK A;  1I76 A;  3ZVS A;  2K2G A;  1GXD A;  1K7G A;  1SLN A;  2JT5 A;  2FV5 A;  1CK7 A;  1JIW P;  4GR3 A;  2W13 A;  3I7I A;  3Q2G A;  1AF0 A;  2MZE A;  2W14 A;  1CIZ A;  3DNG A;  1YQY A;  3LUM A;  4L6T A;  1GE6 A;  2X7M A;  2OXU A;  1OO9 A;  1OS2 A;  1CQR A;  1JAQ A;  3LK8 A;  3LMC A;  1ZXC A;  5D1T A;  1L6J A;  3OHO A;  4H49 A;  1D8M A;  3EDH A;  3WV1 A;  4I35 A;  2W15 A;  4I03 A;  5I12 A;  4WZV A;  1JAN A;  3EDZ A;  4AYK A;  1JH1 A;  1KBC A;  2USN A;  4JA1 A;  1FLS A;  4IUW A;  3F17 A;  2AIG P;  3P1V A;  1J7N A;  2DW2 A;  1BKC A;  3MA2 A;  5BOY A;  5BPA A;  4HMA A;  4JIJ A;  2O3E A;  4CTH A;  1MNC A;  4GR0 A;  4H84 A;  1BQQ M;  1RMZ A;  3SHI A;  1XFW A;  1GKC A;  1ND1 A;  1O0T A;  3EDI A;  4QKZ A;  4XBH A;  4JQG A;  5I3M A;  4ZR5 A;  1BM6 A;  1FBL A;  1BZS A;  1IAA A;  2X3C A;  4H82 A;  2OW9 A;  4IN9 A;  2I47 A;  1ZP5 A;  1HTD A;  1PWU A;  1YCM A;  3U1R A;  4PKT A;  1SRP A;  4DF9 A;  1JJ9 A;  2OXZ A;  1ZXV A;  456C A;  2OZR A;  2JNP A;  2YB9 A;  1PWQ A;  5CUH A;  1PWV A;  1CGL A;  1USN A;  4PKV A;  4PKS A;  1XAX A;  3V96 B;  2D1N A;  1CAQ A;  4L63 A;  2ERO A;  1BUV M;  4WKI A;  3ELM A;  3AIG A;  1GO7 P;  3HY7 A;  1QIB A;  2E3X A;  1SLM A;  1KUH A;  3LIL A;  1IAE A;  4L19 A;  4WF6 A;  1G4K A;  3KEC A;  5H8X A;  5L7F A;  1HFS A;  1UTZ A;  1BKC I;  1C7K A;  2XS4 A;  5B5P A;  1JIZ A;  1XUD A;  4FVL A;  1CXV A;  2O36 A;  4JPA A;  1G49 A;  1XFV A;  2TCL A;  3HDB A;  4XM7 A;  2MLR A;  3O2X A;  4AUO A;  1XUR A;  1XFU A;  2J83 A;  3L0V A;  3LIK A;  1C3I A;  3CKI A;  1GE7 A;  1JAO A;  1XFY A;  1ATL A;  3E8R A;  1G9K A;  1D5J A;  2SRT A;  2Y6C A;  5CXA A;  3ZUK A;  3LJG A;  5I2Z A;  1XFZ A;  3DPE A;  1OZ9 A;  1IAD A;  2PJT A;  1GKD A;  2MZI A;  3RTT A;  3DTK A;  1JKY A;  2K9C A;  1R1J A;  3LJT A;  3KWV C;  3LJZ A;  4H30 A;  1EB6 A;  1PWW A;  4ILW D;  1BKC E;  1KAP P;  5D2B A;  1OMJ A;  2WOA A;  3HY9 A;  4H1Q A;  2CKI A;  2OW2 A;  2V4B A;  3TT4 A;  3TSK A;  1QJJ A;  1KUG A;  1D7X A;  4XCT A;  4XM8 A;  3Q2H A;  1EUB A;  3F1A A;  3LEA A;  1WNI A;  2MZH A;  3WV3 A;  4J4M A;  2JT6 A;  3BA0 A;  1ZS0 A;  3F16 A;  3WV2 A;  2J0T A;  5I43 A;  1IAB A;  1Y8J A;  1Q3A A;  2OVX A;  1ZTQ A;  2X3A A;  1TVI A;  3UVC A;  3OHL A;  1BQO A;  1HFC A;  3AYU A;  1C8T A;  1Y0V A;  4DV8 A;  4PKQ A;  2WO9 A;  966C A;  1BUD A;  5JMY A;  1XFX A;  1FM1 A;  4PKW A;  1IAC A;  2Y6D A;  3F15 A;  3ZXH A;  2RJP A;  1SMP A;  1ROS A;  3LKA A;  4GWN A;  1O0Q A;  3L0T A;  5D1U A;  4L7A A;  4R3V A;  2W0D A;  1DMT A;  2JIH A;  1G12 A;  1D8F A;  4PKU A;  4DD8 A;  3DPF A;  3GBO A;  4A3W A;  1EAK A;  2OW0 A;  3O64 A;  1KUK A;  4JP4 A;  4G9L A;  1BSW A;  1CGE A;  5I0L A;  5BOT A;  1ZVX A;  3HBU P;  3LQ0 A;  4HX3 A;  1YP1 A;  3EWJ A;  1Y93 A;  3NX7 A;  830C A;  1PWP A;  2OVZ A;  1XUC A;  2DW1 A;  2E2D A;  3KME A;  3VTG A;  1A86 A;  4AIG A;  3G42 A;  2YIG A;  2N8R A; 
#chains in the Genus database with same CATH homology
 1GO8 P;  1AYK A;  3DSL A;  1Z3J A;  2D1O A;  3EHX A;  3F19 A;  5L79 A;  1R54 A;  1BIW A;  2OI0 A;  1KUF A;  1GE5 A;  2DDY A;  1HY7 A;  3KEJ A;  4AXQ A;  3HYG A;  4DPE A;  2Z2D A;  2HU6 A;  3I7G A;  1QJI A;  3AYK A;  1H71 P;  1MMQ A;  4FXY P;  3LGP A;  2OXW A;  1OM6 A;  2DDF A;  2POJ A;  1HV5 A;  2CLT A;  3EHY A;  1I73 A;  4XM6 A;  1UEA A;  3LUN A;  4GQL A;  2A8H A;  2W12 A;  1R55 A;  4PKR A;  2JSD A;  1R1I A;  3USN A;  3N2V A;  1G05 A;  1MMB A;  1MMR A;  2OY4 A;  1QUA A;  3P24 A;  1B8Y A;  4H76 A;  1UMT A;  4IJO A;  1R1H A;  1KUI A;  4GR8 A;  4Q1L A;  4H2E A;  3HDA P;  1A85 A;  4GWM A;  1RM8 A;  3LQB A;  1MMP A;  1AKL A;  3HB2 P;  1OS9 A;  1JK3 A;  2FV9 A;  3KEK A;  3HBV P;  2QPJ A;  4EFS A;  5CZM A;  1OM7 A;  1B3D A;  2MLS A;  3K7N A;  3N2U A;  3KRY A;  4G0D A;  3VI1 A;  5D1S A;  2KRJ A;  3B8Z A;  3TS4 A;  2WO8 A;  3TVC A;  1QIA A;  1K7Q A;  5LAB A;  2L0R A;  3DL1 A;  3LIR A;  2XS3 A;  4WKE A;  1QIC A;  1HOV A;  1AST A;  3DTI A;  1S4B P;  3G5C A;  5D7W A;  4WK7 A;  3K7L A;  1DTH A;  1IAG A;  3EDG A;  3KMC A;  3KHI A;  4A7B A;  2DW0 A;  4H3X A;  4GUY A;  3B2Z A;  1SU3 A;  2OW1 A;  3DWB A;  2RJQ A;  1K7I A;  1CGF A;  2YUF A;  1UTT A;  2ERQ A;  3RTS A;  2OY2 A;  3F18 A;  2X3B A;  5I4O A;  1SAT A;  4ON1 A;  3LE9 A;  1I1I P;  1OM8 A;  1UMS A;  4FXQ A;  3B92 A;  1YOU A;  4GF1 A;  4FU4 A;  5B5O A;  3DTE A;  2ERP A;  5D3C A;  1JAP A;  2AYK A;  1I76 A;  3ZVS A;  2K2G A;  1GXD A;  1K7G A;  1SLN A;  2JT5 A;  2FV5 A;  1CK7 A;  1JIW P;  4GR3 A;  2W13 A;  3I7I A;  3Q2G A;  1AF0 A;  2MZE A;  2W14 A;  1CIZ A;  3DNG A;  1YQY A;  3LUM A;  4L6T A;  1GE6 A;  2X7M A;  2OXU A;  1OO9 A;  1OS2 A;  1CQR A;  1JAQ A;  3LK8 A;  3LMC A;  1ZXC A;  5D1T A;  1L6J A;  3OHO A;  4H49 A;  1D8M A;  3EDH A;  3WV1 A;  4I35 A;  2W15 A;  4I03 A;  5I12 A;  4WZV A;  1JAN A;  3EDZ A;  4AYK A;  1JH1 A;  1KBC A;  2USN A;  4JA1 A;  1FLS A;  4IUW A;  3F17 A;  2AIG P;  3P1V A;  1J7N A;  2DW2 A;  1BKC A;  3MA2 A;  5BOY A;  5BPA A;  4HMA A;  4JIJ A;  2O3E A;  4CTH A;  1MNC A;  4GR0 A;  4H84 A;  1BQQ M;  1RMZ A;  3SHI A;  1XFW A;  1GKC A;  1ND1 A;  1O0T A;  3EDI A;  4QKZ A;  4XBH A;  4JQG A;  5I3M A;  4ZR5 A;  1BM6 A;  1FBL A;  1BZS A;  1IAA A;  2X3C A;  4H82 A;  2OW9 A;  4IN9 A;  2I47 A;  1ZP5 A;  1HTD A;  1PWU A;  1YCM A;  3U1R A;  4PKT A;  1SRP A;  4DF9 A;  1JJ9 A;  2OXZ A;  1ZXV A;  456C A;  2OZR A;  2JNP A;  2YB9 A;  1PWQ A;  5CUH A;  1PWV A;  1CGL A;  1USN A;  4PKV A;  4PKS A;  3V96 B;  2D1N A;  1CAQ A;  4L63 A;  2ERO A;  1BUV M;  4WKI A;  3ELM A;  3AIG A;  1GO7 P;  3HY7 A;  1QIB A;  2E3X A;  1SLM A;  1KUH A;  3LIL A;  1IAE A;  4L19 A;  4WF6 A;  1G4K A;  3KEC A;  5H8X A;  5L7F A;  1HFS A;  1UTZ A;  1BKC I;  1C7K A;  2XS4 A;  5B5P A;  1JIZ A;  1XUD A;  4FVL A;  1CXV A;  2O36 A;  4JPA A;  1G49 A;  1XFV A;  2TCL A;  3HDB A;  4XM7 A;  2MLR A;  3O2X A;  4AUO A;  1XUR A;  1XFU A;  2J83 A;  3L0V A;  3LIK A;  1C3I A;  3CKI A;  1GE7 A;  1JAO A;  1XFY A;  1ATL A;  3E8R A;  1G9K A;  1D5J A;  2SRT A;  2Y6C A;  5CXA A;  3ZUK A;  3LJG A;  5I2Z A;  1XFZ A;  3DPE A;  1IAD A;  2PJT A;  1GKD A;  2MZI A;  3RTT A;  3DTK A;  1JKY A;  2K9C A;  1R1J A;  3LJT A;  3KWV C;  3LJZ A;  4H30 A;  1EB6 A;  1PWW A;  4ILW D;  1BKC E;  1KAP P;  5D2B A;  1OMJ A;  2WOA A;  3HY9 A;  4H1Q A;  2CKI A;  2OW2 A;  2V4B A;  3TT4 A;  3TSK A;  1QJJ A;  1KUG A;  1D7X A;  4XCT A;  4XM8 A;  3Q2H A;  1EUB A;  3F1A A;  3LEA A;  1WNI A;  2MZH A;  3WV3 A;  4J4M A;  2JT6 A;  3BA0 A;  1ZS0 A;  3F16 A;  3WV2 A;  2J0T A;  5I43 A;  1IAB A;  1Y8J A;  1Q3A A;  2OVX A;  1ZTQ A;  2X3A A;  3UVC A;  3OHL A;  1BQO A;  1HFC A;  3AYU A;  1C8T A;  1Y0V A;  4DV8 A;  4PKQ A;  2WO9 A;  966C A;  1BUD A;  5JMY A;  1XFX A;  1FM1 A;  4PKW A;  1IAC A;  2Y6D A;  3F15 A;  3ZXH A;  2RJP A;  1SMP A;  1ROS A;  3LKA A;  4GWN A;  1O0Q A;  3L0T A;  5D1U A;  4L7A A;  4R3V A;  2W0D A;  1DMT A;  2JIH A;  1G12 A;  1D8F A;  4PKU A;  4DD8 A;  3DPF A;  3GBO A;  4A3W A;  1EAK A;  2OW0 A;  3O64 A;  1KUK A;  4JP4 A;  4G9L A;  1BSW A;  1CGE A;  5I0L A;  5BOT A;  1ZVX A;  3HBU P;  3LQ0 A;  4HX3 A;  1YP1 A;  3EWJ A;  1Y93 A;  3NX7 A;  830C A;  1PWP A;  2OVZ A;  1XUC A;  2DW1 A;  2E2D A;  3KME A;  3VTG A;  1A86 A;  4AIG A;  3G42 A;  2YIG A;  2N8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...