4AIGA

Adamalysin ii with phosphonate inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
NLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLNSFGEWRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAMALYSIN II
publication title 2 angstrom X-ray structure of adamalysin II complexed with a peptide phosphonate inhibitor adopting a retro-binding mode.
pubmed doi rcsb
molecule tags Metalloendopeptidase
total genus 73
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.46: Adamalysin.
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4aigA00
2RJPA 2JT6A 2OI0A 5LABA 1AF0A 4AIGA 2D1OA 1HY7A 2K2GA 3KEKA 1XFWA 2OVXA 3LE9A 1KUHA 3G42A 2OW1A 3F16A 3O64A 3CKIA 3OHOA 1K7QA 3F17A 2CKIA 830CA 3LJTA 2OY4A 1GO8P 3DWBA 3DL1A 3DNGA 2XS4A 3EDGA 1JAPA 1JKYA 2DW2A 1MMQA 1XFZA 4PKSA 3VI1A 4L6TA 3B8ZA 1MMBA 1D8FA 3KMCA 1D8MA 3LQBA 3SHIA 5I43A 1SATA 3AIGA 1KUFA 2FV5A 4JA1A 1XURA 2OW0A 1R1HA 4FXYP 2EROA 2D1NA 1JAOA 1HTDA 1Y93A 2JT5A 3ZXHA 1ZXCA 3ZUKA 4DF9A 1PWWA 1RM8A 3RTTA 1BQQM 1GXDA 1HFSA 3F19A 3LIRA 3HBUP 1L6JA 1EAKA 3DPEA 2W13A 2X3CA 1HFCA 3BA0A 1IAAA 2X7MA 1AKLA 1KUGA 2JNPA 4DPEA 4J4MA 1ZVXA 2PJTA 1KUIA 1G49A 4GWMA 4JPAA 2DDFA 1ZTQA 4GR8A 3HB2P 3UVCA 1WNIA 3MA2A 1B3DA 3HY9A 3KRYA 4XM7A 3AYKA 5D1TA 4HX3A 1CGFA 1GKCA 4WF6A 1BQOA 1BM6A 2V4BA 4XBHA 3DPFA 1IAGA 4GF1A 2J0TA 4XM6A 1IABA 1OMJA 4Q1LA 3Q2HA 2OXWA 2AYKA 1PWPA 5I2ZA 1R55A 2Z2DA 3HDBA 1ND1A 1SLMA 1IACA 2MZEA 1OM8A 3P1VA 1PWUA 1OS9A 1C8TA 1G12A 2SRTA 4ON1A 2W12A 966CA 1JANA 5H8XA 5B5PA 2YIGA 4JQGA 1CGEA 3O2XA 3VTGA 2RJQA 4AXQA 1I76A 3F15A 3HDAP 2QPJA 1JIZA 3HY7A 1JH1A 5D3CA 3LQ0A 4FU4A 4XCTA 1KBCA 3RTSA 2Y6DA 1EUBA 3G5CA 4JIJA 3LJZA 3B92A 2MLSA 1B8YA 2OW9A 2W14A 1XFXA 4A7BA 1D7XA 3B2ZA 5D7WA 4H49A 1K7IA 2KRJA 4JP4A 3HYGA 1UMTA 3F1AA 3I7IA 2W15A 1USNA 4FVLA 1QIAA 1SMPA 1ROSA 1FLSA 4I35A 1JK3A 4PKUA 2DW0A 3L0TA 2E2DA 4HMAA 5I3MA 1UMSA 4PKVA 4WZVA 3WV2A 2E3XA 1ZS0A 2OY2A 5D1SA 5I12A 1O0TA 4H84A 1QIBA 1XUDA 1PWVA 3K7NA 456CA 3LUNA 3LUMA 4XM8A 1HOVA 4G9LA 3AYUA 1BUDA 1QJJA 1SRPA 3KECA 4ILWD 2A8HA 4H2EA 1G4KA 3KHIA 1HV5A 4PKTA 5I0LA 1CGLA 1JAQA 1BZSA 1R1IA 2MZHA 1Y0VA 1H71P 3EDZA 1QICA 1BKCI 1KAPP 2WOAA 5BOTA 2K9CA 1D5JA 1SLNA 5CUHA 1BIWA 5I4OA 4H3XA 4I03A 4L63A 1CXVA 1J7NA 1O0QA 5CXAA 1GE6A 5D1UA 1UEAA 3LK8A 1G9KA 3ZVSA 4R3VA 5L7FA 3KMEA 3DSLA 2J83A 4CTHA 4FXQA 1R54A 1MNCA 1OM6A 1BKCA 4PKRA 1CK7A 2JSDA 1R1JA 4GQLA 1Q3AA 3KWVC 1Z3JA 4WKEA 3WV1A 1BUVM 1UTZA 2X3AA 2TCLA 1ATLA 1XUCA 4WKIA 1Y8JA 3LKAA 3U1RA 1SU3A 1UTTA 1YCMA 4L19A 2OW2A 2HU6A 1A86A 1XFYA 1G05A 2WO9A 1YP1A 4A3WA 1GE5A 1I1IP 1MMPA 1IADA 3EDHA 2MZIA 5B5OA 3EHXA 1GKDA 2POJA 2I47A 3LGPA 1JIWP 4GWNA 1GO7P 5BOYA 1EB6A 1GE7A 3LJGA 2OXZA 4H1QA 2ERQA 1CAQA 3EHYA 2YB9A 4GUYA 3TT4A 5BPAA 1C7KA 1OM7A 1AYKA 1MMRA 1QUAA 3LMCA 1JJ9A 4WK7A 2OVZA 2O36A 3Q2GA 1CQRA 4AUOA 2FV9A 4H82A 1C3IA 1PWQA 3LILA 3OHLA 4PKWA 1KUKA 2DDYA 1OO9A 1DMTA 3E8RA 3L0VA 1YQYA 3WV3A 4DV8A 1CIZA 3N2VA 4DD8A 3LEAA 4AYKA 4IUWA 3N2UA 2L0RA 1K7GA 5L79A 3TVCA 4IJOA 4PKQA 3EWJA 3V96B 1RMZA 3I7GA 2ERPA 3NX7A 5CZMA 1BKCE 2O3EA 5D2BA 4GR0A 2Y6CA 1S4BP 1ZP5A 3USNA 4QKZA 4H30A 1OS2A 3TS4A 2W0DA 5JMYA 2JIHA 3P24A 4H76A 1FM1A 2AIGP 1I73A 2X3BA 2OZRA 2WO8A 3K7LA 1QJIA 1ASTA 4G0DA 1XFVA 4ZR5A 2XS3A 1DTHA 4GR3A 1IAEA 2OXUA 2DW1A 2CLTA 3KEJA 3TSKA 3F18A 4EFSA 1FBLA 3GBOA 3ELMA 1BSWA 2USNA 4IN9A 3EDIA 1ZXVA 2N8RA 1YOUA 1XFUA 3LIKA 1A85A 3HBVP 2MLRA
chains in the Genus database with same CATH superfamily
2RJPA 2JT6A 2OI0A 5LABA 1AF0A 4AIGA 2D1OA 1HY7A 2K2GA 3KEKA 1XFWA 2OVXA 3LE9A 1KUHA 3G42A 2OW1A 3F16A 3O64A 3CKIA 3OHOA 1K7QA 3F17A 2CKIA 830CA 3LJTA 2OY4A 1GO8P 3DWBA 3DL1A 3DNGA 2XS4A 3EDGA 1JAPA 1JKYA 2DW2A 1MMQA 1XFZA 4PKSA 3VI1A 4L6TA 3B8ZA 1MMBA 1D8FA 3KMCA 1D8MA 3LQBA 3SHIA 5I43A 1SATA 3AIGA 1KUFA 2FV5A 4JA1A 1XURA 2OW0A 1R1HA 4FXYP 2EROA 2D1NA 1JAOA 1HTDA 1Y93A 2JT5A 3ZXHA 1ZXCA 3ZUKA 4DF9A 1PWWA 1RM8A 1XAXA 3RTTA 1BQQM 1GXDA 1HFSA 3F19A 3LIRA 3HBUP 1L6JA 1EAKA 3DPEA 2W13A 2X3CA 1HFCA 3BA0A 1IAAA 2X7MA 1AKLA 1KUGA 2JNPA 4DPEA 4J4MA 1ZVXA 2PJTA 1KUIA 1G49A 4GWMA 4JPAA 2DDFA 1ZTQA 4GR8A 3HB2P 3UVCA 1WNIA 3MA2A 1B3DA 3HY9A 3KRYA 4XM7A 2YUFA 3AYKA 5D1TA 4HX3A 1CGFA 1GKCA 4WF6A 1BQOA 1BM6A 2V4BA 4XBHA 3DPFA 1IAGA 4GF1A 3DTKA 2J0TA 4XM6A 1IABA 1OMJA 4Q1LA 3Q2HA 2OXWA 2AYKA 1PWPA 5I2ZA 1R55A 2Z2DA 3HDBA 1ND1A 1SLMA 1IACA 2MZEA 1OM8A 3P1VA 1PWUA 1OS9A 1C8TA 1G12A 2SRTA 4ON1A 2W12A 966CA 1JANA 5H8XA 5B5PA 2YIGA 4JQGA 1CGEA 3O2XA 3VTGA 2RJQA 4AXQA 1I76A 3F15A 3HDAP 2QPJA 1JIZA 3HY7A 1JH1A 5D3CA 3LQ0A 4FU4A 4XCTA 1KBCA 3RTSA 2Y6DA 1EUBA 3G5CA 4JIJA 3LJZA 3B92A 2MLSA 1B8YA 2OW9A 2W14A 1XFXA 4A7BA 1D7XA 3B2ZA 5D7WA 4H49A 1K7IA 2KRJA 4JP4A 3HYGA 1UMTA 3F1AA 3I7IA 2W15A 1USNA 4FVLA 1QIAA 1SMPA 1ROSA 1FLSA 4I35A 1JK3A 4PKUA 2DW0A 3L0TA 2E2DA 4HMAA 5I3MA 1UMSA 4PKVA 4WZVA 3WV2A 2E3XA 1ZS0A 2OY2A 5D1SA 5I12A 1O0TA 4H84A 1QIBA 1XUDA 1PWVA 3K7NA 456CA 3LUNA 3LUMA 4XM8A 1HOVA 4G9LA 3AYUA 1BUDA 1QJJA 1SRPA 3KECA 4ILWD 2A8HA 4H2EA 1G4KA 3KHIA 1HV5A 4PKTA 5I0LA 1CGLA 1JAQA 1BZSA 1R1IA 3DTEA 2MZHA 1Y0VA 1H71P 3EDZA 1QICA 1BKCI 1KAPP 2WOAA 5BOTA 2K9CA 1D5JA 1SLNA 5CUHA 1BIWA 5I4OA 4H3XA 4I03A 4L63A 1CXVA 1J7NA 1O0QA 5CXAA 1GE6A 5D1UA 1UEAA 3LK8A 1G9KA 3ZVSA 4R3VA 5L7FA 3KMEA 3DSLA 3DTIA 2J83A 4CTHA 4FXQA 1R54A 1MNCA 1OM6A 1BKCA 4PKRA 1CK7A 2JSDA 1R1JA 4GQLA 1Q3AA 3KWVC 1Z3JA 4WKEA 3WV1A 1BUVM 1UTZA 2X3AA 2TCLA 1ATLA 1XUCA 4WKIA 1Y8JA 3LKAA 3U1RA 1SU3A 1UTTA 1YCMA 4L19A 2OW2A 2HU6A 1A86A 1XFYA 1G05A 2WO9A 1YP1A 4A3WA 1GE5A 1I1IP 1MMPA 1IADA 3EDHA 2MZIA 5B5OA 1TVIA 3EHXA 1GKDA 2POJA 2I47A 3LGPA 1JIWP 4GWNA 1GO7P 5BOYA 1EB6A 1GE7A 3LJGA 2OXZA 4H1QA 2ERQA 1CAQA 3EHYA 2YB9A 4GUYA 3TT4A 5BPAA 1C7KA 1OM7A 1AYKA 1MMRA 1QUAA 3LMCA 1JJ9A 4WK7A 1OZ9A 2OVZA 2O36A 3Q2GA 1CQRA 4AUOA 2FV9A 4H82A 1C3IA 1PWQA 3LILA 3OHLA 4PKWA 1KUKA 2DDYA 1OO9A 1DMTA 3E8RA 3L0VA 1YQYA 3WV3A 4DV8A 1CIZA 3N2VA 4DD8A 3LEAA 4AYKA 4IUWA 3N2UA 2L0RA 1K7GA 5L79A 3TVCA 4IJOA 4PKQA 3EWJA 3V96B 1RMZA 3I7GA 2ERPA 3NX7A 5CZMA 1BKCE 2O3EA 5D2BA 4GR0A 2Y6CA 1S4BP 1ZP5A 3USNA 4QKZA 4H30A 1OS2A 3TS4A 2W0DA 5JMYA 2JIHA 3P24A 4H76A 1FM1A 2AIGP 1I73A 2X3BA 2OZRA 2WO8A 3K7LA 1QJIA 1ASTA 4G0DA 1XFVA 4L7AA 4ZR5A 2XS3A 1DTHA 4GR3A 1IAEA 2OXUA 2DW1A 2CLTA 3KEJA 3TSKA 3F18A 4EFSA 1FBLA 3GBOA 3ELMA 1BSWA 2USNA 4IN9A 3EDIA 1ZXVA 1XM5A 2N8RA 1YOUA 1XFUA 3LIKA 1A85A 3HBVP 2MLRA
chains in the Genus database with same CATH topology
2RJPA 2JT6A 2OI0A 5LABA 1AF0A 4AIGA 2D1OA 1HY7A 2K2GA 3KEKA 1XFWA 2OVXA 3LE9A 1KUHA 3G42A 2OW1A 3F16A 3O64A 3CKIA 3OHOA 1K7QA 3F17A 2CKIA 830CA 3LJTA 2OY4A 1GO8P 3DWBA 3DL1A 3DNGA 2XS4A 3EDGA 1JAPA 1JKYA 2DW2A 1MMQA 1XFZA 4PKSA 3VI1A 4L6TA 3B8ZA 1MMBA 1D8FA 3KMCA 1D8MA 3LQBA 3SHIA 5I43A 1SATA 3AIGA 1KUFA 2FV5A 4JA1A 1XURA 2OW0A 1R1HA 4FXYP 2EROA 2D1NA 1JAOA 1HTDA 1Y93A 2JT5A 3ZXHA 1ZXCA 3ZUKA 4DF9A 1PWWA 1RM8A 3RTTA 1BQQM 1GXDA 1HFSA 3F19A 3LIRA 3HBUP 1L6JA 1EAKA 3DPEA 2W13A 2X3CA 1HFCA 3BA0A 1IAAA 2X7MA 1AKLA 1KUGA 2JNPA 4DPEA 4J4MA 1ZVXA 2PJTA 1KUIA 1G49A 4GWMA 4JPAA 2DDFA 1ZTQA 4GR8A 3HB2P 3UVCA 1WNIA 3MA2A 1B3DA 3HY9A 3KRYA 4XM7A 2YUFA 3AYKA 5D1TA 4HX3A 1CGFA 1GKCA 4WF6A 1BQOA 1BM6A 2V4BA 4XBHA 3DPFA 1IAGA 4GF1A 3DTKA 2J0TA 4XM6A 1IABA 1OMJA 4Q1LA 3Q2HA 2OXWA 2AYKA 1PWPA 5I2ZA 1R55A 2Z2DA 3HDBA 1ND1A 1SLMA 1IACA 2MZEA 1OM8A 3P1VA 1PWUA 1OS9A 1C8TA 1G12A 2SRTA 4ON1A 2W12A 966CA 1JANA 5H8XA 5B5PA 2YIGA 4JQGA 1CGEA 3O2XA 3VTGA 2RJQA 4AXQA 1I76A 3F15A 3HDAP 2QPJA 1JIZA 3HY7A 1JH1A 5D3CA 3LQ0A 4FU4A 4XCTA 1KBCA 3RTSA 2Y6DA 1EUBA 3G5CA 4JIJA 3LJZA 3B92A 2MLSA 1B8YA 2OW9A 2W14A 1XFXA 4A7BA 1D7XA 3B2ZA 5D7WA 4H49A 1K7IA 2KRJA 4JP4A 3HYGA 1UMTA 3F1AA 3I7IA 2W15A 1USNA 4FVLA 1QIAA 1SMPA 1ROSA 1FLSA 4I35A 1JK3A 4PKUA 2DW0A 3L0TA 2E2DA 4HMAA 5I3MA 1UMSA 4PKVA 4WZVA 3WV2A 2E3XA 1ZS0A 2OY2A 5D1SA 5I12A 1O0TA 4H84A 1QIBA 1XUDA 1PWVA 3K7NA 456CA 3LUNA 3LUMA 4XM8A 1HOVA 4G9LA 3AYUA 1BUDA 1QJJA 1SRPA 3KECA 4ILWD 2A8HA 4H2EA 1G4KA 3KHIA 1HV5A 4PKTA 5I0LA 1CGLA 1JAQA 1BZSA 1R1IA 3DTEA 2MZHA 1Y0VA 1H71P 3EDZA 1QICA 1BKCI 1KAPP 2WOAA 5BOTA 2K9CA 1D5JA 1SLNA 5CUHA 1BIWA 5I4OA 4H3XA 4I03A 4L63A 1CXVA 1J7NA 1O0QA 5CXAA 1GE6A 5D1UA 1UEAA 3LK8A 1G9KA 3ZVSA 4R3VA 5L7FA 3KMEA 3DSLA 3DTIA 2J83A 4CTHA 4FXQA 1R54A 1MNCA 1OM6A 1BKCA 4PKRA 1CK7A 2JSDA 1R1JA 4GQLA 1Q3AA 3KWVC 1Z3JA 4WKEA 3WV1A 1BUVM 1UTZA 2X3AA 2TCLA 1ATLA 1XUCA 4WKIA 1Y8JA 3LKAA 3U1RA 1SU3A 1UTTA 1YCMA 4L19A 2OW2A 2HU6A 1A86A 1XFYA 1G05A 2WO9A 1YP1A 4A3WA 1GE5A 1I1IP 1MMPA 1IADA 3EDHA 2MZIA 5B5OA 3EHXA 1GKDA 2POJA 2I47A 3LGPA 1JIWP 4GWNA 1GO7P 5BOYA 1EB6A 1GE7A 3LJGA 2OXZA 4H1QA 2ERQA 1CAQA 3EHYA 2YB9A 4GUYA 3TT4A 5BPAA 1C7KA 1OM7A 1AYKA 1MMRA 1QUAA 3LMCA 1JJ9A 4WK7A 2OVZA 2O36A 3Q2GA 1CQRA 4AUOA 2FV9A 4H82A 1C3IA 1PWQA 3LILA 3OHLA 4PKWA 1KUKA 2DDYA 1OO9A 1DMTA 3E8RA 3L0VA 1YQYA 3WV3A 4DV8A 1CIZA 3N2VA 4DD8A 3LEAA 4AYKA 4IUWA 3N2UA 2L0RA 1K7GA 5L79A 3TVCA 4IJOA 4PKQA 3EWJA 3V96B 1RMZA 3I7GA 2ERPA 3NX7A 5CZMA 1BKCE 2O3EA 5D2BA 4GR0A 2Y6CA 1S4BP 1ZP5A 3USNA 4QKZA 4H30A 1OS2A 3TS4A 2W0DA 5JMYA 2JIHA 3P24A 4H76A 1FM1A 2AIGP 1I73A 2X3BA 2OZRA 2WO8A 3K7LA 1QJIA 1ASTA 4G0DA 1XFVA 4L7AA 4ZR5A 2XS3A 1DTHA 4GR3A 1IAEA 2OXUA 2DW1A 2CLTA 3KEJA 3TSKA 3F18A 4EFSA 1FBLA 3GBOA 3ELMA 1BSWA 2USNA 4IN9A 3EDIA 1ZXVA 2N8RA 1YOUA 1XFUA 3LIKA 1A85A 3HBVP 2MLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJP A;  2JT6 A;  2OI0 A;  5LAB A;  1AF0 A;  4AIG A;  2D1O A;  1HY7 A;  2K2G A;  3KEK A;  1XFW A;  2OVX A;  3LE9 A;  1KUH A;  3G42 A;  2OW1 A;  3F16 A;  3O64 A;  3CKI A;  3OHO A;  1K7Q A;  3F17 A;  2CKI A;  830C A;  3LJT A;  2OY4 A;  1GO8 P;  3DWB A;  3DL1 A;  3DNG A;  2XS4 A;  3EDG A;  1JAP A;  1JKY A;  2DW2 A;  1MMQ A;  1XFZ A;  4PKS A;  3VI1 A;  4L6T A;  3B8Z A;  1MMB A;  1D8F A;  3KMC A;  1D8M A;  3LQB A;  3SHI A;  5I43 A;  1SAT A;  3AIG A;  1KUF A;  2FV5 A;  4JA1 A;  1XUR A;  2OW0 A;  1R1H A;  4FXY P;  2ERO A;  2D1N A;  1JAO A;  1HTD A;  1Y93 A;  2JT5 A;  3ZXH A;  1ZXC A;  3ZUK A;  4DF9 A;  1PWW A;  1RM8 A;  3RTT A;  1BQQ M;  1GXD A;  1HFS A;  3F19 A;  3LIR A;  3HBU P;  1L6J A;  1EAK A;  3DPE A;  2W13 A;  2X3C A;  1HFC A;  3BA0 A;  1IAA A;  2X7M A;  1AKL A;  1KUG A;  2JNP A;  4DPE A;  4J4M A;  1ZVX A;  2PJT A;  1KUI A;  1G49 A;  4GWM A;  4JPA A;  2DDF A;  1ZTQ A;  4GR8 A;  3HB2 P;  3UVC A;  1WNI A;  3MA2 A;  1B3D A;  3HY9 A;  3KRY A;  4XM7 A;  3AYK A;  5D1T A;  4HX3 A;  1CGF A;  1GKC A;  4WF6 A;  1BQO A;  1BM6 A;  2V4B A;  4XBH A;  3DPF A;  1IAG A;  4GF1 A;  2J0T A;  4XM6 A;  1IAB A;  1OMJ A;  4Q1L A;  3Q2H A;  2OXW A;  2AYK A;  1PWP A;  5I2Z A;  1R55 A;  2Z2D A;  3HDB A;  1ND1 A;  1SLM A;  1IAC A;  2MZE A;  1OM8 A;  3P1V A;  1PWU A;  1OS9 A;  1C8T A;  1G12 A;  2SRT A;  4ON1 A;  2W12 A;  966C A;  1JAN A;  5H8X A;  5B5P A;  2YIG A;  4JQG A;  1CGE A;  3O2X A;  3VTG A;  2RJQ A;  4AXQ A;  1I76 A;  3F15 A;  3HDA P;  2QPJ A;  1JIZ A;  3HY7 A;  1JH1 A;  5D3C A;  3LQ0 A;  4FU4 A;  4XCT A;  1KBC A;  3RTS A;  2Y6D A;  1EUB A;  3G5C A;  4JIJ A;  3LJZ A;  3B92 A;  2MLS A;  1B8Y A;  2OW9 A;  2W14 A;  1XFX A;  4A7B A;  1D7X A;  3B2Z A;  5D7W A;  4H49 A;  1K7I A;  2KRJ A;  4JP4 A;  3HYG A;  1UMT A;  3F1A A;  3I7I A;  2W15 A;  1USN A;  4FVL A;  1QIA A;  1SMP A;  1ROS A;  1FLS A;  4I35 A;  1JK3 A;  4PKU A;  2DW0 A;  3L0T A;  2E2D A;  4HMA A;  5I3M A;  1UMS A;  4PKV A;  4WZV A;  3WV2 A;  2E3X A;  1ZS0 A;  2OY2 A;  5D1S A;  5I12 A;  1O0T A;  4H84 A;  1QIB A;  1XUD A;  1PWV A;  3K7N A;  456C A;  3LUN A;  3LUM A;  4XM8 A;  1HOV A;  4G9L A;  3AYU A;  1BUD A;  1QJJ A;  1SRP A;  3KEC A;  4ILW D;  2A8H A;  4H2E A;  1G4K A;  3KHI A;  1HV5 A;  4PKT A;  5I0L A;  1CGL A;  1JAQ A;  1BZS A;  1R1I A;  2MZH A;  1Y0V A;  1H71 P;  3EDZ A;  1QIC A;  1BKC I;  1KAP P;  2WOA A;  5BOT A;  2K9C A;  1D5J A;  1SLN A;  5CUH A;  1BIW A;  5I4O A;  4H3X A;  4I03 A;  4L63 A;  1CXV A;  1J7N A;  1O0Q A;  5CXA A;  1GE6 A;  5D1U A;  1UEA A;  3LK8 A;  1G9K A;  3ZVS A;  4R3V A;  5L7F A;  3KME A;  3DSL A;  2J83 A;  4CTH A;  4FXQ A;  1R54 A;  1MNC A;  1OM6 A;  1BKC A;  4PKR A;  1CK7 A;  2JSD A;  1R1J A;  4GQL A;  1Q3A A;  3KWV C;  1Z3J A;  4WKE A;  3WV1 A;  1BUV M;  1UTZ A;  2X3A A;  2TCL A;  1ATL A;  1XUC A;  4WKI A;  1Y8J A;  3LKA A;  3U1R A;  1SU3 A;  1UTT A;  1YCM A;  4L19 A;  2OW2 A;  2HU6 A;  1A86 A;  1XFY A;  1G05 A;  2WO9 A;  1YP1 A;  4A3W A;  1GE5 A;  1I1I P;  1MMP A;  1IAD A;  3EDH A;  2MZI A;  5B5O A;  3EHX A;  1GKD A;  2POJ A;  2I47 A;  3LGP A;  1JIW P;  4GWN A;  1GO7 P;  5BOY A;  1EB6 A;  1GE7 A;  3LJG A;  2OXZ A;  4H1Q A;  2ERQ A;  1CAQ A;  3EHY A;  2YB9 A;  4GUY A;  3TT4 A;  5BPA A;  1C7K A;  1OM7 A;  1AYK A;  1MMR A;  1QUA A;  3LMC A;  1JJ9 A;  4WK7 A;  2OVZ A;  2O36 A;  3Q2G A;  1CQR A;  4AUO A;  2FV9 A;  4H82 A;  1C3I A;  1PWQ A;  3LIL A;  3OHL A;  4PKW A;  1KUK A;  2DDY A;  1OO9 A;  1DMT A;  3E8R A;  3L0V A;  1YQY A;  3WV3 A;  4DV8 A;  1CIZ A;  3N2V A;  4DD8 A;  3LEA A;  4AYK A;  4IUW A;  3N2U A;  2L0R A;  1K7G A;  5L79 A;  3TVC A;  4IJO A;  4PKQ A;  3EWJ A;  3V96 B;  1RMZ A;  3I7G A;  2ERP A;  3NX7 A;  5CZM A;  1BKC E;  2O3E A;  5D2B A;  4GR0 A;  2Y6C A;  1S4B P;  1ZP5 A;  3USN A;  4QKZ A;  4H30 A;  1OS2 A;  3TS4 A;  2W0D A;  5JMY A;  2JIH A;  3P24 A;  4H76 A;  1FM1 A;  2AIG P;  1I73 A;  2X3B A;  2OZR A;  2WO8 A;  3K7L A;  1QJI A;  1AST A;  4G0D A;  1XFV A;  4ZR5 A;  2XS3 A;  1DTH A;  4GR3 A;  1IAE A;  2OXU A;  2DW1 A;  2CLT A;  3KEJ A;  3TSK A;  3F18 A;  4EFS A;  1FBL A;  3GBO A;  3ELM A;  1BSW A;  2USN A;  4IN9 A;  3EDI A;  1ZXV A;  2N8R A;  1YOU A;  1XFU A;  3LIK A;  1A85 A;  3HBV P;  2MLR A; 
#chains in the Genus database with same CATH topology
 2RJP A;  2JT6 A;  2OI0 A;  5LAB A;  1AF0 A;  4AIG A;  2D1O A;  1HY7 A;  2K2G A;  3KEK A;  1XFW A;  2OVX A;  3LE9 A;  1KUH A;  3G42 A;  2OW1 A;  3F16 A;  3O64 A;  3CKI A;  3OHO A;  1K7Q A;  3F17 A;  2CKI A;  830C A;  3LJT A;  2OY4 A;  1GO8 P;  3DWB A;  3DL1 A;  3DNG A;  2XS4 A;  3EDG A;  1JAP A;  1JKY A;  2DW2 A;  1MMQ A;  1XFZ A;  4PKS A;  3VI1 A;  4L6T A;  3B8Z A;  1MMB A;  1D8F A;  3KMC A;  1D8M A;  3LQB A;  3SHI A;  5I43 A;  1SAT A;  3AIG A;  1KUF A;  2FV5 A;  4JA1 A;  1XUR A;  2OW0 A;  1R1H A;  4FXY P;  2ERO A;  2D1N A;  1JAO A;  1HTD A;  1Y93 A;  2JT5 A;  3ZXH A;  1ZXC A;  3ZUK A;  4DF9 A;  1PWW A;  1RM8 A;  1XAX A;  3RTT A;  1BQQ M;  1GXD A;  1HFS A;  3F19 A;  3LIR A;  3HBU P;  1L6J A;  1EAK A;  3DPE A;  2W13 A;  2X3C A;  1HFC A;  3BA0 A;  1IAA A;  2X7M A;  1AKL A;  1KUG A;  2JNP A;  4DPE A;  4J4M A;  1ZVX A;  2PJT A;  1KUI A;  1G49 A;  4GWM A;  4JPA A;  2DDF A;  1ZTQ A;  4GR8 A;  3HB2 P;  3UVC A;  1WNI A;  3MA2 A;  1B3D A;  3HY9 A;  3KRY A;  4XM7 A;  2YUF A;  3AYK A;  5D1T A;  4HX3 A;  1CGF A;  1GKC A;  4WF6 A;  1BQO A;  1BM6 A;  2V4B A;  4XBH A;  3DPF A;  1IAG A;  4GF1 A;  3DTK A;  2J0T A;  4XM6 A;  1IAB A;  1OMJ A;  4Q1L A;  3Q2H A;  2OXW A;  2AYK A;  1PWP A;  5I2Z A;  1R55 A;  2Z2D A;  3HDB A;  1ND1 A;  1SLM A;  1IAC A;  2MZE A;  1OM8 A;  3P1V A;  1PWU A;  1OS9 A;  1C8T A;  1G12 A;  2SRT A;  4ON1 A;  2W12 A;  966C A;  1JAN A;  5H8X A;  5B5P A;  2YIG A;  4JQG A;  1CGE A;  3O2X A;  3VTG A;  2RJQ A;  4AXQ A;  1I76 A;  3F15 A;  3HDA P;  2QPJ A;  1JIZ A;  3HY7 A;  1JH1 A;  5D3C A;  3LQ0 A;  4FU4 A;  4XCT A;  1KBC A;  3RTS A;  2Y6D A;  1EUB A;  3G5C A;  4JIJ A;  3LJZ A;  3B92 A;  2MLS A;  1B8Y A;  2OW9 A;  2W14 A;  1XFX A;  4A7B A;  1D7X A;  3B2Z A;  5D7W A;  4H49 A;  1K7I A;  2KRJ A;  4JP4 A;  3HYG A;  1UMT A;  3F1A A;  3I7I A;  2W15 A;  1USN A;  4FVL A;  1QIA A;  1SMP A;  1ROS A;  1FLS A;  4I35 A;  1JK3 A;  4PKU A;  2DW0 A;  3L0T A;  2E2D A;  4HMA A;  5I3M A;  1UMS A;  4PKV A;  4WZV A;  3WV2 A;  2E3X A;  1ZS0 A;  2OY2 A;  5D1S A;  5I12 A;  1O0T A;  4H84 A;  1QIB A;  1XUD A;  1PWV A;  3K7N A;  456C A;  3LUN A;  3LUM A;  4XM8 A;  1HOV A;  4G9L A;  3AYU A;  1BUD A;  1QJJ A;  1SRP A;  3KEC A;  4ILW D;  2A8H A;  4H2E A;  1G4K A;  3KHI A;  1HV5 A;  4PKT A;  5I0L A;  1CGL A;  1JAQ A;  1BZS A;  1R1I A;  3DTE A;  2MZH A;  1Y0V A;  1H71 P;  3EDZ A;  1QIC A;  1BKC I;  1KAP P;  2WOA A;  5BOT A;  2K9C A;  1D5J A;  1SLN A;  5CUH A;  1BIW A;  5I4O A;  4H3X A;  4I03 A;  4L63 A;  1CXV A;  1J7N A;  1O0Q A;  5CXA A;  1GE6 A;  5D1U A;  1UEA A;  3LK8 A;  1G9K A;  3ZVS A;  4R3V A;  5L7F A;  3KME A;  3DSL A;  3DTI A;  2J83 A;  4CTH A;  4FXQ A;  1R54 A;  1MNC A;  1OM6 A;  1BKC A;  4PKR A;  1CK7 A;  2JSD A;  1R1J A;  4GQL A;  1Q3A A;  3KWV C;  1Z3J A;  4WKE A;  3WV1 A;  1BUV M;  1UTZ A;  2X3A A;  2TCL A;  1ATL A;  1XUC A;  4WKI A;  1Y8J A;  3LKA A;  3U1R A;  1SU3 A;  1UTT A;  1YCM A;  4L19 A;  2OW2 A;  2HU6 A;  1A86 A;  1XFY A;  1G05 A;  2WO9 A;  1YP1 A;  4A3W A;  1GE5 A;  1I1I P;  1MMP A;  1IAD A;  3EDH A;  2MZI A;  5B5O A;  1TVI A;  3EHX A;  1GKD A;  2POJ A;  2I47 A;  3LGP A;  1JIW P;  4GWN A;  1GO7 P;  5BOY A;  1EB6 A;  1GE7 A;  3LJG A;  2OXZ A;  4H1Q A;  2ERQ A;  1CAQ A;  3EHY A;  2YB9 A;  4GUY A;  3TT4 A;  5BPA A;  1C7K A;  1OM7 A;  1AYK A;  1MMR A;  1QUA A;  3LMC A;  1JJ9 A;  4WK7 A;  1OZ9 A;  2OVZ A;  2O36 A;  3Q2G A;  1CQR A;  4AUO A;  2FV9 A;  4H82 A;  1C3I A;  1PWQ A;  3LIL A;  3OHL A;  4PKW A;  1KUK A;  2DDY A;  1OO9 A;  1DMT A;  3E8R A;  3L0V A;  1YQY A;  3WV3 A;  4DV8 A;  1CIZ A;  3N2V A;  4DD8 A;  3LEA A;  4AYK A;  4IUW A;  3N2U A;  2L0R A;  1K7G A;  5L79 A;  3TVC A;  4IJO A;  4PKQ A;  3EWJ A;  3V96 B;  1RMZ A;  3I7G A;  2ERP A;  3NX7 A;  5CZM A;  1BKC E;  2O3E A;  5D2B A;  4GR0 A;  2Y6C A;  1S4B P;  1ZP5 A;  3USN A;  4QKZ A;  4H30 A;  1OS2 A;  3TS4 A;  2W0D A;  5JMY A;  2JIH A;  3P24 A;  4H76 A;  1FM1 A;  2AIG P;  1I73 A;  2X3B A;  2OZR A;  2WO8 A;  3K7L A;  1QJI A;  1AST A;  4G0D A;  1XFV A;  4L7A A;  4ZR5 A;  2XS3 A;  1DTH A;  4GR3 A;  1IAE A;  2OXU A;  2DW1 A;  2CLT A;  3KEJ A;  3TSK A;  3F18 A;  4EFS A;  1FBL A;  3GBO A;  3ELM A;  1BSW A;  2USN A;  4IN9 A;  3EDI A;  1ZXV A;  1XM5 A;  2N8R A;  1YOU A;  1XFU A;  3LIK A;  1A85 A;  3HBV P;  2MLR A; 
#chains in the Genus database with same CATH homology
 2RJP A;  2JT6 A;  2OI0 A;  5LAB A;  1AF0 A;  4AIG A;  2D1O A;  1HY7 A;  2K2G A;  3KEK A;  1XFW A;  2OVX A;  3LE9 A;  1KUH A;  3G42 A;  2OW1 A;  3F16 A;  3O64 A;  3CKI A;  3OHO A;  1K7Q A;  3F17 A;  2CKI A;  830C A;  3LJT A;  2OY4 A;  1GO8 P;  3DWB A;  3DL1 A;  3DNG A;  2XS4 A;  3EDG A;  1JAP A;  1JKY A;  2DW2 A;  1MMQ A;  1XFZ A;  4PKS A;  3VI1 A;  4L6T A;  3B8Z A;  1MMB A;  1D8F A;  3KMC A;  1D8M A;  3LQB A;  3SHI A;  5I43 A;  1SAT A;  3AIG A;  1KUF A;  2FV5 A;  4JA1 A;  1XUR A;  2OW0 A;  1R1H A;  4FXY P;  2ERO A;  2D1N A;  1JAO A;  1HTD A;  1Y93 A;  2JT5 A;  3ZXH A;  1ZXC A;  3ZUK A;  4DF9 A;  1PWW A;  1RM8 A;  3RTT A;  1BQQ M;  1GXD A;  1HFS A;  3F19 A;  3LIR A;  3HBU P;  1L6J A;  1EAK A;  3DPE A;  2W13 A;  2X3C A;  1HFC A;  3BA0 A;  1IAA A;  2X7M A;  1AKL A;  1KUG A;  2JNP A;  4DPE A;  4J4M A;  1ZVX A;  2PJT A;  1KUI A;  1G49 A;  4GWM A;  4JPA A;  2DDF A;  1ZTQ A;  4GR8 A;  3HB2 P;  3UVC A;  1WNI A;  3MA2 A;  1B3D A;  3HY9 A;  3KRY A;  4XM7 A;  2YUF A;  3AYK A;  5D1T A;  4HX3 A;  1CGF A;  1GKC A;  4WF6 A;  1BQO A;  1BM6 A;  2V4B A;  4XBH A;  3DPF A;  1IAG A;  4GF1 A;  3DTK A;  2J0T A;  4XM6 A;  1IAB A;  1OMJ A;  4Q1L A;  3Q2H A;  2OXW A;  2AYK A;  1PWP A;  5I2Z A;  1R55 A;  2Z2D A;  3HDB A;  1ND1 A;  1SLM A;  1IAC A;  2MZE A;  1OM8 A;  3P1V A;  1PWU A;  1OS9 A;  1C8T A;  1G12 A;  2SRT A;  4ON1 A;  2W12 A;  966C A;  1JAN A;  5H8X A;  5B5P A;  2YIG A;  4JQG A;  1CGE A;  3O2X A;  3VTG A;  2RJQ A;  4AXQ A;  1I76 A;  3F15 A;  3HDA P;  2QPJ A;  1JIZ A;  3HY7 A;  1JH1 A;  5D3C A;  3LQ0 A;  4FU4 A;  4XCT A;  1KBC A;  3RTS A;  2Y6D A;  1EUB A;  3G5C A;  4JIJ A;  3LJZ A;  3B92 A;  2MLS A;  1B8Y A;  2OW9 A;  2W14 A;  1XFX A;  4A7B A;  1D7X A;  3B2Z A;  5D7W A;  4H49 A;  1K7I A;  2KRJ A;  4JP4 A;  3HYG A;  1UMT A;  3F1A A;  3I7I A;  2W15 A;  1USN A;  4FVL A;  1QIA A;  1SMP A;  1ROS A;  1FLS A;  4I35 A;  1JK3 A;  4PKU A;  2DW0 A;  3L0T A;  2E2D A;  4HMA A;  5I3M A;  1UMS A;  4PKV A;  4WZV A;  3WV2 A;  2E3X A;  1ZS0 A;  2OY2 A;  5D1S A;  5I12 A;  1O0T A;  4H84 A;  1QIB A;  1XUD A;  1PWV A;  3K7N A;  456C A;  3LUN A;  3LUM A;  4XM8 A;  1HOV A;  4G9L A;  3AYU A;  1BUD A;  1QJJ A;  1SRP A;  3KEC A;  4ILW D;  2A8H A;  4H2E A;  1G4K A;  3KHI A;  1HV5 A;  4PKT A;  5I0L A;  1CGL A;  1JAQ A;  1BZS A;  1R1I A;  3DTE A;  2MZH A;  1Y0V A;  1H71 P;  3EDZ A;  1QIC A;  1BKC I;  1KAP P;  2WOA A;  5BOT A;  2K9C A;  1D5J A;  1SLN A;  5CUH A;  1BIW A;  5I4O A;  4H3X A;  4I03 A;  4L63 A;  1CXV A;  1J7N A;  1O0Q A;  5CXA A;  1GE6 A;  5D1U A;  1UEA A;  3LK8 A;  1G9K A;  3ZVS A;  4R3V A;  5L7F A;  3KME A;  3DSL A;  3DTI A;  2J83 A;  4CTH A;  4FXQ A;  1R54 A;  1MNC A;  1OM6 A;  1BKC A;  4PKR A;  1CK7 A;  2JSD A;  1R1J A;  4GQL A;  1Q3A A;  3KWV C;  1Z3J A;  4WKE A;  3WV1 A;  1BUV M;  1UTZ A;  2X3A A;  2TCL A;  1ATL A;  1XUC A;  4WKI A;  1Y8J A;  3LKA A;  3U1R A;  1SU3 A;  1UTT A;  1YCM A;  4L19 A;  2OW2 A;  2HU6 A;  1A86 A;  1XFY A;  1G05 A;  2WO9 A;  1YP1 A;  4A3W A;  1GE5 A;  1I1I P;  1MMP A;  1IAD A;  3EDH A;  2MZI A;  5B5O A;  3EHX A;  1GKD A;  2POJ A;  2I47 A;  3LGP A;  1JIW P;  4GWN A;  1GO7 P;  5BOY A;  1EB6 A;  1GE7 A;  3LJG A;  2OXZ A;  4H1Q A;  2ERQ A;  1CAQ A;  3EHY A;  2YB9 A;  4GUY A;  3TT4 A;  5BPA A;  1C7K A;  1OM7 A;  1AYK A;  1MMR A;  1QUA A;  3LMC A;  1JJ9 A;  4WK7 A;  2OVZ A;  2O36 A;  3Q2G A;  1CQR A;  4AUO A;  2FV9 A;  4H82 A;  1C3I A;  1PWQ A;  3LIL A;  3OHL A;  4PKW A;  1KUK A;  2DDY A;  1OO9 A;  1DMT A;  3E8R A;  3L0V A;  1YQY A;  3WV3 A;  4DV8 A;  1CIZ A;  3N2V A;  4DD8 A;  3LEA A;  4AYK A;  4IUW A;  3N2U A;  2L0R A;  1K7G A;  5L79 A;  3TVC A;  4IJO A;  4PKQ A;  3EWJ A;  3V96 B;  1RMZ A;  3I7G A;  2ERP A;  3NX7 A;  5CZM A;  1BKC E;  2O3E A;  5D2B A;  4GR0 A;  2Y6C A;  1S4B P;  1ZP5 A;  3USN A;  4QKZ A;  4H30 A;  1OS2 A;  3TS4 A;  2W0D A;  5JMY A;  2JIH A;  3P24 A;  4H76 A;  1FM1 A;  2AIG P;  1I73 A;  2X3B A;  2OZR A;  2WO8 A;  3K7L A;  1QJI A;  1AST A;  4G0D A;  1XFV A;  4L7A A;  4ZR5 A;  2XS3 A;  1DTH A;  4GR3 A;  1IAE A;  2OXU A;  2DW1 A;  2CLT A;  3KEJ A;  3TSK A;  3F18 A;  4EFS A;  1FBL A;  3GBO A;  3ELM A;  1BSW A;  2USN A;  4IN9 A;  3EDI A;  1ZXV A;  2N8R A;  1YOU A;  1XFU A;  3LIK A;  1A85 A;  3HBV P;  2MLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...