2W13A

High-resolution crystal structure of the p-i snake venom metalloproteinase bap1 in complex with a peptidomimetic: insights into inhibitor binding
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
202
structure length
202
Chain Sequence
ERFSPRYIELAVVADHGIFTKYNSNLNTIRTRVHEMLNTVNGFYRSVDVHAPLANLEVWSKQDLIKVQKDSSKTLKSFGEWRERDLLPRISHDHAQLLTAVVFDGNTIGRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNLGIHHDTGSCSCGAKSCIMASVLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC METALLOPROTEINASE BAP1
publication title High-Resolution Crystal Structure of the Snake Venom Metalloproteinase Bap1 Complexed with a Peptidomimetic: Insight Into Inhibitor Binding.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 81
structure length 202
sequence length 202
ec nomenclature ec 3.4.24.-:
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2w13A00
1C7KA 2K9CA 2FV5A 1JKYA 2X3BA 3MA2A 1D5JA 3DWBA 4L63A 3U1RA 3EDGA 5I4OA 2TCLA 2MZIA 5I43A 1BZSA 1ZXCA 1USNA 3WV2A 1I76A 2D1NA 1K7GA 1ZVXA 1FBLA 1MMBA 4XCTA 2JNPA 1OM7A 1MMPA 2A8HA 1QUAA 5D1SA 1MMQA 2J0TA 3LUMA 2PJTA 1ZTQA 1IACA 1KAPP 1FLSA 3EWJA 1CK7A 2O3EA 1J7NA 3HB2P 2OVZA 2X3CA 3K7LA 3KECA 3HDAP 1R55A 1XURA 2O36A 4GQLA 3L0VA 1YOUA 1K7IA 2WOAA 5BOTA 4H84A 3Q2HA 5I2ZA 2V4BA 3HBUP 4ON1A 1D7XA 1QJIA 4WZVA 2JSDA 1R1IA 3TSKA 4FXQA 5LABA 1BQQM 1YCMA 2POJA 4H76A 1FM1A 1G12A 3USNA 3B2ZA 1CAQA 1G9KA 1K7QA 5B5OA 3LJGA 2WO8A 3DNGA 4AYKA 1CIZA 2XS4A 1CGLA 1Y8JA 1EB6A 4H3XA 4HX3A 3G5CA 1ZS0A 1Y93A 5H8XA 1JIZA 1EUBA 2OZRA 3LKAA 5D7WA 3SHIA 1SATA 5CXAA 4I03A 3HBVP 3B8ZA 4FVLA 1JAPA 2W12A 3KHIA 1GO7P 4CTHA 3F17A 3AYUA 3LQBA 2DW2A 4XM6A 3KMEA 2OI0A 3OHLA 3ZXHA 4GF1A 2WO9A 1AKLA 1BM6A 1EAKA 4ILWD 2KRJA 2E2DA 2XS3A 1IAGA 3HY9A 1IAEA 3ZVSA 1SRPA 3LUNA 1C8TA 1PWQA 2JT6A 1MMRA 3KWVC 1BUDA 1Z3JA 3G42A 1KUFA 4JPAA 5BPAA 1JAQA 4H2EA 2MLRA 4AIGA 2X7MA 2RJQA 2N8RA 1O0QA 1UTTA 1CGFA 1XFUA 4H49A 3HYGA 3F1AA 4DD8A 4GUYA 4Q1LA 1B3DA 2J83A 1BUVM 830CA 1B8YA 3TT4A 3F19A 3WV3A 1XFWA 1I1IP 2JT5A 2Y6CA 3F16A 4PKRA 1G4KA 3LMCA 4PKQA 1MNCA 1SLMA 1YQYA 1HOVA 3Q2GA 1JH1A 5D3CA 2D1OA 3TVCA 3N2VA 1QICA 1O0TA 1R54A 2HU6A 2YIGA 1OS2A 1GO8P 3KRYA 4FXYP 3P1VA 1PWWA 2USNA 1JANA 4PKUA 1HTDA 1OS9A 1XFXA 1KUHA 4HMAA 2JIHA 4AUOA 3DPEA 4DF9A 1UMTA 3LQ0A 2OW0A 4WKEA 3GBOA 5I3MA 1R1JA 3I7GA 4GWMA 1ND1A 1UTZA 1PWUA 3HY7A 3F18A 3N2UA 3RTSA 4H82A 2FV9A 4R3VA 4JA1A 4PKVA 3F15A 2W13A 1SU3A 2ERQA 3AIGA 3LIRA 1L6JA 4JP4A 3LJZA 4JQGA 2CKIA 3VI1A 4WKIA 2I47A 4L6TA 1KUIA 1BKCI 1KUKA 3O64A 2CLTA 1JAOA 2OXUA 1GE7A 3WV1A 2DW0A 3VTGA 4DV8A 1IABA 2K2GA 1SMPA 1ASTA 5CUHA 2OVXA 1OM6A 2OY2A 1PWPA 1CXVA 4EFSA 2ERPA 1CGEA 2L0RA 2MLSA 2W15A 4XM8A 4H1QA 2DW1A 1ZP5A 3EHYA 1IAAA 1XFZA 1QIBA 3LE9A 2MZEA 1CQRA 1UMSA 2OW9A 1KUGA 1XUDA 3LJTA 1OM8A 3OHOA 4G0DA 4A3WA 1AF0A 1AYKA 2E3XA 3KEKA 1G49A 2OW2A 1RM8A 1I73A 2EROA 2Y6DA 4GR8A 5BOYA 4GR3A 2X3AA 1SLNA 3DPFA 3DSLA 5JMYA 2OW1A 1ATLA 5D1UA 1JIWP 4PKWA 1BKCE 1BQOA 1UEAA 1OO9A 4L19A 3ELMA 3K7NA 1HFSA 4FU4A 4PKTA 5CZMA 3BA0A 4XM7A 3I7IA 1OMJA 4IJOA 2DDYA 3UVCA 2DDFA 966CA 1XUCA 4DPEA 1JK3A 1GXDA 3LIKA 1DMTA 1D8FA 3L0TA 2OXWA 1D8MA 3KMCA 1HY7A 1KBCA 1BSWA 2W14A 1QJJA 5D2BA 3EHXA 456CA 1YP1A 3E8RA 5I0LA 2OXZA 4IUWA 2SRTA 1DTHA 1HV5A 1GKDA 3EDIA 1IADA 3CKIA 4GWNA 1Y0VA 4JIJA 3EDZA 4PKSA 4G9LA 1ROSA 2W0DA 4WF6A 3LK8A 3ZUKA 4QKZA 4AXQA 1R1HA 3HDBA 3KEJA 3LILA 5L79A 1Q3AA 4I35A 4XBHA 5I12A 3LGPA 3P24A 4ZR5A 1XFYA 2Z2DA 1GE5A 2MZHA 1G05A 4J4MA 1WNIA 1GKCA 3AYKA 4WK7A 5D1TA 1H71P 1A86A 3DL1A 2QPJA 1PWVA 1BKCA 3EDHA 1BIWA 3TS4A 4GR0A 1XFVA 4H30A 1QIAA 1GE6A 1HFCA 3NX7A 2RJPA 3RTTA 3O2XA 3B92A 1ZXVA 2AYKA 2YB9A 1A85A 3LEAA 3V96B 1C3IA 1RMZA 4IN9A 2OY4A 5L7FA 4A7BA 5B5PA 1S4BP 2AIGP 1JJ9A
chains in the Genus database with same CATH superfamily
1C7KA 2K9CA 2FV5A 1JKYA 2X3BA 3MA2A 1D5JA 3DWBA 4L63A 3U1RA 3EDGA 5I4OA 2TCLA 2MZIA 5I43A 1BZSA 1ZXCA 1USNA 3WV2A 1I76A 2D1NA 1K7GA 1ZVXA 1FBLA 1MMBA 4XCTA 2JNPA 1OM7A 1MMPA 2A8HA 1QUAA 5D1SA 1MMQA 2J0TA 3LUMA 2PJTA 1ZTQA 3DTEA 1IACA 1KAPP 4L7AA 1FLSA 3EWJA 1CK7A 2O3EA 1J7NA 3HB2P 2OVZA 2X3CA 3K7LA 3KECA 3HDAP 1R55A 1XURA 2O36A 4GQLA 3L0VA 1YOUA 1K7IA 1TVIA 2WOAA 5BOTA 4H84A 3Q2HA 5I2ZA 2V4BA 3HBUP 4ON1A 1D7XA 1QJIA 4WZVA 2JSDA 1R1IA 3TSKA 4FXQA 5LABA 1BQQM 1YCMA 2POJA 4H76A 1FM1A 1G12A 3USNA 3B2ZA 1CAQA 1G9KA 2YUFA 1K7QA 5B5OA 3LJGA 2WO8A 3DNGA 4AYKA 1CIZA 2XS4A 1CGLA 1Y8JA 1EB6A 4H3XA 4HX3A 3G5CA 1ZS0A 1Y93A 5H8XA 1JIZA 1EUBA 2OZRA 3LKAA 5D7WA 3SHIA 1SATA 5CXAA 4I03A 3HBVP 3B8ZA 4FVLA 1JAPA 2W12A 3KHIA 1GO7P 4CTHA 3F17A 3AYUA 3LQBA 2DW2A 4XM6A 3KMEA 2OI0A 3OHLA 3ZXHA 4GF1A 2WO9A 1AKLA 1BM6A 1EAKA 4ILWD 2KRJA 2E2DA 2XS3A 1IAGA 3HY9A 1IAEA 3ZVSA 1SRPA 3LUNA 1C8TA 1PWQA 2JT6A 1MMRA 3KWVC 1BUDA 1Z3JA 3G42A 1KUFA 4JPAA 5BPAA 1JAQA 4H2EA 2MLRA 4AIGA 2X7MA 2RJQA 2N8RA 1O0QA 1UTTA 1CGFA 1XFUA 4H49A 3HYGA 3F1AA 1OZ9A 4DD8A 4GUYA 4Q1LA 1B3DA 2J83A 1BUVM 830CA 1B8YA 3TT4A 3F19A 3WV3A 1XFWA 1I1IP 2JT5A 2Y6CA 3F16A 4PKRA 1G4KA 3LMCA 4PKQA 1MNCA 1SLMA 1YQYA 3DTIA 1HOVA 3Q2GA 1JH1A 5D3CA 2D1OA 3TVCA 3N2VA 1QICA 1O0TA 1R54A 2HU6A 3DTKA 2YIGA 1OS2A 1GO8P 3KRYA 4FXYP 3P1VA 1PWWA 2USNA 1JANA 4PKUA 1HTDA 1OS9A 1XFXA 1KUHA 4HMAA 2JIHA 4AUOA 3DPEA 4DF9A 1UMTA 3LQ0A 2OW0A 4WKEA 3GBOA 5I3MA 1R1JA 3I7GA 4GWMA 1ND1A 1UTZA 1PWUA 3HY7A 3F18A 3N2UA 3RTSA 4H82A 1XM5A 2FV9A 4R3VA 4JA1A 4PKVA 3F15A 2W13A 1SU3A 2ERQA 3AIGA 3LIRA 1L6JA 4JP4A 3LJZA 4JQGA 2CKIA 3VI1A 4WKIA 2I47A 4L6TA 1KUIA 1BKCI 1KUKA 3O64A 2CLTA 1JAOA 2OXUA 1GE7A 3WV1A 2DW0A 3VTGA 4DV8A 1IABA 2K2GA 1SMPA 1ASTA 5CUHA 2OVXA 1OM6A 2OY2A 1PWPA 1CXVA 4EFSA 2ERPA 1CGEA 2L0RA 2MLSA 2W15A 4XM8A 4H1QA 2DW1A 1ZP5A 3EHYA 1IAAA 1XFZA 1QIBA 3LE9A 2MZEA 1CQRA 1UMSA 2OW9A 1KUGA 1XUDA 3LJTA 1OM8A 3OHOA 4G0DA 4A3WA 1AF0A 1AYKA 2E3XA 3KEKA 1G49A 2OW2A 1RM8A 1I73A 2EROA 2Y6DA 4GR8A 5BOYA 4GR3A 2X3AA 1XAXA 1SLNA 3DPFA 3DSLA 5JMYA 2OW1A 1ATLA 5D1UA 1JIWP 4PKWA 1BKCE 1BQOA 1UEAA 1OO9A 4L19A 3ELMA 3K7NA 1HFSA 4FU4A 4PKTA 5CZMA 3BA0A 4XM7A 3I7IA 1OMJA 4IJOA 2DDYA 3UVCA 2DDFA 966CA 1XUCA 4DPEA 1JK3A 1GXDA 3LIKA 1DMTA 1D8FA 3L0TA 2OXWA 1D8MA 3KMCA 1HY7A 1KBCA 1BSWA 2W14A 1QJJA 5D2BA 3EHXA 456CA 1YP1A 3E8RA 5I0LA 2OXZA 4IUWA 2SRTA 1DTHA 1HV5A 1GKDA 3EDIA 1IADA 3CKIA 4GWNA 1Y0VA 4JIJA 3EDZA 4PKSA 4G9LA 1ROSA 2W0DA 4WF6A 3LK8A 3ZUKA 4QKZA 4AXQA 1R1HA 3HDBA 3KEJA 3LILA 5L79A 1Q3AA 4I35A 4XBHA 5I12A 3LGPA 3P24A 4ZR5A 1XFYA 2Z2DA 1GE5A 2MZHA 1G05A 4J4MA 1WNIA 1GKCA 3AYKA 4WK7A 5D1TA 1H71P 1A86A 3DL1A 2QPJA 1PWVA 1BKCA 3EDHA 1BIWA 3TS4A 4GR0A 1XFVA 4H30A 1QIAA 1GE6A 1HFCA 3NX7A 2RJPA 3RTTA 3O2XA 3B92A 1ZXVA 2AYKA 2YB9A 1A85A 3LEAA 3V96B 1C3IA 1RMZA 4IN9A 2OY4A 5L7FA 4A7BA 5B5PA 1S4BP 2AIGP 1JJ9A
chains in the Genus database with same CATH topology
1C7KA 2K9CA 2FV5A 1JKYA 2X3BA 3MA2A 1D5JA 3DWBA 4L63A 3U1RA 3EDGA 5I4OA 2TCLA 2MZIA 5I43A 1BZSA 1ZXCA 1USNA 3WV2A 1I76A 2D1NA 1K7GA 1ZVXA 1FBLA 1MMBA 4XCTA 2JNPA 1OM7A 1MMPA 2A8HA 1QUAA 5D1SA 1MMQA 2J0TA 3LUMA 2PJTA 1ZTQA 3DTEA 1IACA 1KAPP 4L7AA 1FLSA 3EWJA 1CK7A 2O3EA 1J7NA 3HB2P 2OVZA 2X3CA 3K7LA 3KECA 3HDAP 1R55A 1XURA 2O36A 4GQLA 3L0VA 1YOUA 1K7IA 2WOAA 5BOTA 4H84A 3Q2HA 5I2ZA 2V4BA 3HBUP 4ON1A 1D7XA 1QJIA 4WZVA 2JSDA 1R1IA 3TSKA 4FXQA 5LABA 1BQQM 1YCMA 2POJA 4H76A 1FM1A 1G12A 3USNA 3B2ZA 1CAQA 1G9KA 2YUFA 1K7QA 5B5OA 3LJGA 2WO8A 3DNGA 4AYKA 1CIZA 2XS4A 1CGLA 1Y8JA 1EB6A 4H3XA 4HX3A 3G5CA 1ZS0A 1Y93A 5H8XA 1JIZA 1EUBA 2OZRA 3LKAA 5D7WA 3SHIA 1SATA 5CXAA 4I03A 3HBVP 3B8ZA 4FVLA 1JAPA 2W12A 3KHIA 1GO7P 4CTHA 3F17A 3AYUA 3LQBA 2DW2A 4XM6A 3KMEA 2OI0A 3OHLA 3ZXHA 4GF1A 2WO9A 1AKLA 1BM6A 1EAKA 4ILWD 2KRJA 2E2DA 2XS3A 1IAGA 3HY9A 1IAEA 3ZVSA 1SRPA 3LUNA 1C8TA 1PWQA 2JT6A 1MMRA 3KWVC 1BUDA 1Z3JA 3G42A 1KUFA 4JPAA 5BPAA 1JAQA 4H2EA 2MLRA 4AIGA 2X7MA 2RJQA 2N8RA 1O0QA 1UTTA 1CGFA 1XFUA 4H49A 3HYGA 3F1AA 4DD8A 4GUYA 4Q1LA 1B3DA 2J83A 1BUVM 830CA 1B8YA 3TT4A 3F19A 3WV3A 1XFWA 1I1IP 2JT5A 2Y6CA 3F16A 4PKRA 1G4KA 3LMCA 4PKQA 1MNCA 1SLMA 1YQYA 3DTIA 1HOVA 3Q2GA 1JH1A 5D3CA 2D1OA 3TVCA 3N2VA 1QICA 1O0TA 1R54A 2HU6A 3DTKA 2YIGA 1OS2A 1GO8P 3KRYA 4FXYP 3P1VA 1PWWA 2USNA 1JANA 4PKUA 1HTDA 1OS9A 1XFXA 1KUHA 4HMAA 2JIHA 4AUOA 3DPEA 4DF9A 1UMTA 3LQ0A 2OW0A 4WKEA 3GBOA 5I3MA 1R1JA 3I7GA 4GWMA 1ND1A 1UTZA 1PWUA 3HY7A 3F18A 3N2UA 3RTSA 4H82A 2FV9A 4R3VA 4JA1A 4PKVA 3F15A 2W13A 1SU3A 2ERQA 3AIGA 3LIRA 1L6JA 4JP4A 3LJZA 4JQGA 2CKIA 3VI1A 4WKIA 2I47A 4L6TA 1KUIA 1BKCI 1KUKA 3O64A 2CLTA 1JAOA 2OXUA 1GE7A 3WV1A 2DW0A 3VTGA 4DV8A 1IABA 2K2GA 1SMPA 1ASTA 5CUHA 2OVXA 1OM6A 2OY2A 1PWPA 1CXVA 4EFSA 2ERPA 1CGEA 2L0RA 2MLSA 2W15A 4XM8A 4H1QA 2DW1A 1ZP5A 3EHYA 1IAAA 1XFZA 1QIBA 3LE9A 2MZEA 1CQRA 1UMSA 2OW9A 1KUGA 1XUDA 3LJTA 1OM8A 3OHOA 4G0DA 4A3WA 1AF0A 1AYKA 2E3XA 3KEKA 1G49A 2OW2A 1RM8A 1I73A 2EROA 2Y6DA 4GR8A 5BOYA 4GR3A 2X3AA 1SLNA 3DPFA 3DSLA 5JMYA 2OW1A 1ATLA 5D1UA 1JIWP 4PKWA 1BKCE 1BQOA 1UEAA 1OO9A 4L19A 3ELMA 3K7NA 1HFSA 4FU4A 4PKTA 5CZMA 3BA0A 4XM7A 3I7IA 1OMJA 4IJOA 2DDYA 3UVCA 2DDFA 966CA 1XUCA 4DPEA 1JK3A 1GXDA 3LIKA 1DMTA 1D8FA 3L0TA 2OXWA 1D8MA 3KMCA 1HY7A 1KBCA 1BSWA 2W14A 1QJJA 5D2BA 3EHXA 456CA 1YP1A 3E8RA 5I0LA 2OXZA 4IUWA 2SRTA 1DTHA 1HV5A 1GKDA 3EDIA 1IADA 3CKIA 4GWNA 1Y0VA 4JIJA 3EDZA 4PKSA 4G9LA 1ROSA 2W0DA 4WF6A 3LK8A 3ZUKA 4QKZA 4AXQA 1R1HA 3HDBA 3KEJA 3LILA 5L79A 1Q3AA 4I35A 4XBHA 5I12A 3LGPA 3P24A 4ZR5A 1XFYA 2Z2DA 1GE5A 2MZHA 1G05A 4J4MA 1WNIA 1GKCA 3AYKA 4WK7A 5D1TA 1H71P 1A86A 3DL1A 2QPJA 1PWVA 1BKCA 3EDHA 1BIWA 3TS4A 4GR0A 1XFVA 4H30A 1QIAA 1GE6A 1HFCA 3NX7A 2RJPA 3RTTA 3O2XA 3B92A 1ZXVA 2AYKA 2YB9A 1A85A 3LEAA 3V96B 1C3IA 1RMZA 4IN9A 2OY4A 5L7FA 4A7BA 5B5PA 1S4BP 2AIGP 1JJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7K A;  2K9C A;  2FV5 A;  1JKY A;  2X3B A;  3MA2 A;  1D5J A;  3DWB A;  4L63 A;  3U1R A;  3EDG A;  5I4O A;  2TCL A;  2MZI A;  5I43 A;  1BZS A;  1ZXC A;  1USN A;  3WV2 A;  1I76 A;  2D1N A;  1K7G A;  1ZVX A;  1FBL A;  1MMB A;  4XCT A;  2JNP A;  1OM7 A;  1MMP A;  2A8H A;  1QUA A;  5D1S A;  1MMQ A;  2J0T A;  3LUM A;  2PJT A;  1ZTQ A;  1IAC A;  1KAP P;  1FLS A;  3EWJ A;  1CK7 A;  2O3E A;  1J7N A;  3HB2 P;  2OVZ A;  2X3C A;  3K7L A;  3KEC A;  3HDA P;  1R55 A;  1XUR A;  2O36 A;  4GQL A;  3L0V A;  1YOU A;  1K7I A;  2WOA A;  5BOT A;  4H84 A;  3Q2H A;  5I2Z A;  2V4B A;  3HBU P;  4ON1 A;  1D7X A;  1QJI A;  4WZV A;  2JSD A;  1R1I A;  3TSK A;  4FXQ A;  5LAB A;  1BQQ M;  1YCM A;  2POJ A;  4H76 A;  1FM1 A;  1G12 A;  3USN A;  3B2Z A;  1CAQ A;  1G9K A;  1K7Q A;  5B5O A;  3LJG A;  2WO8 A;  3DNG A;  4AYK A;  1CIZ A;  2XS4 A;  1CGL A;  1Y8J A;  1EB6 A;  4H3X A;  4HX3 A;  3G5C A;  1ZS0 A;  1Y93 A;  5H8X A;  1JIZ A;  1EUB A;  2OZR A;  3LKA A;  5D7W A;  3SHI A;  1SAT A;  5CXA A;  4I03 A;  3HBV P;  3B8Z A;  4FVL A;  1JAP A;  2W12 A;  3KHI A;  1GO7 P;  4CTH A;  3F17 A;  3AYU A;  3LQB A;  2DW2 A;  4XM6 A;  3KME A;  2OI0 A;  3OHL A;  3ZXH A;  4GF1 A;  2WO9 A;  1AKL A;  1BM6 A;  1EAK A;  4ILW D;  2KRJ A;  2E2D A;  2XS3 A;  1IAG A;  3HY9 A;  1IAE A;  3ZVS A;  1SRP A;  3LUN A;  1C8T A;  1PWQ A;  2JT6 A;  1MMR A;  3KWV C;  1BUD A;  1Z3J A;  3G42 A;  1KUF A;  4JPA A;  5BPA A;  1JAQ A;  4H2E A;  2MLR A;  4AIG A;  2X7M A;  2RJQ A;  2N8R A;  1O0Q A;  1UTT A;  1CGF A;  1XFU A;  4H49 A;  3HYG A;  3F1A A;  4DD8 A;  4GUY A;  4Q1L A;  1B3D A;  2J83 A;  1BUV M;  830C A;  1B8Y A;  3TT4 A;  3F19 A;  3WV3 A;  1XFW A;  1I1I P;  2JT5 A;  2Y6C A;  3F16 A;  4PKR A;  1G4K A;  3LMC A;  4PKQ A;  1MNC A;  1SLM A;  1YQY A;  1HOV A;  3Q2G A;  1JH1 A;  5D3C A;  2D1O A;  3TVC A;  3N2V A;  1QIC A;  1O0T A;  1R54 A;  2HU6 A;  2YIG A;  1OS2 A;  1GO8 P;  3KRY A;  4FXY P;  3P1V A;  1PWW A;  2USN A;  1JAN A;  4PKU A;  1HTD A;  1OS9 A;  1XFX A;  1KUH A;  4HMA A;  2JIH A;  4AUO A;  3DPE A;  4DF9 A;  1UMT A;  3LQ0 A;  2OW0 A;  4WKE A;  3GBO A;  5I3M A;  1R1J A;  3I7G A;  4GWM A;  1ND1 A;  1UTZ A;  1PWU A;  3HY7 A;  3F18 A;  3N2U A;  3RTS A;  4H82 A;  2FV9 A;  4R3V A;  4JA1 A;  4PKV A;  3F15 A;  2W13 A;  1SU3 A;  2ERQ A;  3AIG A;  3LIR A;  1L6J A;  4JP4 A;  3LJZ A;  4JQG A;  2CKI A;  3VI1 A;  4WKI A;  2I47 A;  4L6T A;  1KUI A;  1BKC I;  1KUK A;  3O64 A;  2CLT A;  1JAO A;  2OXU A;  1GE7 A;  3WV1 A;  2DW0 A;  3VTG A;  4DV8 A;  1IAB A;  2K2G A;  1SMP A;  1AST A;  5CUH A;  2OVX A;  1OM6 A;  2OY2 A;  1PWP A;  1CXV A;  4EFS A;  2ERP A;  1CGE A;  2L0R A;  2MLS A;  2W15 A;  4XM8 A;  4H1Q A;  2DW1 A;  1ZP5 A;  3EHY A;  1IAA A;  1XFZ A;  1QIB A;  3LE9 A;  2MZE A;  1CQR A;  1UMS A;  2OW9 A;  1KUG A;  1XUD A;  3LJT A;  1OM8 A;  3OHO A;  4G0D A;  4A3W A;  1AF0 A;  1AYK A;  2E3X A;  3KEK A;  1G49 A;  2OW2 A;  1RM8 A;  1I73 A;  2ERO A;  2Y6D A;  4GR8 A;  5BOY A;  4GR3 A;  2X3A A;  1SLN A;  3DPF A;  3DSL A;  5JMY A;  2OW1 A;  1ATL A;  5D1U A;  1JIW P;  4PKW A;  1BKC E;  1BQO A;  1UEA A;  1OO9 A;  4L19 A;  3ELM A;  3K7N A;  1HFS A;  4FU4 A;  4PKT A;  5CZM A;  3BA0 A;  4XM7 A;  3I7I A;  1OMJ A;  4IJO A;  2DDY A;  3UVC A;  2DDF A;  966C A;  1XUC A;  4DPE A;  1JK3 A;  1GXD A;  3LIK A;  1DMT A;  1D8F A;  3L0T A;  2OXW A;  1D8M A;  3KMC A;  1HY7 A;  1KBC A;  1BSW A;  2W14 A;  1QJJ A;  5D2B A;  3EHX A;  456C A;  1YP1 A;  3E8R A;  5I0L A;  2OXZ A;  4IUW A;  2SRT A;  1DTH A;  1HV5 A;  1GKD A;  3EDI A;  1IAD A;  3CKI A;  4GWN A;  1Y0V A;  4JIJ A;  3EDZ A;  4PKS A;  4G9L A;  1ROS A;  2W0D A;  4WF6 A;  3LK8 A;  3ZUK A;  4QKZ A;  4AXQ A;  1R1H A;  3HDB A;  3KEJ A;  3LIL A;  5L79 A;  1Q3A A;  4I35 A;  4XBH A;  5I12 A;  3LGP A;  3P24 A;  4ZR5 A;  1XFY A;  2Z2D A;  1GE5 A;  2MZH A;  1G05 A;  4J4M A;  1WNI A;  1GKC A;  3AYK A;  4WK7 A;  5D1T A;  1H71 P;  1A86 A;  3DL1 A;  2QPJ A;  1PWV A;  1BKC A;  3EDH A;  1BIW A;  3TS4 A;  4GR0 A;  1XFV A;  4H30 A;  1QIA A;  1GE6 A;  1HFC A;  3NX7 A;  2RJP A;  3RTT A;  3O2X A;  3B92 A;  1ZXV A;  2AYK A;  2YB9 A;  1A85 A;  3LEA A;  3V96 B;  1C3I A;  1RMZ A;  4IN9 A;  2OY4 A;  5L7F A;  4A7B A;  5B5P A;  1S4B P;  2AIG P;  1JJ9 A; 
#chains in the Genus database with same CATH topology
 1C7K A;  2K9C A;  2FV5 A;  1JKY A;  2X3B A;  3MA2 A;  1D5J A;  3DWB A;  4L63 A;  3U1R A;  3EDG A;  5I4O A;  2TCL A;  2MZI A;  5I43 A;  1BZS A;  1ZXC A;  1USN A;  3WV2 A;  1I76 A;  2D1N A;  1K7G A;  1ZVX A;  1FBL A;  1MMB A;  4XCT A;  2JNP A;  1OM7 A;  1MMP A;  2A8H A;  1QUA A;  5D1S A;  1MMQ A;  2J0T A;  3LUM A;  2PJT A;  1ZTQ A;  3DTE A;  1IAC A;  1KAP P;  4L7A A;  1FLS A;  3EWJ A;  1CK7 A;  2O3E A;  1J7N A;  3HB2 P;  2OVZ A;  2X3C A;  3K7L A;  3KEC A;  3HDA P;  1R55 A;  1XUR A;  2O36 A;  4GQL A;  3L0V A;  1YOU A;  1K7I A;  1TVI A;  2WOA A;  5BOT A;  4H84 A;  3Q2H A;  5I2Z A;  2V4B A;  3HBU P;  4ON1 A;  1D7X A;  1QJI A;  4WZV A;  2JSD A;  1R1I A;  3TSK A;  4FXQ A;  5LAB A;  1BQQ M;  1YCM A;  2POJ A;  4H76 A;  1FM1 A;  1G12 A;  3USN A;  3B2Z A;  1CAQ A;  1G9K A;  2YUF A;  1K7Q A;  5B5O A;  3LJG A;  2WO8 A;  3DNG A;  4AYK A;  1CIZ A;  2XS4 A;  1CGL A;  1Y8J A;  1EB6 A;  4H3X A;  4HX3 A;  3G5C A;  1ZS0 A;  1Y93 A;  5H8X A;  1JIZ A;  1EUB A;  2OZR A;  3LKA A;  5D7W A;  3SHI A;  1SAT A;  5CXA A;  4I03 A;  3HBV P;  3B8Z A;  4FVL A;  1JAP A;  2W12 A;  3KHI A;  1GO7 P;  4CTH A;  3F17 A;  3AYU A;  3LQB A;  2DW2 A;  4XM6 A;  3KME A;  2OI0 A;  3OHL A;  3ZXH A;  4GF1 A;  2WO9 A;  1AKL A;  1BM6 A;  1EAK A;  4ILW D;  2KRJ A;  2E2D A;  2XS3 A;  1IAG A;  3HY9 A;  1IAE A;  3ZVS A;  1SRP A;  3LUN A;  1C8T A;  1PWQ A;  2JT6 A;  1MMR A;  3KWV C;  1BUD A;  1Z3J A;  3G42 A;  1KUF A;  4JPA A;  5BPA A;  1JAQ A;  4H2E A;  2MLR A;  4AIG A;  2X7M A;  2RJQ A;  2N8R A;  1O0Q A;  1UTT A;  1CGF A;  1XFU A;  4H49 A;  3HYG A;  3F1A A;  1OZ9 A;  4DD8 A;  4GUY A;  4Q1L A;  1B3D A;  2J83 A;  1BUV M;  830C A;  1B8Y A;  3TT4 A;  3F19 A;  3WV3 A;  1XFW A;  1I1I P;  2JT5 A;  2Y6C A;  3F16 A;  4PKR A;  1G4K A;  3LMC A;  4PKQ A;  1MNC A;  1SLM A;  1YQY A;  3DTI A;  1HOV A;  3Q2G A;  1JH1 A;  5D3C A;  2D1O A;  3TVC A;  3N2V A;  1QIC A;  1O0T A;  1R54 A;  2HU6 A;  3DTK A;  2YIG A;  1OS2 A;  1GO8 P;  3KRY A;  4FXY P;  3P1V A;  1PWW A;  2USN A;  1JAN A;  4PKU A;  1HTD A;  1OS9 A;  1XFX A;  1KUH A;  4HMA A;  2JIH A;  4AUO A;  3DPE A;  4DF9 A;  1UMT A;  3LQ0 A;  2OW0 A;  4WKE A;  3GBO A;  5I3M A;  1R1J A;  3I7G A;  4GWM A;  1ND1 A;  1UTZ A;  1PWU A;  3HY7 A;  3F18 A;  3N2U A;  3RTS A;  4H82 A;  1XM5 A;  2FV9 A;  4R3V A;  4JA1 A;  4PKV A;  3F15 A;  2W13 A;  1SU3 A;  2ERQ A;  3AIG A;  3LIR A;  1L6J A;  4JP4 A;  3LJZ A;  4JQG A;  2CKI A;  3VI1 A;  4WKI A;  2I47 A;  4L6T A;  1KUI A;  1BKC I;  1KUK A;  3O64 A;  2CLT A;  1JAO A;  2OXU A;  1GE7 A;  3WV1 A;  2DW0 A;  3VTG A;  4DV8 A;  1IAB A;  2K2G A;  1SMP A;  1AST A;  5CUH A;  2OVX A;  1OM6 A;  2OY2 A;  1PWP A;  1CXV A;  4EFS A;  2ERP A;  1CGE A;  2L0R A;  2MLS A;  2W15 A;  4XM8 A;  4H1Q A;  2DW1 A;  1ZP5 A;  3EHY A;  1IAA A;  1XFZ A;  1QIB A;  3LE9 A;  2MZE A;  1CQR A;  1UMS A;  2OW9 A;  1KUG A;  1XUD A;  3LJT A;  1OM8 A;  3OHO A;  4G0D A;  4A3W A;  1AF0 A;  1AYK A;  2E3X A;  3KEK A;  1G49 A;  2OW2 A;  1RM8 A;  1I73 A;  2ERO A;  2Y6D A;  4GR8 A;  5BOY A;  4GR3 A;  2X3A A;  1XAX A;  1SLN A;  3DPF A;  3DSL A;  5JMY A;  2OW1 A;  1ATL A;  5D1U A;  1JIW P;  4PKW A;  1BKC E;  1BQO A;  1UEA A;  1OO9 A;  4L19 A;  3ELM A;  3K7N A;  1HFS A;  4FU4 A;  4PKT A;  5CZM A;  3BA0 A;  4XM7 A;  3I7I A;  1OMJ A;  4IJO A;  2DDY A;  3UVC A;  2DDF A;  966C A;  1XUC A;  4DPE A;  1JK3 A;  1GXD A;  3LIK A;  1DMT A;  1D8F A;  3L0T A;  2OXW A;  1D8M A;  3KMC A;  1HY7 A;  1KBC A;  1BSW A;  2W14 A;  1QJJ A;  5D2B A;  3EHX A;  456C A;  1YP1 A;  3E8R A;  5I0L A;  2OXZ A;  4IUW A;  2SRT A;  1DTH A;  1HV5 A;  1GKD A;  3EDI A;  1IAD A;  3CKI A;  4GWN A;  1Y0V A;  4JIJ A;  3EDZ A;  4PKS A;  4G9L A;  1ROS A;  2W0D A;  4WF6 A;  3LK8 A;  3ZUK A;  4QKZ A;  4AXQ A;  1R1H A;  3HDB A;  3KEJ A;  3LIL A;  5L79 A;  1Q3A A;  4I35 A;  4XBH A;  5I12 A;  3LGP A;  3P24 A;  4ZR5 A;  1XFY A;  2Z2D A;  1GE5 A;  2MZH A;  1G05 A;  4J4M A;  1WNI A;  1GKC A;  3AYK A;  4WK7 A;  5D1T A;  1H71 P;  1A86 A;  3DL1 A;  2QPJ A;  1PWV A;  1BKC A;  3EDH A;  1BIW A;  3TS4 A;  4GR0 A;  1XFV A;  4H30 A;  1QIA A;  1GE6 A;  1HFC A;  3NX7 A;  2RJP A;  3RTT A;  3O2X A;  3B92 A;  1ZXV A;  2AYK A;  2YB9 A;  1A85 A;  3LEA A;  3V96 B;  1C3I A;  1RMZ A;  4IN9 A;  2OY4 A;  5L7F A;  4A7B A;  5B5P A;  1S4B P;  2AIG P;  1JJ9 A; 
#chains in the Genus database with same CATH homology
 1C7K A;  2K9C A;  2FV5 A;  1JKY A;  2X3B A;  3MA2 A;  1D5J A;  3DWB A;  4L63 A;  3U1R A;  3EDG A;  5I4O A;  2TCL A;  2MZI A;  5I43 A;  1BZS A;  1ZXC A;  1USN A;  3WV2 A;  1I76 A;  2D1N A;  1K7G A;  1ZVX A;  1FBL A;  1MMB A;  4XCT A;  2JNP A;  1OM7 A;  1MMP A;  2A8H A;  1QUA A;  5D1S A;  1MMQ A;  2J0T A;  3LUM A;  2PJT A;  1ZTQ A;  3DTE A;  1IAC A;  1KAP P;  4L7A A;  1FLS A;  3EWJ A;  1CK7 A;  2O3E A;  1J7N A;  3HB2 P;  2OVZ A;  2X3C A;  3K7L A;  3KEC A;  3HDA P;  1R55 A;  1XUR A;  2O36 A;  4GQL A;  3L0V A;  1YOU A;  1K7I A;  2WOA A;  5BOT A;  4H84 A;  3Q2H A;  5I2Z A;  2V4B A;  3HBU P;  4ON1 A;  1D7X A;  1QJI A;  4WZV A;  2JSD A;  1R1I A;  3TSK A;  4FXQ A;  5LAB A;  1BQQ M;  1YCM A;  2POJ A;  4H76 A;  1FM1 A;  1G12 A;  3USN A;  3B2Z A;  1CAQ A;  1G9K A;  2YUF A;  1K7Q A;  5B5O A;  3LJG A;  2WO8 A;  3DNG A;  4AYK A;  1CIZ A;  2XS4 A;  1CGL A;  1Y8J A;  1EB6 A;  4H3X A;  4HX3 A;  3G5C A;  1ZS0 A;  1Y93 A;  5H8X A;  1JIZ A;  1EUB A;  2OZR A;  3LKA A;  5D7W A;  3SHI A;  1SAT A;  5CXA A;  4I03 A;  3HBV P;  3B8Z A;  4FVL A;  1JAP A;  2W12 A;  3KHI A;  1GO7 P;  4CTH A;  3F17 A;  3AYU A;  3LQB A;  2DW2 A;  4XM6 A;  3KME A;  2OI0 A;  3OHL A;  3ZXH A;  4GF1 A;  2WO9 A;  1AKL A;  1BM6 A;  1EAK A;  4ILW D;  2KRJ A;  2E2D A;  2XS3 A;  1IAG A;  3HY9 A;  1IAE A;  3ZVS A;  1SRP A;  3LUN A;  1C8T A;  1PWQ A;  2JT6 A;  1MMR A;  3KWV C;  1BUD A;  1Z3J A;  3G42 A;  1KUF A;  4JPA A;  5BPA A;  1JAQ A;  4H2E A;  2MLR A;  4AIG A;  2X7M A;  2RJQ A;  2N8R A;  1O0Q A;  1UTT A;  1CGF A;  1XFU A;  4H49 A;  3HYG A;  3F1A A;  4DD8 A;  4GUY A;  4Q1L A;  1B3D A;  2J83 A;  1BUV M;  830C A;  1B8Y A;  3TT4 A;  3F19 A;  3WV3 A;  1XFW A;  1I1I P;  2JT5 A;  2Y6C A;  3F16 A;  4PKR A;  1G4K A;  3LMC A;  4PKQ A;  1MNC A;  1SLM A;  1YQY A;  3DTI A;  1HOV A;  3Q2G A;  1JH1 A;  5D3C A;  2D1O A;  3TVC A;  3N2V A;  1QIC A;  1O0T A;  1R54 A;  2HU6 A;  3DTK A;  2YIG A;  1OS2 A;  1GO8 P;  3KRY A;  4FXY P;  3P1V A;  1PWW A;  2USN A;  1JAN A;  4PKU A;  1HTD A;  1OS9 A;  1XFX A;  1KUH A;  4HMA A;  2JIH A;  4AUO A;  3DPE A;  4DF9 A;  1UMT A;  3LQ0 A;  2OW0 A;  4WKE A;  3GBO A;  5I3M A;  1R1J A;  3I7G A;  4GWM A;  1ND1 A;  1UTZ A;  1PWU A;  3HY7 A;  3F18 A;  3N2U A;  3RTS A;  4H82 A;  2FV9 A;  4R3V A;  4JA1 A;  4PKV A;  3F15 A;  2W13 A;  1SU3 A;  2ERQ A;  3AIG A;  3LIR A;  1L6J A;  4JP4 A;  3LJZ A;  4JQG A;  2CKI A;  3VI1 A;  4WKI A;  2I47 A;  4L6T A;  1KUI A;  1BKC I;  1KUK A;  3O64 A;  2CLT A;  1JAO A;  2OXU A;  1GE7 A;  3WV1 A;  2DW0 A;  3VTG A;  4DV8 A;  1IAB A;  2K2G A;  1SMP A;  1AST A;  5CUH A;  2OVX A;  1OM6 A;  2OY2 A;  1PWP A;  1CXV A;  4EFS A;  2ERP A;  1CGE A;  2L0R A;  2MLS A;  2W15 A;  4XM8 A;  4H1Q A;  2DW1 A;  1ZP5 A;  3EHY A;  1IAA A;  1XFZ A;  1QIB A;  3LE9 A;  2MZE A;  1CQR A;  1UMS A;  2OW9 A;  1KUG A;  1XUD A;  3LJT A;  1OM8 A;  3OHO A;  4G0D A;  4A3W A;  1AF0 A;  1AYK A;  2E3X A;  3KEK A;  1G49 A;  2OW2 A;  1RM8 A;  1I73 A;  2ERO A;  2Y6D A;  4GR8 A;  5BOY A;  4GR3 A;  2X3A A;  1SLN A;  3DPF A;  3DSL A;  5JMY A;  2OW1 A;  1ATL A;  5D1U A;  1JIW P;  4PKW A;  1BKC E;  1BQO A;  1UEA A;  1OO9 A;  4L19 A;  3ELM A;  3K7N A;  1HFS A;  4FU4 A;  4PKT A;  5CZM A;  3BA0 A;  4XM7 A;  3I7I A;  1OMJ A;  4IJO A;  2DDY A;  3UVC A;  2DDF A;  966C A;  1XUC A;  4DPE A;  1JK3 A;  1GXD A;  3LIK A;  1DMT A;  1D8F A;  3L0T A;  2OXW A;  1D8M A;  3KMC A;  1HY7 A;  1KBC A;  1BSW A;  2W14 A;  1QJJ A;  5D2B A;  3EHX A;  456C A;  1YP1 A;  3E8R A;  5I0L A;  2OXZ A;  4IUW A;  2SRT A;  1DTH A;  1HV5 A;  1GKD A;  3EDI A;  1IAD A;  3CKI A;  4GWN A;  1Y0V A;  4JIJ A;  3EDZ A;  4PKS A;  4G9L A;  1ROS A;  2W0D A;  4WF6 A;  3LK8 A;  3ZUK A;  4QKZ A;  4AXQ A;  1R1H A;  3HDB A;  3KEJ A;  3LIL A;  5L79 A;  1Q3A A;  4I35 A;  4XBH A;  5I12 A;  3LGP A;  3P24 A;  4ZR5 A;  1XFY A;  2Z2D A;  1GE5 A;  2MZH A;  1G05 A;  4J4M A;  1WNI A;  1GKC A;  3AYK A;  4WK7 A;  5D1T A;  1H71 P;  1A86 A;  3DL1 A;  2QPJ A;  1PWV A;  1BKC A;  3EDH A;  1BIW A;  3TS4 A;  4GR0 A;  1XFV A;  4H30 A;  1QIA A;  1GE6 A;  1HFC A;  3NX7 A;  2RJP A;  3RTT A;  3O2X A;  3B92 A;  1ZXV A;  2AYK A;  2YB9 A;  1A85 A;  3LEA A;  3V96 B;  1C3I A;  1RMZ A;  4IN9 A;  2OY4 A;  5L7F A;  4A7B A;  5B5P A;  1S4B P;  2AIG P;  1JJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...