3DSLA

The three-dimensional structure of bothropasin, the main hemorrhagic factor from bothrops jararaca venom.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
416
structure length
416
Chain Sequence
QKYNPFRYVELFIVVDQGMVTKNNGDLDKIKARMYELANIVNEILRYLYMHAALVGLEIWSNGDKITVKPDVDYTLNSFAEWRKTDLLTRKKHDNAQLLTAIDFNGPTIGYAYIGSMCHPKRSVAIVEDYSPINLVVAVIMAHEMGHNLGIHHDTDFCSCGDYPCIMGPTISNEPSKFFSNCSYIQCWDFIMKENPQCILNEPLGTDIVSPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYALFGADVYEAEDSCFKDNQKGNYYGYCRKENGKKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNDDEHKGMVLPGTKCADGKVCSNGHCVDVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Zinc metalloproteinase-disintegrin bothropasin
publication title The three-dimensional structure of bothropasin, the main hemorrhagic factor from Bothrops jararaca venom: Insights for a new classification of snake venom metalloprotease subgroups.
pubmed doi rcsb
total genus 119
structure length 416
sequence length 416
chains with identical sequence B
ec nomenclature ec 3.4.24.49: Bothropasin.
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dslA01
3F16A 1FM1A 2TCLA 3LKAA 1QIAA 5D7WA 2JT5A 4J4MA 4L63A 5LABA 1DTHA 2DDFA 1C8TA 1MNCA 1AF0A 2OI0A 1QICA 4IUWA 5I0LA 2MZHA 1I1IP 4XBHA 1OO9A 5BOYA 3KMCA 3EDHA 1XFYA 2E3XA 1D5JA 3LJTA 3E8RA 4H3XA 1CAQA 1PWVA 1SMPA 5H8XA 1GKDA 1JAPA 4GWNA 4DF9A 3ZXHA 1ATLA 2W12A 1USNA 1BQQM 2N8RA 2ERQA 1IADA 3N2VA 966CA 5L79A 1BUVM 3AIGA 3VTGA 2E2DA 1AKLA 2K9CA 1S4BP 3Q2GA 4FXYP 4IN9A 1YP1A 2W13A 3DL1A 2W14A 1GE6A 2DW1A 3K7NA 1JANA 1PWWA 2X3CA 4A7BA 5I43A 1D7XA 5L7FA 4GR3A 3HBVP 3LJGA 1IACA 1BZSA 1C7KA 2D1OA 1XFVA 4H30A 3WV3A 1BKCI 3EDIA 2OXWA 2J0TA 1Y93A 4PKWA 4AXQA 4PKVA 1GXDA 3HY7A 3SHIA 2DW0A 2AYKA 4H84A 1XUCA 1IAGA 3WV1A 1HOVA 4GR8A 5D1UA 1JIZA 1MMPA 4HMAA 4G0DA 3AYUA 1XFXA 2W15A 4ON1A 3LUNA 2OVZA 1OM8A 1BKCE 2Z2DA 3O64A 1B3DA 1KAPP 4ILWD 1JIWP 3LIKA 1R54A 2L0RA 3F17A 1I76A 2EROA 5I4OA 1Y0VA 1KUFA 3WV2A 3OHLA 1G12A 2HU6A 1XFUA 1YCMA 2K2GA 4PKUA 4XM6A 1GKCA 4FVLA 2USNA 4FU4A 3AYKA 1OM6A 2WO8A 2V4BA 3OHOA 3LIRA 2OW9A 3LGPA 1JJ9A 3V96B 3N2UA 1RM8A 1R1IA 1IAAA 1K7QA 3RTSA 4JQGA 4JPAA 1UTTA 3CKIA 1UEAA 1KUGA 3TSKA 5CZMA 4H82A 2Y6DA 1CXVA 1BSWA 3LQ0A 1JAQA 1EB6A 3I7IA 3HDBA 1BIWA 3DWBA 4QKZA 1ZTQA 1D8MA 1K7IA 5D2BA 1HTDA 2I47A 2X7MA 3P1VA 2J83A 3P24A 1HY7A 2FV9A 1CGEA 1R1JA 1BKCA 5D1TA 3F15A 1EUBA 4PKSA 1SLMA 4H76A 5I12A 3EWJA 1IABA 456CA 4FXQA 1CQRA 1SATA 4R3VA 3ZUKA 3LUMA 5BPAA 1MMBA 3KRYA 3EDGA 2CKIA 1CGLA 1XFZA 2OW1A 2YB9A 1OS9A 1DMTA 2WO9A 4JIJA 4PKTA 2WOAA 4ZR5A 4AUOA 3EDZA 3ELMA 2JT6A 3HYGA 1K7GA 1IAEA 1ZP5A 1J7NA 1XURA 2OW2A 1XUDA 4GUYA 2DDYA 1PWPA 1XFWA 4GR0A 4HX3A 1JAOA 1QUAA 2YIGA 1A86A 4I35A 1ZS0A 2OXUA 3BA0A 3L0VA 2OY2A 3TS4A 5BOTA 1KUHA 2MZEA 4XM8A 1O0QA 3RTTA 3KEJA 3TT4A 1L6JA 4PKRA 3EHXA 3USNA 3LEAA 5B5PA 4IJOA 3LILA 2KRJA 4Q1LA 4WKEA 3LJZA 4WKIA 1I73A 1ZXCA 4DV8A 2O36A 1H71P 1SU3A 4WF6A 1OM7A 5B5OA 1FBLA 3DNGA 1GO8P 2OXZA 3HY9A 3KEKA 3LE9A 3EHYA 1SLNA 3F19A 5CXAA 3K7LA 3GBOA 1KBCA 2PJTA 4A3WA 4H1QA 3G42A 3VI1A 3MA2A 4H2EA 2X3BA 3KMEA 3UVCA 4DD8A 1QJIA 1SRPA 1CK7A 3U1RA 4XCTA 2DW2A 4EFSA 1EAKA 1R1HA 2JIHA 3B92A 3TVCA 2X3AA 2RJPA 1ND1A 3F1AA 1BM6A 1ZVXA 4CTHA 2W0DA 1PWQA 2AIGP 3B8ZA 4WK7A 1C3IA 2Y6CA 1A85A 2FV5A 1O0TA 3HBUP 4WZVA 3LQBA 3LK8A 5I3MA 2D1NA 5CUHA 1KUIA 3DPFA 1GE7A 1YQYA 4AYKA 1JK3A 2A8HA 1ROSA 4AIGA 4GWMA 1GE5A 4XM7A 3G5CA 1QJJA 2SRTA 1KUKA 3LMCA 3DPEA 1ZXVA 3KECA 1WNIA 4G9LA 3L0TA 4JP4A 1YOUA 2MLSA 1JKYA 3HB2P 2O3EA 1OS2A 1Y8JA 2XS3A 2POJA 3ZVSA 4H49A 2ERPA 3HDAP 1CGFA 1G05A 5JMYA 4I03A 5I2ZA 4DPEA 1R55A 1HV5A 1G4KA 5D3CA 1D8FA 2OVXA 1B8YA 3I7GA 2CLTA 1AYKA 1RMZA 1MMQA 3NX7A 3B2ZA 3F18A 1QIBA 1BUDA 1UTZA 4JA1A 1OMJA 1JH1A 2OY4A 1GO7P 4L6TA 5D1SA 1G49A 1Z3JA 2XS4A 1HFSA 2MLRA 830CA 2OW0A 3O2XA 2OZRA 3KHIA 4GQLA 1CIZA 2MZIA 2QPJA 2JSDA 4L19A 2RJQA 1BQOA 1UMSA 2JNPA 3KWVC 1G9KA 1HFCA 1FLSA 3DSLA 4GF1A 1UMTA 1PWUA 4PKQA 3Q2HA 1Q3AA 1ASTA 1MMRA
chains in the Genus database with same CATH superfamily
3F16A 1FM1A 2TCLA 3LKAA 1QIAA 5D7WA 2JT5A 4J4MA 4L63A 5LABA 1DTHA 2DDFA 1C8TA 1MNCA 1AF0A 2OI0A 1QICA 4IUWA 5I0LA 2MZHA 1I1IP 3DTIA 4XBHA 1OO9A 5BOYA 3KMCA 3EDHA 1XFYA 2E3XA 1D5JA 3LJTA 3E8RA 4H3XA 1CAQA 1PWVA 1SMPA 5H8XA 1GKDA 1JAPA 4GWNA 4DF9A 3ZXHA 1ATLA 2W12A 1USNA 1BQQM 2N8RA 2ERQA 1IADA 3N2VA 966CA 5L79A 1BUVM 3AIGA 3VTGA 2E2DA 1AKLA 2K9CA 1S4BP 3Q2GA 4FXYP 4IN9A 1YP1A 2W13A 3DL1A 4L7AA 2W14A 1GE6A 2DW1A 3K7NA 1JANA 1PWWA 2X3CA 4A7BA 5I43A 1D7XA 5L7FA 4GR3A 3HBVP 3LJGA 1IACA 1BZSA 1C7KA 2D1OA 1TVIA 1XFVA 4H30A 3WV3A 1BKCI 3EDIA 2OXWA 2J0TA 1Y93A 4PKWA 4AXQA 4PKVA 1GXDA 3HY7A 3SHIA 2DW0A 2AYKA 4H84A 1XUCA 1IAGA 3WV1A 1HOVA 4GR8A 5D1UA 1XM5A 1JIZA 1MMPA 4HMAA 4G0DA 3AYUA 1XFXA 2W15A 4ON1A 3LUNA 2OVZA 1OM8A 1BKCE 2Z2DA 3O64A 1B3DA 1KAPP 4ILWD 1JIWP 3LIKA 1OZ9A 1R54A 2L0RA 3F17A 1I76A 3DTKA 2EROA 5I4OA 1Y0VA 1KUFA 3WV2A 3OHLA 1G12A 2HU6A 1XFUA 1YCMA 2K2GA 4PKUA 4XM6A 1GKCA 4FVLA 2USNA 4FU4A 3AYKA 1OM6A 2WO8A 2V4BA 3OHOA 3LIRA 2OW9A 3LGPA 1JJ9A 3V96B 3N2UA 1RM8A 1R1IA 1IAAA 1K7QA 3RTSA 4JQGA 4JPAA 1UTTA 3CKIA 1UEAA 1KUGA 3TSKA 5CZMA 4H82A 2Y6DA 1CXVA 1BSWA 3LQ0A 1JAQA 1EB6A 3I7IA 3HDBA 1BIWA 3DWBA 4QKZA 1ZTQA 1D8MA 1K7IA 5D2BA 1HTDA 2I47A 2X7MA 3P1VA 2J83A 3P24A 1HY7A 2FV9A 1CGEA 1R1JA 1BKCA 5D1TA 3F15A 1EUBA 4PKSA 1SLMA 4H76A 5I12A 3EWJA 1IABA 456CA 4FXQA 1CQRA 1SATA 4R3VA 3ZUKA 3LUMA 5BPAA 1MMBA 3KRYA 3EDGA 2CKIA 1CGLA 1XFZA 2OW1A 2YB9A 1OS9A 1DMTA 2WO9A 4JIJA 4PKTA 2WOAA 4ZR5A 4AUOA 3EDZA 3ELMA 2JT6A 3HYGA 1K7GA 1IAEA 1ZP5A 1J7NA 1XURA 2OW2A 1XUDA 4GUYA 2DDYA 1PWPA 1XFWA 4GR0A 4HX3A 1JAOA 1QUAA 2YIGA 1A86A 4I35A 1ZS0A 2OXUA 3BA0A 3L0VA 2OY2A 3TS4A 5BOTA 1KUHA 2MZEA 4XM8A 1O0QA 3RTTA 3KEJA 3TT4A 1L6JA 4PKRA 3EHXA 3USNA 3LEAA 5B5PA 4IJOA 3LILA 2KRJA 4Q1LA 4WKEA 3LJZA 4WKIA 1I73A 1ZXCA 4DV8A 2O36A 1H71P 1SU3A 4WF6A 1OM7A 5B5OA 1FBLA 3DNGA 1GO8P 2OXZA 3HY9A 3KEKA 3LE9A 3EHYA 1SLNA 3F19A 5CXAA 3K7LA 3GBOA 1KBCA 2PJTA 4A3WA 4H1QA 3G42A 3VI1A 3MA2A 4H2EA 2X3BA 3KMEA 3UVCA 4DD8A 1XAXA 1QJIA 1SRPA 1CK7A 3U1RA 4XCTA 2DW2A 4EFSA 1EAKA 1R1HA 2JIHA 3B92A 3TVCA 2X3AA 2RJPA 1ND1A 3F1AA 1BM6A 1ZVXA 4CTHA 2W0DA 1PWQA 2AIGP 3B8ZA 4WK7A 3DTEA 1C3IA 2Y6CA 1A85A 2FV5A 1O0TA 3HBUP 4WZVA 3LQBA 3LK8A 5I3MA 2D1NA 5CUHA 1KUIA 3DPFA 1GE7A 1YQYA 4AYKA 1JK3A 2A8HA 1ROSA 4AIGA 4GWMA 1GE5A 4XM7A 3G5CA 1QJJA 2SRTA 1KUKA 3LMCA 3DPEA 1ZXVA 3KECA 1WNIA 4G9LA 3L0TA 4JP4A 1YOUA 2MLSA 1JKYA 3HB2P 2O3EA 1OS2A 1Y8JA 2XS3A 2POJA 3ZVSA 4H49A 2ERPA 3HDAP 1CGFA 1G05A 5JMYA 4I03A 5I2ZA 4DPEA 1R55A 1HV5A 1G4KA 5D3CA 1D8FA 2OVXA 1B8YA 3I7GA 2CLTA 1AYKA 1RMZA 1MMQA 3NX7A 3B2ZA 3F18A 1QIBA 1BUDA 1UTZA 2YUFA 4JA1A 1OMJA 1JH1A 2OY4A 1GO7P 4L6TA 5D1SA 1G49A 1Z3JA 2XS4A 1HFSA 2MLRA 830CA 2OW0A 3O2XA 2OZRA 3KHIA 4GQLA 1CIZA 2MZIA 2QPJA 2JSDA 4L19A 2RJQA 1BQOA 1UMSA 2JNPA 3KWVC 1G9KA 1HFCA 1FLSA 3DSLA 4GF1A 1UMTA 1PWUA 4PKQA 3Q2HA 1Q3AA 1ASTA 1MMRA
chains in the Genus database with same CATH topology
3F16A 1FM1A 2TCLA 3LKAA 1QIAA 5D7WA 2JT5A 4J4MA 4L63A 5LABA 1DTHA 2DDFA 1C8TA 1MNCA 1AF0A 2OI0A 1QICA 4IUWA 5I0LA 2MZHA 1I1IP 3DTIA 4XBHA 1OO9A 5BOYA 3KMCA 3EDHA 1XFYA 2E3XA 1D5JA 3LJTA 3E8RA 4H3XA 1CAQA 1PWVA 1SMPA 5H8XA 1GKDA 1JAPA 4GWNA 4DF9A 3ZXHA 1ATLA 2W12A 1USNA 1BQQM 2N8RA 2ERQA 1IADA 3N2VA 966CA 5L79A 1BUVM 3AIGA 3VTGA 2E2DA 1AKLA 2K9CA 1S4BP 3Q2GA 4FXYP 4IN9A 1YP1A 2W13A 3DL1A 4L7AA 2W14A 1GE6A 2DW1A 3K7NA 1JANA 1PWWA 2X3CA 4A7BA 5I43A 1D7XA 5L7FA 4GR3A 3HBVP 3LJGA 1IACA 1BZSA 1C7KA 2D1OA 1XFVA 4H30A 3WV3A 1BKCI 3EDIA 2OXWA 2J0TA 1Y93A 4PKWA 4AXQA 4PKVA 1GXDA 3HY7A 3SHIA 2DW0A 2AYKA 4H84A 1XUCA 1IAGA 3WV1A 1HOVA 4GR8A 5D1UA 1JIZA 1MMPA 4HMAA 4G0DA 3AYUA 1XFXA 2W15A 4ON1A 3LUNA 2OVZA 1OM8A 1BKCE 2Z2DA 3O64A 1B3DA 1KAPP 4ILWD 1JIWP 3LIKA 1R54A 2L0RA 3F17A 1I76A 3DTKA 2EROA 5I4OA 1Y0VA 1KUFA 3WV2A 3OHLA 1G12A 2HU6A 1XFUA 1YCMA 2K2GA 4PKUA 4XM6A 1GKCA 4FVLA 2USNA 4FU4A 3AYKA 1OM6A 2WO8A 2V4BA 3OHOA 3LIRA 2OW9A 3LGPA 1JJ9A 3V96B 3N2UA 1RM8A 1R1IA 1IAAA 1K7QA 3RTSA 4JQGA 4JPAA 1UTTA 3CKIA 1UEAA 1KUGA 3TSKA 5CZMA 4H82A 2Y6DA 1CXVA 1BSWA 3LQ0A 1JAQA 1EB6A 3I7IA 3HDBA 1BIWA 3DWBA 4QKZA 1ZTQA 1D8MA 1K7IA 5D2BA 1HTDA 2I47A 2X7MA 3P1VA 2J83A 3P24A 1HY7A 2FV9A 1CGEA 1R1JA 1BKCA 5D1TA 3F15A 1EUBA 4PKSA 1SLMA 4H76A 5I12A 3EWJA 1IABA 456CA 4FXQA 1CQRA 1SATA 4R3VA 3ZUKA 3LUMA 5BPAA 1MMBA 3KRYA 3EDGA 2CKIA 1CGLA 1XFZA 2OW1A 2YB9A 1OS9A 1DMTA 2WO9A 4JIJA 4PKTA 2WOAA 4ZR5A 4AUOA 3EDZA 3ELMA 2JT6A 3HYGA 1K7GA 1IAEA 1ZP5A 1J7NA 1XURA 2OW2A 1XUDA 4GUYA 2DDYA 1PWPA 1XFWA 4GR0A 4HX3A 1JAOA 1QUAA 2YIGA 1A86A 4I35A 1ZS0A 2OXUA 3BA0A 3L0VA 2OY2A 3TS4A 5BOTA 1KUHA 2MZEA 4XM8A 1O0QA 3RTTA 3KEJA 3TT4A 1L6JA 4PKRA 3EHXA 3USNA 3LEAA 5B5PA 4IJOA 3LILA 2KRJA 4Q1LA 4WKEA 3LJZA 4WKIA 1I73A 1ZXCA 4DV8A 2O36A 1H71P 1SU3A 4WF6A 1OM7A 5B5OA 1FBLA 3DNGA 1GO8P 2OXZA 3HY9A 3KEKA 3LE9A 3EHYA 1SLNA 3F19A 5CXAA 3K7LA 3GBOA 1KBCA 2PJTA 4A3WA 4H1QA 3G42A 3VI1A 3MA2A 4H2EA 2X3BA 3KMEA 3UVCA 4DD8A 1QJIA 1SRPA 1CK7A 3U1RA 4XCTA 2DW2A 4EFSA 1EAKA 1R1HA 2JIHA 3B92A 3TVCA 2X3AA 2RJPA 1ND1A 3F1AA 1BM6A 1ZVXA 4CTHA 2W0DA 1PWQA 2AIGP 3B8ZA 4WK7A 3DTEA 1C3IA 2Y6CA 1A85A 2FV5A 1O0TA 3HBUP 4WZVA 3LQBA 3LK8A 5I3MA 2D1NA 5CUHA 1KUIA 3DPFA 1GE7A 1YQYA 4AYKA 1JK3A 2A8HA 1ROSA 4AIGA 4GWMA 1GE5A 4XM7A 3G5CA 1QJJA 2SRTA 1KUKA 3LMCA 3DPEA 1ZXVA 3KECA 1WNIA 4G9LA 3L0TA 4JP4A 1YOUA 2MLSA 1JKYA 3HB2P 2O3EA 1OS2A 1Y8JA 2XS3A 2POJA 3ZVSA 4H49A 2ERPA 3HDAP 1CGFA 1G05A 5JMYA 4I03A 5I2ZA 4DPEA 1R55A 1HV5A 1G4KA 5D3CA 1D8FA 2OVXA 1B8YA 3I7GA 2CLTA 1AYKA 1RMZA 1MMQA 3NX7A 3B2ZA 3F18A 1QIBA 1BUDA 1UTZA 2YUFA 4JA1A 1OMJA 1JH1A 2OY4A 1GO7P 4L6TA 5D1SA 1G49A 1Z3JA 2XS4A 1HFSA 2MLRA 830CA 2OW0A 3O2XA 2OZRA 3KHIA 4GQLA 1CIZA 2MZIA 2QPJA 2JSDA 4L19A 2RJQA 1BQOA 1UMSA 2JNPA 3KWVC 1G9KA 1HFCA 1FLSA 3DSLA 4GF1A 1UMTA 1PWUA 4PKQA 3Q2HA 1Q3AA 1ASTA 1MMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F16 A;  1FM1 A;  2TCL A;  3LKA A;  1QIA A;  5D7W A;  2JT5 A;  4J4M A;  4L63 A;  5LAB A;  1DTH A;  2DDF A;  1C8T A;  1MNC A;  1AF0 A;  2OI0 A;  1QIC A;  4IUW A;  5I0L A;  2MZH A;  1I1I P;  4XBH A;  1OO9 A;  5BOY A;  3KMC A;  3EDH A;  1XFY A;  2E3X A;  1D5J A;  3LJT A;  3E8R A;  4H3X A;  1CAQ A;  1PWV A;  1SMP A;  5H8X A;  1GKD A;  1JAP A;  4GWN A;  4DF9 A;  3ZXH A;  1ATL A;  2W12 A;  1USN A;  1BQQ M;  2N8R A;  2ERQ A;  1IAD A;  3N2V A;  966C A;  5L79 A;  1BUV M;  3AIG A;  3VTG A;  2E2D A;  1AKL A;  2K9C A;  1S4B P;  3Q2G A;  4FXY P;  4IN9 A;  1YP1 A;  2W13 A;  3DL1 A;  2W14 A;  1GE6 A;  2DW1 A;  3K7N A;  1JAN A;  1PWW A;  2X3C A;  4A7B A;  5I43 A;  1D7X A;  5L7F A;  4GR3 A;  3HBV P;  3LJG A;  1IAC A;  1BZS A;  1C7K A;  2D1O A;  1XFV A;  4H30 A;  3WV3 A;  1BKC I;  3EDI A;  2OXW A;  2J0T A;  1Y93 A;  4PKW A;  4AXQ A;  4PKV A;  1GXD A;  3HY7 A;  3SHI A;  2DW0 A;  2AYK A;  4H84 A;  1XUC A;  1IAG A;  3WV1 A;  1HOV A;  4GR8 A;  5D1U A;  1JIZ A;  1MMP A;  4HMA A;  4G0D A;  3AYU A;  1XFX A;  2W15 A;  4ON1 A;  3LUN A;  2OVZ A;  1OM8 A;  1BKC E;  2Z2D A;  3O64 A;  1B3D A;  1KAP P;  4ILW D;  1JIW P;  3LIK A;  1R54 A;  2L0R A;  3F17 A;  1I76 A;  2ERO A;  5I4O A;  1Y0V A;  1KUF A;  3WV2 A;  3OHL A;  1G12 A;  2HU6 A;  1XFU A;  1YCM A;  2K2G A;  4PKU A;  4XM6 A;  1GKC A;  4FVL A;  2USN A;  4FU4 A;  3AYK A;  1OM6 A;  2WO8 A;  2V4B A;  3OHO A;  3LIR A;  2OW9 A;  3LGP A;  1JJ9 A;  3V96 B;  3N2U A;  1RM8 A;  1R1I A;  1IAA A;  1K7Q A;  3RTS A;  4JQG A;  4JPA A;  1UTT A;  3CKI A;  1UEA A;  1KUG A;  3TSK A;  5CZM A;  4H82 A;  2Y6D A;  1CXV A;  1BSW A;  3LQ0 A;  1JAQ A;  1EB6 A;  3I7I A;  3HDB A;  1BIW A;  3DWB A;  4QKZ A;  1ZTQ A;  1D8M A;  1K7I A;  5D2B A;  1HTD A;  2I47 A;  2X7M A;  3P1V A;  2J83 A;  3P24 A;  1HY7 A;  2FV9 A;  1CGE A;  1R1J A;  1BKC A;  5D1T A;  3F15 A;  1EUB A;  4PKS A;  1SLM A;  4H76 A;  5I12 A;  3EWJ A;  1IAB A;  456C A;  4FXQ A;  1CQR A;  1SAT A;  4R3V A;  3ZUK A;  3LUM A;  5BPA A;  1MMB A;  3KRY A;  3EDG A;  2CKI A;  1CGL A;  1XFZ A;  2OW1 A;  2YB9 A;  1OS9 A;  1DMT A;  2WO9 A;  4JIJ A;  4PKT A;  2WOA A;  4ZR5 A;  4AUO A;  3EDZ A;  3ELM A;  2JT6 A;  3HYG A;  1K7G A;  1IAE A;  1ZP5 A;  1J7N A;  1XUR A;  2OW2 A;  1XUD A;  4GUY A;  2DDY A;  1PWP A;  1XFW A;  4GR0 A;  4HX3 A;  1JAO A;  1QUA A;  2YIG A;  1A86 A;  4I35 A;  1ZS0 A;  2OXU A;  3BA0 A;  3L0V A;  2OY2 A;  3TS4 A;  5BOT A;  1KUH A;  2MZE A;  4XM8 A;  1O0Q A;  3RTT A;  3KEJ A;  3TT4 A;  1L6J A;  4PKR A;  3EHX A;  3USN A;  3LEA A;  5B5P A;  4IJO A;  3LIL A;  2KRJ A;  4Q1L A;  4WKE A;  3LJZ A;  4WKI A;  1I73 A;  1ZXC A;  4DV8 A;  2O36 A;  1H71 P;  1SU3 A;  4WF6 A;  1OM7 A;  5B5O A;  1FBL A;  3DNG A;  1GO8 P;  2OXZ A;  3HY9 A;  3KEK A;  3LE9 A;  3EHY A;  1SLN A;  3F19 A;  5CXA A;  3K7L A;  3GBO A;  1KBC A;  2PJT A;  4A3W A;  4H1Q A;  3G42 A;  3VI1 A;  3MA2 A;  4H2E A;  2X3B A;  3KME A;  3UVC A;  4DD8 A;  1QJI A;  1SRP A;  1CK7 A;  3U1R A;  4XCT A;  2DW2 A;  4EFS A;  1EAK A;  1R1H A;  2JIH A;  3B92 A;  3TVC A;  2X3A A;  2RJP A;  1ND1 A;  3F1A A;  1BM6 A;  1ZVX A;  4CTH A;  2W0D A;  1PWQ A;  2AIG P;  3B8Z A;  4WK7 A;  1C3I A;  2Y6C A;  1A85 A;  2FV5 A;  1O0T A;  3HBU P;  4WZV A;  3LQB A;  3LK8 A;  5I3M A;  2D1N A;  5CUH A;  1KUI A;  3DPF A;  1GE7 A;  1YQY A;  4AYK A;  1JK3 A;  2A8H A;  1ROS A;  4AIG A;  4GWM A;  1GE5 A;  4XM7 A;  3G5C A;  1QJJ A;  2SRT A;  1KUK A;  3LMC A;  3DPE A;  1ZXV A;  3KEC A;  1WNI A;  4G9L A;  3L0T A;  4JP4 A;  1YOU A;  2MLS A;  1JKY A;  3HB2 P;  2O3E A;  1OS2 A;  1Y8J A;  2XS3 A;  2POJ A;  3ZVS A;  4H49 A;  2ERP A;  3HDA P;  1CGF A;  1G05 A;  5JMY A;  4I03 A;  5I2Z A;  4DPE A;  1R55 A;  1HV5 A;  1G4K A;  5D3C A;  1D8F A;  2OVX A;  1B8Y A;  3I7G A;  2CLT A;  1AYK A;  1RMZ A;  1MMQ A;  3NX7 A;  3B2Z A;  3F18 A;  1QIB A;  1BUD A;  1UTZ A;  4JA1 A;  1OMJ A;  1JH1 A;  2OY4 A;  1GO7 P;  4L6T A;  5D1S A;  1G49 A;  1Z3J A;  2XS4 A;  1HFS A;  2MLR A;  830C A;  2OW0 A;  3O2X A;  2OZR A;  3KHI A;  4GQL A;  1CIZ A;  2MZI A;  2QPJ A;  2JSD A;  4L19 A;  2RJQ A;  1BQO A;  1UMS A;  2JNP A;  3KWV C;  1G9K A;  1HFC A;  1FLS A;  3DSL A;  4GF1 A;  1UMT A;  1PWU A;  4PKQ A;  3Q2H A;  1Q3A A;  1AST A;  1MMR A; 
#chains in the Genus database with same CATH topology
 3F16 A;  1FM1 A;  2TCL A;  3LKA A;  1QIA A;  5D7W A;  2JT5 A;  4J4M A;  4L63 A;  5LAB A;  1DTH A;  2DDF A;  1C8T A;  1MNC A;  1AF0 A;  2OI0 A;  1QIC A;  4IUW A;  5I0L A;  2MZH A;  1I1I P;  3DTI A;  4XBH A;  1OO9 A;  5BOY A;  3KMC A;  3EDH A;  1XFY A;  2E3X A;  1D5J A;  3LJT A;  3E8R A;  4H3X A;  1CAQ A;  1PWV A;  1SMP A;  5H8X A;  1GKD A;  1JAP A;  4GWN A;  4DF9 A;  3ZXH A;  1ATL A;  2W12 A;  1USN A;  1BQQ M;  2N8R A;  2ERQ A;  1IAD A;  3N2V A;  966C A;  5L79 A;  1BUV M;  3AIG A;  3VTG A;  2E2D A;  1AKL A;  2K9C A;  1S4B P;  3Q2G A;  4FXY P;  4IN9 A;  1YP1 A;  2W13 A;  3DL1 A;  4L7A A;  2W14 A;  1GE6 A;  2DW1 A;  3K7N A;  1JAN A;  1PWW A;  2X3C A;  4A7B A;  5I43 A;  1D7X A;  5L7F A;  4GR3 A;  3HBV P;  3LJG A;  1IAC A;  1BZS A;  1C7K A;  2D1O A;  1TVI A;  1XFV A;  4H30 A;  3WV3 A;  1BKC I;  3EDI A;  2OXW A;  2J0T A;  1Y93 A;  4PKW A;  4AXQ A;  4PKV A;  1GXD A;  3HY7 A;  3SHI A;  2DW0 A;  2AYK A;  4H84 A;  1XUC A;  1IAG A;  3WV1 A;  1HOV A;  4GR8 A;  5D1U A;  1XM5 A;  1JIZ A;  1MMP A;  4HMA A;  4G0D A;  3AYU A;  1XFX A;  2W15 A;  4ON1 A;  3LUN A;  2OVZ A;  1OM8 A;  1BKC E;  2Z2D A;  3O64 A;  1B3D A;  1KAP P;  4ILW D;  1JIW P;  3LIK A;  1OZ9 A;  1R54 A;  2L0R A;  3F17 A;  1I76 A;  3DTK A;  2ERO A;  5I4O A;  1Y0V A;  1KUF A;  3WV2 A;  3OHL A;  1G12 A;  2HU6 A;  1XFU A;  1YCM A;  2K2G A;  4PKU A;  4XM6 A;  1GKC A;  4FVL A;  2USN A;  4FU4 A;  3AYK A;  1OM6 A;  2WO8 A;  2V4B A;  3OHO A;  3LIR A;  2OW9 A;  3LGP A;  1JJ9 A;  3V96 B;  3N2U A;  1RM8 A;  1R1I A;  1IAA A;  1K7Q A;  3RTS A;  4JQG A;  4JPA A;  1UTT A;  3CKI A;  1UEA A;  1KUG A;  3TSK A;  5CZM A;  4H82 A;  2Y6D A;  1CXV A;  1BSW A;  3LQ0 A;  1JAQ A;  1EB6 A;  3I7I A;  3HDB A;  1BIW A;  3DWB A;  4QKZ A;  1ZTQ A;  1D8M A;  1K7I A;  5D2B A;  1HTD A;  2I47 A;  2X7M A;  3P1V A;  2J83 A;  3P24 A;  1HY7 A;  2FV9 A;  1CGE A;  1R1J A;  1BKC A;  5D1T A;  3F15 A;  1EUB A;  4PKS A;  1SLM A;  4H76 A;  5I12 A;  3EWJ A;  1IAB A;  456C A;  4FXQ A;  1CQR A;  1SAT A;  4R3V A;  3ZUK A;  3LUM A;  5BPA A;  1MMB A;  3KRY A;  3EDG A;  2CKI A;  1CGL A;  1XFZ A;  2OW1 A;  2YB9 A;  1OS9 A;  1DMT A;  2WO9 A;  4JIJ A;  4PKT A;  2WOA A;  4ZR5 A;  4AUO A;  3EDZ A;  3ELM A;  2JT6 A;  3HYG A;  1K7G A;  1IAE A;  1ZP5 A;  1J7N A;  1XUR A;  2OW2 A;  1XUD A;  4GUY A;  2DDY A;  1PWP A;  1XFW A;  4GR0 A;  4HX3 A;  1JAO A;  1QUA A;  2YIG A;  1A86 A;  4I35 A;  1ZS0 A;  2OXU A;  3BA0 A;  3L0V A;  2OY2 A;  3TS4 A;  5BOT A;  1KUH A;  2MZE A;  4XM8 A;  1O0Q A;  3RTT A;  3KEJ A;  3TT4 A;  1L6J A;  4PKR A;  3EHX A;  3USN A;  3LEA A;  5B5P A;  4IJO A;  3LIL A;  2KRJ A;  4Q1L A;  4WKE A;  3LJZ A;  4WKI A;  1I73 A;  1ZXC A;  4DV8 A;  2O36 A;  1H71 P;  1SU3 A;  4WF6 A;  1OM7 A;  5B5O A;  1FBL A;  3DNG A;  1GO8 P;  2OXZ A;  3HY9 A;  3KEK A;  3LE9 A;  3EHY A;  1SLN A;  3F19 A;  5CXA A;  3K7L A;  3GBO A;  1KBC A;  2PJT A;  4A3W A;  4H1Q A;  3G42 A;  3VI1 A;  3MA2 A;  4H2E A;  2X3B A;  3KME A;  3UVC A;  4DD8 A;  1XAX A;  1QJI A;  1SRP A;  1CK7 A;  3U1R A;  4XCT A;  2DW2 A;  4EFS A;  1EAK A;  1R1H A;  2JIH A;  3B92 A;  3TVC A;  2X3A A;  2RJP A;  1ND1 A;  3F1A A;  1BM6 A;  1ZVX A;  4CTH A;  2W0D A;  1PWQ A;  2AIG P;  3B8Z A;  4WK7 A;  3DTE A;  1C3I A;  2Y6C A;  1A85 A;  2FV5 A;  1O0T A;  3HBU P;  4WZV A;  3LQB A;  3LK8 A;  5I3M A;  2D1N A;  5CUH A;  1KUI A;  3DPF A;  1GE7 A;  1YQY A;  4AYK A;  1JK3 A;  2A8H A;  1ROS A;  4AIG A;  4GWM A;  1GE5 A;  4XM7 A;  3G5C A;  1QJJ A;  2SRT A;  1KUK A;  3LMC A;  3DPE A;  1ZXV A;  3KEC A;  1WNI A;  4G9L A;  3L0T A;  4JP4 A;  1YOU A;  2MLS A;  1JKY A;  3HB2 P;  2O3E A;  1OS2 A;  1Y8J A;  2XS3 A;  2POJ A;  3ZVS A;  4H49 A;  2ERP A;  3HDA P;  1CGF A;  1G05 A;  5JMY A;  4I03 A;  5I2Z A;  4DPE A;  1R55 A;  1HV5 A;  1G4K A;  5D3C A;  1D8F A;  2OVX A;  1B8Y A;  3I7G A;  2CLT A;  1AYK A;  1RMZ A;  1MMQ A;  3NX7 A;  3B2Z A;  3F18 A;  1QIB A;  1BUD A;  1UTZ A;  2YUF A;  4JA1 A;  1OMJ A;  1JH1 A;  2OY4 A;  1GO7 P;  4L6T A;  5D1S A;  1G49 A;  1Z3J A;  2XS4 A;  1HFS A;  2MLR A;  830C A;  2OW0 A;  3O2X A;  2OZR A;  3KHI A;  4GQL A;  1CIZ A;  2MZI A;  2QPJ A;  2JSD A;  4L19 A;  2RJQ A;  1BQO A;  1UMS A;  2JNP A;  3KWV C;  1G9K A;  1HFC A;  1FLS A;  3DSL A;  4GF1 A;  1UMT A;  1PWU A;  4PKQ A;  3Q2H A;  1Q3A A;  1AST A;  1MMR A; 
#chains in the Genus database with same CATH homology
 3F16 A;  1FM1 A;  2TCL A;  3LKA A;  1QIA A;  5D7W A;  2JT5 A;  4J4M A;  4L63 A;  5LAB A;  1DTH A;  2DDF A;  1C8T A;  1MNC A;  1AF0 A;  2OI0 A;  1QIC A;  4IUW A;  5I0L A;  2MZH A;  1I1I P;  3DTI A;  4XBH A;  1OO9 A;  5BOY A;  3KMC A;  3EDH A;  1XFY A;  2E3X A;  1D5J A;  3LJT A;  3E8R A;  4H3X A;  1CAQ A;  1PWV A;  1SMP A;  5H8X A;  1GKD A;  1JAP A;  4GWN A;  4DF9 A;  3ZXH A;  1ATL A;  2W12 A;  1USN A;  1BQQ M;  2N8R A;  2ERQ A;  1IAD A;  3N2V A;  966C A;  5L79 A;  1BUV M;  3AIG A;  3VTG A;  2E2D A;  1AKL A;  2K9C A;  1S4B P;  3Q2G A;  4FXY P;  4IN9 A;  1YP1 A;  2W13 A;  3DL1 A;  4L7A A;  2W14 A;  1GE6 A;  2DW1 A;  3K7N A;  1JAN A;  1PWW A;  2X3C A;  4A7B A;  5I43 A;  1D7X A;  5L7F A;  4GR3 A;  3HBV P;  3LJG A;  1IAC A;  1BZS A;  1C7K A;  2D1O A;  1XFV A;  4H30 A;  3WV3 A;  1BKC I;  3EDI A;  2OXW A;  2J0T A;  1Y93 A;  4PKW A;  4AXQ A;  4PKV A;  1GXD A;  3HY7 A;  3SHI A;  2DW0 A;  2AYK A;  4H84 A;  1XUC A;  1IAG A;  3WV1 A;  1HOV A;  4GR8 A;  5D1U A;  1JIZ A;  1MMP A;  4HMA A;  4G0D A;  3AYU A;  1XFX A;  2W15 A;  4ON1 A;  3LUN A;  2OVZ A;  1OM8 A;  1BKC E;  2Z2D A;  3O64 A;  1B3D A;  1KAP P;  4ILW D;  1JIW P;  3LIK A;  1R54 A;  2L0R A;  3F17 A;  1I76 A;  3DTK A;  2ERO A;  5I4O A;  1Y0V A;  1KUF A;  3WV2 A;  3OHL A;  1G12 A;  2HU6 A;  1XFU A;  1YCM A;  2K2G A;  4PKU A;  4XM6 A;  1GKC A;  4FVL A;  2USN A;  4FU4 A;  3AYK A;  1OM6 A;  2WO8 A;  2V4B A;  3OHO A;  3LIR A;  2OW9 A;  3LGP A;  1JJ9 A;  3V96 B;  3N2U A;  1RM8 A;  1R1I A;  1IAA A;  1K7Q A;  3RTS A;  4JQG A;  4JPA A;  1UTT A;  3CKI A;  1UEA A;  1KUG A;  3TSK A;  5CZM A;  4H82 A;  2Y6D A;  1CXV A;  1BSW A;  3LQ0 A;  1JAQ A;  1EB6 A;  3I7I A;  3HDB A;  1BIW A;  3DWB A;  4QKZ A;  1ZTQ A;  1D8M A;  1K7I A;  5D2B A;  1HTD A;  2I47 A;  2X7M A;  3P1V A;  2J83 A;  3P24 A;  1HY7 A;  2FV9 A;  1CGE A;  1R1J A;  1BKC A;  5D1T A;  3F15 A;  1EUB A;  4PKS A;  1SLM A;  4H76 A;  5I12 A;  3EWJ A;  1IAB A;  456C A;  4FXQ A;  1CQR A;  1SAT A;  4R3V A;  3ZUK A;  3LUM A;  5BPA A;  1MMB A;  3KRY A;  3EDG A;  2CKI A;  1CGL A;  1XFZ A;  2OW1 A;  2YB9 A;  1OS9 A;  1DMT A;  2WO9 A;  4JIJ A;  4PKT A;  2WOA A;  4ZR5 A;  4AUO A;  3EDZ A;  3ELM A;  2JT6 A;  3HYG A;  1K7G A;  1IAE A;  1ZP5 A;  1J7N A;  1XUR A;  2OW2 A;  1XUD A;  4GUY A;  2DDY A;  1PWP A;  1XFW A;  4GR0 A;  4HX3 A;  1JAO A;  1QUA A;  2YIG A;  1A86 A;  4I35 A;  1ZS0 A;  2OXU A;  3BA0 A;  3L0V A;  2OY2 A;  3TS4 A;  5BOT A;  1KUH A;  2MZE A;  4XM8 A;  1O0Q A;  3RTT A;  3KEJ A;  3TT4 A;  1L6J A;  4PKR A;  3EHX A;  3USN A;  3LEA A;  5B5P A;  4IJO A;  3LIL A;  2KRJ A;  4Q1L A;  4WKE A;  3LJZ A;  4WKI A;  1I73 A;  1ZXC A;  4DV8 A;  2O36 A;  1H71 P;  1SU3 A;  4WF6 A;  1OM7 A;  5B5O A;  1FBL A;  3DNG A;  1GO8 P;  2OXZ A;  3HY9 A;  3KEK A;  3LE9 A;  3EHY A;  1SLN A;  3F19 A;  5CXA A;  3K7L A;  3GBO A;  1KBC A;  2PJT A;  4A3W A;  4H1Q A;  3G42 A;  3VI1 A;  3MA2 A;  4H2E A;  2X3B A;  3KME A;  3UVC A;  4DD8 A;  1QJI A;  1SRP A;  1CK7 A;  3U1R A;  4XCT A;  2DW2 A;  4EFS A;  1EAK A;  1R1H A;  2JIH A;  3B92 A;  3TVC A;  2X3A A;  2RJP A;  1ND1 A;  3F1A A;  1BM6 A;  1ZVX A;  4CTH A;  2W0D A;  1PWQ A;  2AIG P;  3B8Z A;  4WK7 A;  3DTE A;  1C3I A;  2Y6C A;  1A85 A;  2FV5 A;  1O0T A;  3HBU P;  4WZV A;  3LQB A;  3LK8 A;  5I3M A;  2D1N A;  5CUH A;  1KUI A;  3DPF A;  1GE7 A;  1YQY A;  4AYK A;  1JK3 A;  2A8H A;  1ROS A;  4AIG A;  4GWM A;  1GE5 A;  4XM7 A;  3G5C A;  1QJJ A;  2SRT A;  1KUK A;  3LMC A;  3DPE A;  1ZXV A;  3KEC A;  1WNI A;  4G9L A;  3L0T A;  4JP4 A;  1YOU A;  2MLS A;  1JKY A;  3HB2 P;  2O3E A;  1OS2 A;  1Y8J A;  2XS3 A;  2POJ A;  3ZVS A;  4H49 A;  2ERP A;  3HDA P;  1CGF A;  1G05 A;  5JMY A;  4I03 A;  5I2Z A;  4DPE A;  1R55 A;  1HV5 A;  1G4K A;  5D3C A;  1D8F A;  2OVX A;  1B8Y A;  3I7G A;  2CLT A;  1AYK A;  1RMZ A;  1MMQ A;  3NX7 A;  3B2Z A;  3F18 A;  1QIB A;  1BUD A;  1UTZ A;  2YUF A;  4JA1 A;  1OMJ A;  1JH1 A;  2OY4 A;  1GO7 P;  4L6T A;  5D1S A;  1G49 A;  1Z3J A;  2XS4 A;  1HFS A;  2MLR A;  830C A;  2OW0 A;  3O2X A;  2OZR A;  3KHI A;  4GQL A;  1CIZ A;  2MZI A;  2QPJ A;  2JSD A;  4L19 A;  2RJQ A;  1BQO A;  1UMS A;  2JNP A;  3KWV C;  1G9K A;  1HFC A;  1FLS A;  3DSL A;  4GF1 A;  1UMT A;  1PWU A;  4PKQ A;  3Q2H A;  1Q3A A;  1AST A;  1MMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...