3DSLA

The three-dimensional structure of bothropasin, the main hemorrhagic factor from bothrops jararaca venom.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
416
structure length
416
Chain Sequence
QKYNPFRYVELFIVVDQGMVTKNNGDLDKIKARMYELANIVNEILRYLYMHAALVGLEIWSNGDKITVKPDVDYTLNSFAEWRKTDLLTRKKHDNAQLLTAIDFNGPTIGYAYIGSMCHPKRSVAIVEDYSPINLVVAVIMAHEMGHNLGIHHDTDFCSCGDYPCIMGPTISNEPSKFFSNCSYIQCWDFIMKENPQCILNEPLGTDIVSPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYALFGADVYEAEDSCFKDNQKGNYYGYCRKENGKKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNDDEHKGMVLPGTKCADGKVCSNGHCVDVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc metalloproteinase-disintegrin bothropasin
publication title The three-dimensional structure of bothropasin, the main hemorrhagic factor from Bothrops jararaca venom: Insights for a new classification of snake venom metalloprotease subgroups.
pubmed doi rcsb
molecule tags Hydrolase
total genus 119
structure length 416
sequence length 416
chains with identical sequence B
ec nomenclature ec 3.4.24.49: Bothropasin.
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dslA01
1OM6A 5D3CA 1BZSA 1CXVA 2RJQA 2JIHA 2D1OA 1S4BP 2D1NA 1XURA 4H3XA 1J7NA 3EWJA 3KWVC 4JQGA 4GQLA 2JSDA 3MA2A 1IAEA 4EFSA 4GR8A 4GWNA 4PKUA 3AYKA 1SLMA 456CA 1G4KA 4G9LA 5D2BA 1JANA 1GXDA 1K7QA 1GE7A 1MNCA 1IADA 3KRYA 4H76A 3Q2GA 4H82A 4H49A 2MZHA 3LJTA 3LILA 3OHLA 1CAQA 1FLSA 1D8FA 1JH1A 2W0DA 3KEJA 2RJPA 1R1HA 1GE5A 5BPAA 1R55A 5I4OA 2OXZA 1PWWA 3EDHA 2MZEA 1Y8JA 2PJTA 1Q3AA 3SHIA 4DD8A 3LQBA 3KMCA 5JMYA 4AYKA 3DWBA 3ZUKA 4J4MA 4G0DA 4R3VA 1KUHA 3ZXHA 1HOVA 3AYUA 1SMPA 4IJOA 1JAQA 1MMQA 3HBVP 1CIZA 1H71P 2OY2A 3VTGA 5CXAA 3TT4A 3K7LA 3Q2HA 1BQOA 3G5CA 5B5OA 1HFCA 1UMSA 2YIGA 1QIBA 1G12A 4JA1A 4FVLA 2EROA 1O0TA 3NX7A 2WO9A 4GUYA 1XFWA 2DDFA 2W15A 1JAOA 1FM1A 1KUGA 2OXUA 2OY4A 5BOYA 2HU6A 4H2EA 2E3XA 5CZMA 1BM6A 3F1AA 4HX3A 2X7MA 3CKIA 3N2VA 1Y0VA 1GO7P 2OI0A 3DNGA 5H8XA 2KRJA 1IACA 2X3CA 3KHIA 1PWUA 1MMBA 1D8MA 3ELMA 2DW2A 2DDYA 2J0TA 1XFXA 3LK8A 1ZS0A 1PWVA 3LQ0A 5D7WA 1O0QA 1BKCA 3HY9A 3DL1A 1UTZA 1OS2A 5D1UA 1OS9A 5I2ZA 5B5PA 3LJGA 2JNPA 2MLSA 2QPJA 2CKIA 1ZTQA 2JT6A 2K9CA 4GWMA 1I1IP 1C7KA 1KBCA 3USNA 1CK7A 1IAGA 1XUDA 1C8TA 1B8YA 2X3AA 4DPEA 5BOTA 2USNA 2W13A 4WZVA 1ATLA 4FXQA 1IAAA 1IABA 2WO8A 3EDGA 2Y6DA 5CUHA 2JT5A 3ZVSA 4AUOA 4PKQA 3EDIA 1A85A 1HV5A 3DSLA 2ERPA 4DV8A 1AYKA 1CGLA 1XUCA 1D5JA 3EHYA 1YOUA 3LGPA 4XM6A 1XFVA 4PKSA 4ILWD 4WF6A 4FXYP 2I47A 2O3EA 1ASTA 3B92A 3HY7A 4QKZA 1ND1A 2OZRA 1BKCE 2TCLA 4JIJA 1OM7A 1I73A 5I43A 1HY7A 1G05A 2DW1A 2ERQA 3KEKA 2L0RA 2OVXA 1JJ9A 1QIAA 3VI1A 1QICA 3LMCA 3LKAA 1G9KA 2Z2DA 4GR0A 2X3BA 2AIGP 3OHOA 2OW0A 2OW2A 2OW1A 4A3WA 1JIZA 3L0VA 1XFYA 1MMPA 2DW0A 3HYGA 1AF0A 3TVCA 1RMZA 1BQQM 4PKTA 4XM7A 1SU3A 1SRPA 1GKDA 4HMAA 1EAKA 3LIKA 2XS4A 1QJJA 3RTTA 2E2DA 1HTDA 4GR3A 1I76A 1R1JA 1GE6A 1EB6A 2YB9A 1GO8P 5L79A 4PKRA 1R54A 3LJZA 3F15A 4ON1A 4I35A 3LEAA 2MLRA 3HDBA 4FU4A 4DF9A 2CLTA 3HDAP 4AIGA 3WV3A 1K7IA 2O36A 3KMEA 3WV2A 3EHXA 2W14A 1GKCA 3WV1A 1C3IA 1L6JA 2OW9A 830CA 1QUAA 5I0LA 4WK7A 3B8ZA 2Y6CA 1Y93A 4L19A 4H1QA 2SRTA 3F17A 2J83A 1ZP5A 3U1RA 4ZR5A 1ROSA 3LUMA 1BUVM 3G42A 1JIWP 4WKEA 3GBOA 1AKLA 1G49A 1CGFA 966CA 3HBUP 4XM8A 1OM8A 2XS3A 1YQYA 5LABA 4PKVA 1UMTA 3LIRA 3BA0A 4JP4A 1ZXCA 1QJIA 5I3MA 3N2UA 1WNIA 1KAPP 1BUDA 5D1SA 1BSWA 4XBHA 1OMJA 1SATA 2OXWA 1CQRA 3TSKA 4H30A 3HB2P 1JAPA 1FBLA 1USNA 3B2ZA 1A86A 3P24A 3DPFA 1OO9A 1XFZA 2FV5A 2AYKA 3KECA 1CGEA 2OVZA 3F19A 1MMRA 1PWPA 3TS4A 2POJA 5I12A 3V96B 4GF1A 2V4BA 1K7GA 1JK3A 3I7IA 2A8HA 1XFUA 4JPAA 1UTTA 1ZVXA 4AXQA 2K2GA 1YP1A 3E8RA 2FV9A 3O64A 1D7XA 3P1VA 3F16A 3F18A 1JKYA 1KUKA 4H84A 3EDZA 1R1IA 1YCMA 1DTHA 1EUBA 1KUFA 1BIWA 1PWQA 1HFSA 4IUWA 3K7NA 4XCTA 2MZIA 1BKCI 4Q1LA 2N8RA 4A7BA 1KUIA 1DMTA 2WOAA 4L63A 4L6TA 3LUNA 1RM8A 5D1TA 4WKIA 4CTHA 3LE9A 1B3DA 2W12A 3RTSA 3AIGA 4IN9A 3O2XA 1UEAA 3L0TA 3DPEA 5L7FA 4PKWA 3I7GA 1ZXVA 1SLNA 4I03A 1Z3JA 3UVCA
chains in the Genus database with same CATH superfamily
1OM6A 5D3CA 1BZSA 1CXVA 2RJQA 2JIHA 2D1OA 1S4BP 2D1NA 1XURA 4H3XA 1J7NA 3EWJA 3KWVC 4JQGA 4GQLA 2JSDA 3MA2A 1IAEA 4EFSA 4GR8A 4GWNA 4PKUA 3AYKA 1SLMA 456CA 1G4KA 4G9LA 5D2BA 1JANA 1GXDA 1K7QA 1GE7A 1MNCA 1IADA 3KRYA 4H76A 3Q2GA 4H82A 4H49A 2MZHA 3LJTA 3LILA 3OHLA 1CAQA 1FLSA 1D8FA 1JH1A 2W0DA 3KEJA 2RJPA 1R1HA 1GE5A 5BPAA 1R55A 5I4OA 2OXZA 1PWWA 3EDHA 2MZEA 1Y8JA 2PJTA 1Q3AA 3DTIA 3SHIA 4DD8A 3LQBA 3KMCA 5JMYA 4AYKA 3DWBA 3ZUKA 4J4MA 4G0DA 4R3VA 1KUHA 3ZXHA 1HOVA 3AYUA 1SMPA 4IJOA 1JAQA 1MMQA 3HBVP 1CIZA 1H71P 2OY2A 3VTGA 5CXAA 3TT4A 3K7LA 3Q2HA 1BQOA 3G5CA 5B5OA 1HFCA 1UMSA 2YIGA 1QIBA 1G12A 4JA1A 4FVLA 2EROA 1O0TA 3NX7A 2WO9A 4GUYA 1XFWA 2DDFA 2W15A 1JAOA 1FM1A 1KUGA 2OXUA 2OY4A 5BOYA 2HU6A 4H2EA 2E3XA 5CZMA 1BM6A 3F1AA 4HX3A 2X7MA 3CKIA 3N2VA 1Y0VA 1GO7P 2OI0A 3DNGA 5H8XA 2KRJA 1IACA 2X3CA 3KHIA 1PWUA 1MMBA 1D8MA 3ELMA 2DW2A 2DDYA 2J0TA 1XFXA 3LK8A 1ZS0A 1PWVA 3LQ0A 5D7WA 1O0QA 1BKCA 3HY9A 3DL1A 1UTZA 1OS2A 5D1UA 1OS9A 5I2ZA 5B5PA 3LJGA 2JNPA 2MLSA 2QPJA 2CKIA 1ZTQA 2JT6A 2K9CA 4GWMA 1I1IP 1C7KA 1KBCA 3USNA 1CK7A 1IAGA 1XUDA 1C8TA 1B8YA 2X3AA 4DPEA 5BOTA 2USNA 2W13A 4WZVA 1ATLA 4FXQA 1IAAA 1IABA 2WO8A 3EDGA 2Y6DA 5CUHA 2JT5A 3ZVSA 4AUOA 4PKQA 3EDIA 1A85A 1HV5A 3DSLA 2ERPA 4DV8A 1AYKA 1CGLA 1XUCA 1TVIA 1D5JA 3EHYA 1YOUA 3LGPA 4XM6A 1XFVA 4PKSA 4ILWD 4WF6A 4FXYP 2I47A 2O3EA 1ASTA 3B92A 3HY7A 4QKZA 1ND1A 2OZRA 1BKCE 2TCLA 4JIJA 1OM7A 1I73A 5I43A 1HY7A 1G05A 1XM5A 2DW1A 2ERQA 3KEKA 2L0RA 2OVXA 1JJ9A 1QIAA 3VI1A 1QICA 3LMCA 3LKAA 1G9KA 2Z2DA 4GR0A 2X3BA 2AIGP 3OHOA 2OW0A 2OW2A 2OW1A 4A3WA 1JIZA 3L0VA 1XFYA 1MMPA 2DW0A 3HYGA 1AF0A 3TVCA 1RMZA 1BQQM 4PKTA 4XM7A 1SU3A 1SRPA 1GKDA 4HMAA 1EAKA 3DTEA 3LIKA 2XS4A 1QJJA 3RTTA 2E2DA 1HTDA 4GR3A 1I76A 1R1JA 1GE6A 1EB6A 2YB9A 1GO8P 5L79A 4PKRA 1R54A 3LJZA 3F15A 4ON1A 4I35A 3LEAA 2MLRA 3HDBA 4FU4A 4DF9A 2CLTA 3HDAP 4AIGA 3WV3A 1K7IA 2O36A 3KMEA 3WV2A 3EHXA 2W14A 1GKCA 3WV1A 1C3IA 1L6JA 2OW9A 830CA 1QUAA 5I0LA 4WK7A 3B8ZA 2Y6CA 1Y93A 4L19A 4H1QA 2SRTA 3F17A 2J83A 1ZP5A 3U1RA 4ZR5A 1ROSA 3LUMA 1BUVM 3G42A 1JIWP 4WKEA 3GBOA 1AKLA 1G49A 1CGFA 966CA 3HBUP 4XM8A 1OM8A 2XS3A 1YQYA 5LABA 4PKVA 1UMTA 3LIRA 3BA0A 4JP4A 1ZXCA 1QJIA 5I3MA 3N2UA 1WNIA 1KAPP 1BUDA 5D1SA 1BSWA 3DTKA 4XBHA 1OMJA 1SATA 2OXWA 1CQRA 3TSKA 4H30A 3HB2P 1JAPA 1FBLA 1USNA 3B2ZA 1A86A 3P24A 3DPFA 1OO9A 1XFZA 2FV5A 2AYKA 3KECA 1CGEA 2OVZA 3F19A 1MMRA 1PWPA 3TS4A 2POJA 5I12A 3V96B 4GF1A 2V4BA 1K7GA 1JK3A 3I7IA 2A8HA 1XFUA 1XAXA 4JPAA 1UTTA 1ZVXA 4AXQA 2K2GA 1YP1A 3E8RA 2FV9A 3O64A 1D7XA 3P1VA 3F16A 3F18A 1JKYA 1KUKA 4H84A 3EDZA 1R1IA 1YCMA 1DTHA 1OZ9A 1EUBA 1KUFA 1BIWA 1PWQA 1HFSA 4IUWA 3K7NA 2YUFA 4XCTA 2MZIA 4L7AA 1BKCI 4Q1LA 2N8RA 4A7BA 1KUIA 1DMTA 2WOAA 4L63A 4L6TA 3LUNA 1RM8A 5D1TA 4WKIA 4CTHA 3LE9A 1B3DA 2W12A 3RTSA 3AIGA 4IN9A 3O2XA 1UEAA 3L0TA 3DPEA 5L7FA 4PKWA 3I7GA 1ZXVA 1SLNA 4I03A 1Z3JA 3UVCA
chains in the Genus database with same CATH topology
1OM6A 5D3CA 1BZSA 1CXVA 2RJQA 2JIHA 2D1OA 1S4BP 2D1NA 1XURA 4H3XA 1J7NA 3EWJA 3KWVC 4JQGA 4GQLA 2JSDA 3MA2A 1IAEA 4EFSA 4GR8A 4GWNA 4PKUA 3AYKA 1SLMA 456CA 1G4KA 4G9LA 5D2BA 1JANA 1GXDA 1K7QA 1GE7A 1MNCA 1IADA 3KRYA 4H76A 3Q2GA 4H82A 4H49A 2MZHA 3LJTA 3LILA 3OHLA 1CAQA 1FLSA 1D8FA 1JH1A 2W0DA 3KEJA 2RJPA 1R1HA 1GE5A 5BPAA 1R55A 5I4OA 2OXZA 1PWWA 3EDHA 2MZEA 1Y8JA 2PJTA 1Q3AA 3DTIA 3SHIA 4DD8A 3LQBA 3KMCA 5JMYA 4AYKA 3DWBA 3ZUKA 4J4MA 4G0DA 4R3VA 1KUHA 3ZXHA 1HOVA 3AYUA 1SMPA 4IJOA 1JAQA 1MMQA 3HBVP 1CIZA 1H71P 2OY2A 3VTGA 5CXAA 3TT4A 3K7LA 3Q2HA 1BQOA 3G5CA 5B5OA 1HFCA 1UMSA 2YIGA 1QIBA 1G12A 4JA1A 4FVLA 2EROA 1O0TA 3NX7A 2WO9A 4GUYA 1XFWA 2DDFA 2W15A 1JAOA 1FM1A 1KUGA 2OXUA 2OY4A 5BOYA 2HU6A 4H2EA 2E3XA 5CZMA 1BM6A 3F1AA 4HX3A 2X7MA 3CKIA 3N2VA 1Y0VA 1GO7P 2OI0A 3DNGA 5H8XA 2KRJA 1IACA 2X3CA 3KHIA 1PWUA 1MMBA 1D8MA 3ELMA 2DW2A 2DDYA 2J0TA 1XFXA 3LK8A 1ZS0A 1PWVA 3LQ0A 5D7WA 1O0QA 1BKCA 3HY9A 3DL1A 1UTZA 1OS2A 5D1UA 1OS9A 5I2ZA 5B5PA 3LJGA 2JNPA 2MLSA 2QPJA 2CKIA 1ZTQA 2JT6A 2K9CA 4GWMA 1I1IP 1C7KA 1KBCA 3USNA 1CK7A 1IAGA 1XUDA 1C8TA 1B8YA 2X3AA 4DPEA 5BOTA 2USNA 2W13A 4WZVA 1ATLA 4FXQA 1IAAA 1IABA 2WO8A 3EDGA 2Y6DA 5CUHA 2JT5A 3ZVSA 4AUOA 4PKQA 3EDIA 1A85A 1HV5A 3DSLA 2ERPA 4DV8A 1AYKA 1CGLA 1XUCA 1D5JA 3EHYA 1YOUA 3LGPA 4XM6A 1XFVA 4PKSA 4ILWD 4WF6A 4FXYP 2I47A 2O3EA 1ASTA 3B92A 3HY7A 4QKZA 1ND1A 2OZRA 1BKCE 2TCLA 4JIJA 1OM7A 1I73A 5I43A 1HY7A 1G05A 2DW1A 2ERQA 3KEKA 2L0RA 2OVXA 1JJ9A 1QIAA 3VI1A 1QICA 3LMCA 3LKAA 1G9KA 2Z2DA 4GR0A 2X3BA 2AIGP 3OHOA 2OW0A 2OW2A 2OW1A 4A3WA 1JIZA 3L0VA 1XFYA 1MMPA 2DW0A 3HYGA 1AF0A 3TVCA 1RMZA 1BQQM 4PKTA 4XM7A 1SU3A 1SRPA 1GKDA 4HMAA 1EAKA 3DTEA 3LIKA 2XS4A 1QJJA 3RTTA 2E2DA 1HTDA 4GR3A 1I76A 1R1JA 1GE6A 1EB6A 2YB9A 1GO8P 5L79A 4PKRA 1R54A 3LJZA 3F15A 4ON1A 4I35A 3LEAA 2MLRA 3HDBA 4FU4A 4DF9A 2CLTA 3HDAP 4AIGA 3WV3A 1K7IA 2O36A 3KMEA 3WV2A 3EHXA 2W14A 1GKCA 3WV1A 1C3IA 1L6JA 2OW9A 830CA 1QUAA 5I0LA 4WK7A 3B8ZA 2Y6CA 1Y93A 4L19A 4H1QA 2SRTA 3F17A 2J83A 1ZP5A 3U1RA 4ZR5A 1ROSA 3LUMA 1BUVM 3G42A 1JIWP 4WKEA 3GBOA 1AKLA 1G49A 1CGFA 966CA 3HBUP 4XM8A 1OM8A 2XS3A 1YQYA 5LABA 4PKVA 1UMTA 3LIRA 3BA0A 4JP4A 1ZXCA 1QJIA 5I3MA 3N2UA 1WNIA 1KAPP 1BUDA 5D1SA 1BSWA 3DTKA 4XBHA 1OMJA 1SATA 2OXWA 1CQRA 3TSKA 4H30A 3HB2P 1JAPA 1FBLA 1USNA 3B2ZA 1A86A 3P24A 3DPFA 1OO9A 1XFZA 2FV5A 2AYKA 3KECA 1CGEA 2OVZA 3F19A 1MMRA 1PWPA 3TS4A 2POJA 5I12A 3V96B 4GF1A 2V4BA 1K7GA 1JK3A 3I7IA 2A8HA 1XFUA 4JPAA 1UTTA 1ZVXA 4AXQA 2K2GA 1YP1A 3E8RA 2FV9A 3O64A 1D7XA 3P1VA 3F16A 3F18A 1JKYA 1KUKA 4H84A 3EDZA 1R1IA 1YCMA 1DTHA 1EUBA 1KUFA 1BIWA 1PWQA 1HFSA 4IUWA 3K7NA 2YUFA 4XCTA 2MZIA 4L7AA 1BKCI 4Q1LA 2N8RA 4A7BA 1KUIA 1DMTA 2WOAA 4L63A 4L6TA 3LUNA 1RM8A 5D1TA 4WKIA 4CTHA 3LE9A 1B3DA 2W12A 3RTSA 3AIGA 4IN9A 3O2XA 1UEAA 3L0TA 3DPEA 5L7FA 4PKWA 3I7GA 1ZXVA 1SLNA 4I03A 1Z3JA 3UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM6 A;  5D3C A;  1BZS A;  1CXV A;  2RJQ A;  2JIH A;  2D1O A;  1S4B P;  2D1N A;  1XUR A;  4H3X A;  1J7N A;  3EWJ A;  3KWV C;  4JQG A;  4GQL A;  2JSD A;  3MA2 A;  1IAE A;  4EFS A;  4GR8 A;  4GWN A;  4PKU A;  3AYK A;  1SLM A;  456C A;  1G4K A;  4G9L A;  5D2B A;  1JAN A;  1GXD A;  1K7Q A;  1GE7 A;  1MNC A;  1IAD A;  3KRY A;  4H76 A;  3Q2G A;  4H82 A;  4H49 A;  2MZH A;  3LJT A;  3LIL A;  3OHL A;  1CAQ A;  1FLS A;  1D8F A;  1JH1 A;  2W0D A;  3KEJ A;  2RJP A;  1R1H A;  1GE5 A;  5BPA A;  1R55 A;  5I4O A;  2OXZ A;  1PWW A;  3EDH A;  2MZE A;  1Y8J A;  2PJT A;  1Q3A A;  3SHI A;  4DD8 A;  3LQB A;  3KMC A;  5JMY A;  4AYK A;  3DWB A;  3ZUK A;  4J4M A;  4G0D A;  4R3V A;  1KUH A;  3ZXH A;  1HOV A;  3AYU A;  1SMP A;  4IJO A;  1JAQ A;  1MMQ A;  3HBV P;  1CIZ A;  1H71 P;  2OY2 A;  3VTG A;  5CXA A;  3TT4 A;  3K7L A;  3Q2H A;  1BQO A;  3G5C A;  5B5O A;  1HFC A;  1UMS A;  2YIG A;  1QIB A;  1G12 A;  4JA1 A;  4FVL A;  2ERO A;  1O0T A;  3NX7 A;  2WO9 A;  4GUY A;  1XFW A;  2DDF A;  2W15 A;  1JAO A;  1FM1 A;  1KUG A;  2OXU A;  2OY4 A;  5BOY A;  2HU6 A;  4H2E A;  2E3X A;  5CZM A;  1BM6 A;  3F1A A;  4HX3 A;  2X7M A;  3CKI A;  3N2V A;  1Y0V A;  1GO7 P;  2OI0 A;  3DNG A;  5H8X A;  2KRJ A;  1IAC A;  2X3C A;  3KHI A;  1PWU A;  1MMB A;  1D8M A;  3ELM A;  2DW2 A;  2DDY A;  2J0T A;  1XFX A;  3LK8 A;  1ZS0 A;  1PWV A;  3LQ0 A;  5D7W A;  1O0Q A;  1BKC A;  3HY9 A;  3DL1 A;  1UTZ A;  1OS2 A;  5D1U A;  1OS9 A;  5I2Z A;  5B5P A;  3LJG A;  2JNP A;  2MLS A;  2QPJ A;  2CKI A;  1ZTQ A;  2JT6 A;  2K9C A;  4GWM A;  1I1I P;  1C7K A;  1KBC A;  3USN A;  1CK7 A;  1IAG A;  1XUD A;  1C8T A;  1B8Y A;  2X3A A;  4DPE A;  5BOT A;  2USN A;  2W13 A;  4WZV A;  1ATL A;  4FXQ A;  1IAA A;  1IAB A;  2WO8 A;  3EDG A;  2Y6D A;  5CUH A;  2JT5 A;  3ZVS A;  4AUO A;  4PKQ A;  3EDI A;  1A85 A;  1HV5 A;  3DSL A;  2ERP A;  4DV8 A;  1AYK A;  1CGL A;  1XUC A;  1D5J A;  3EHY A;  1YOU A;  3LGP A;  4XM6 A;  1XFV A;  4PKS A;  4ILW D;  4WF6 A;  4FXY P;  2I47 A;  2O3E A;  1AST A;  3B92 A;  3HY7 A;  4QKZ A;  1ND1 A;  2OZR A;  1BKC E;  2TCL A;  4JIJ A;  1OM7 A;  1I73 A;  5I43 A;  1HY7 A;  1G05 A;  2DW1 A;  2ERQ A;  3KEK A;  2L0R A;  2OVX A;  1JJ9 A;  1QIA A;  3VI1 A;  1QIC A;  3LMC A;  3LKA A;  1G9K A;  2Z2D A;  4GR0 A;  2X3B A;  2AIG P;  3OHO A;  2OW0 A;  2OW2 A;  2OW1 A;  4A3W A;  1JIZ A;  3L0V A;  1XFY A;  1MMP A;  2DW0 A;  3HYG A;  1AF0 A;  3TVC A;  1RMZ A;  1BQQ M;  4PKT A;  4XM7 A;  1SU3 A;  1SRP A;  1GKD A;  4HMA A;  1EAK A;  3LIK A;  2XS4 A;  1QJJ A;  3RTT A;  2E2D A;  1HTD A;  4GR3 A;  1I76 A;  1R1J A;  1GE6 A;  1EB6 A;  2YB9 A;  1GO8 P;  5L79 A;  4PKR A;  1R54 A;  3LJZ A;  3F15 A;  4ON1 A;  4I35 A;  3LEA A;  2MLR A;  3HDB A;  4FU4 A;  4DF9 A;  2CLT A;  3HDA P;  4AIG A;  3WV3 A;  1K7I A;  2O36 A;  3KME A;  3WV2 A;  3EHX A;  2W14 A;  1GKC A;  3WV1 A;  1C3I A;  1L6J A;  2OW9 A;  830C A;  1QUA A;  5I0L A;  4WK7 A;  3B8Z A;  2Y6C A;  1Y93 A;  4L19 A;  4H1Q A;  2SRT A;  3F17 A;  2J83 A;  1ZP5 A;  3U1R A;  4ZR5 A;  1ROS A;  3LUM A;  1BUV M;  3G42 A;  1JIW P;  4WKE A;  3GBO A;  1AKL A;  1G49 A;  1CGF A;  966C A;  3HBU P;  4XM8 A;  1OM8 A;  2XS3 A;  1YQY A;  5LAB A;  4PKV A;  1UMT A;  3LIR A;  3BA0 A;  4JP4 A;  1ZXC A;  1QJI A;  5I3M A;  3N2U A;  1WNI A;  1KAP P;  1BUD A;  5D1S A;  1BSW A;  4XBH A;  1OMJ A;  1SAT A;  2OXW A;  1CQR A;  3TSK A;  4H30 A;  3HB2 P;  1JAP A;  1FBL A;  1USN A;  3B2Z A;  1A86 A;  3P24 A;  3DPF A;  1OO9 A;  1XFZ A;  2FV5 A;  2AYK A;  3KEC A;  1CGE A;  2OVZ A;  3F19 A;  1MMR A;  1PWP A;  3TS4 A;  2POJ A;  5I12 A;  3V96 B;  4GF1 A;  2V4B A;  1K7G A;  1JK3 A;  3I7I A;  2A8H A;  1XFU A;  4JPA A;  1UTT A;  1ZVX A;  4AXQ A;  2K2G A;  1YP1 A;  3E8R A;  2FV9 A;  3O64 A;  1D7X A;  3P1V A;  3F16 A;  3F18 A;  1JKY A;  1KUK A;  4H84 A;  3EDZ A;  1R1I A;  1YCM A;  1DTH A;  1EUB A;  1KUF A;  1BIW A;  1PWQ A;  1HFS A;  4IUW A;  3K7N A;  4XCT A;  2MZI A;  1BKC I;  4Q1L A;  2N8R A;  4A7B A;  1KUI A;  1DMT A;  2WOA A;  4L63 A;  4L6T A;  3LUN A;  1RM8 A;  5D1T A;  4WKI A;  4CTH A;  3LE9 A;  1B3D A;  2W12 A;  3RTS A;  3AIG A;  4IN9 A;  3O2X A;  1UEA A;  3L0T A;  3DPE A;  5L7F A;  4PKW A;  3I7G A;  1ZXV A;  1SLN A;  4I03 A;  1Z3J A;  3UVC A; 
#chains in the Genus database with same CATH topology
 1OM6 A;  5D3C A;  1BZS A;  1CXV A;  2RJQ A;  2JIH A;  2D1O A;  1S4B P;  2D1N A;  1XUR A;  4H3X A;  1J7N A;  3EWJ A;  3KWV C;  4JQG A;  4GQL A;  2JSD A;  3MA2 A;  1IAE A;  4EFS A;  4GR8 A;  4GWN A;  4PKU A;  3AYK A;  1SLM A;  456C A;  1G4K A;  4G9L A;  5D2B A;  1JAN A;  1GXD A;  1K7Q A;  1GE7 A;  1MNC A;  1IAD A;  3KRY A;  4H76 A;  3Q2G A;  4H82 A;  4H49 A;  2MZH A;  3LJT A;  3LIL A;  3OHL A;  1CAQ A;  1FLS A;  1D8F A;  1JH1 A;  2W0D A;  3KEJ A;  2RJP A;  1R1H A;  1GE5 A;  5BPA A;  1R55 A;  5I4O A;  2OXZ A;  1PWW A;  3EDH A;  2MZE A;  1Y8J A;  2PJT A;  1Q3A A;  3DTI A;  3SHI A;  4DD8 A;  3LQB A;  3KMC A;  5JMY A;  4AYK A;  3DWB A;  3ZUK A;  4J4M A;  4G0D A;  4R3V A;  1KUH A;  3ZXH A;  1HOV A;  3AYU A;  1SMP A;  4IJO A;  1JAQ A;  1MMQ A;  3HBV P;  1CIZ A;  1H71 P;  2OY2 A;  3VTG A;  5CXA A;  3TT4 A;  3K7L A;  3Q2H A;  1BQO A;  3G5C A;  5B5O A;  1HFC A;  1UMS A;  2YIG A;  1QIB A;  1G12 A;  4JA1 A;  4FVL A;  2ERO A;  1O0T A;  3NX7 A;  2WO9 A;  4GUY A;  1XFW A;  2DDF A;  2W15 A;  1JAO A;  1FM1 A;  1KUG A;  2OXU A;  2OY4 A;  5BOY A;  2HU6 A;  4H2E A;  2E3X A;  5CZM A;  1BM6 A;  3F1A A;  4HX3 A;  2X7M A;  3CKI A;  3N2V A;  1Y0V A;  1GO7 P;  2OI0 A;  3DNG A;  5H8X A;  2KRJ A;  1IAC A;  2X3C A;  3KHI A;  1PWU A;  1MMB A;  1D8M A;  3ELM A;  2DW2 A;  2DDY A;  2J0T A;  1XFX A;  3LK8 A;  1ZS0 A;  1PWV A;  3LQ0 A;  5D7W A;  1O0Q A;  1BKC A;  3HY9 A;  3DL1 A;  1UTZ A;  1OS2 A;  5D1U A;  1OS9 A;  5I2Z A;  5B5P A;  3LJG A;  2JNP A;  2MLS A;  2QPJ A;  2CKI A;  1ZTQ A;  2JT6 A;  2K9C A;  4GWM A;  1I1I P;  1C7K A;  1KBC A;  3USN A;  1CK7 A;  1IAG A;  1XUD A;  1C8T A;  1B8Y A;  2X3A A;  4DPE A;  5BOT A;  2USN A;  2W13 A;  4WZV A;  1ATL A;  4FXQ A;  1IAA A;  1IAB A;  2WO8 A;  3EDG A;  2Y6D A;  5CUH A;  2JT5 A;  3ZVS A;  4AUO A;  4PKQ A;  3EDI A;  1A85 A;  1HV5 A;  3DSL A;  2ERP A;  4DV8 A;  1AYK A;  1CGL A;  1XUC A;  1TVI A;  1D5J A;  3EHY A;  1YOU A;  3LGP A;  4XM6 A;  1XFV A;  4PKS A;  4ILW D;  4WF6 A;  4FXY P;  2I47 A;  2O3E A;  1AST A;  3B92 A;  3HY7 A;  4QKZ A;  1ND1 A;  2OZR A;  1BKC E;  2TCL A;  4JIJ A;  1OM7 A;  1I73 A;  5I43 A;  1HY7 A;  1G05 A;  1XM5 A;  2DW1 A;  2ERQ A;  3KEK A;  2L0R A;  2OVX A;  1JJ9 A;  1QIA A;  3VI1 A;  1QIC A;  3LMC A;  3LKA A;  1G9K A;  2Z2D A;  4GR0 A;  2X3B A;  2AIG P;  3OHO A;  2OW0 A;  2OW2 A;  2OW1 A;  4A3W A;  1JIZ A;  3L0V A;  1XFY A;  1MMP A;  2DW0 A;  3HYG A;  1AF0 A;  3TVC A;  1RMZ A;  1BQQ M;  4PKT A;  4XM7 A;  1SU3 A;  1SRP A;  1GKD A;  4HMA A;  1EAK A;  3DTE A;  3LIK A;  2XS4 A;  1QJJ A;  3RTT A;  2E2D A;  1HTD A;  4GR3 A;  1I76 A;  1R1J A;  1GE6 A;  1EB6 A;  2YB9 A;  1GO8 P;  5L79 A;  4PKR A;  1R54 A;  3LJZ A;  3F15 A;  4ON1 A;  4I35 A;  3LEA A;  2MLR A;  3HDB A;  4FU4 A;  4DF9 A;  2CLT A;  3HDA P;  4AIG A;  3WV3 A;  1K7I A;  2O36 A;  3KME A;  3WV2 A;  3EHX A;  2W14 A;  1GKC A;  3WV1 A;  1C3I A;  1L6J A;  2OW9 A;  830C A;  1QUA A;  5I0L A;  4WK7 A;  3B8Z A;  2Y6C A;  1Y93 A;  4L19 A;  4H1Q A;  2SRT A;  3F17 A;  2J83 A;  1ZP5 A;  3U1R A;  4ZR5 A;  1ROS A;  3LUM A;  1BUV M;  3G42 A;  1JIW P;  4WKE A;  3GBO A;  1AKL A;  1G49 A;  1CGF A;  966C A;  3HBU P;  4XM8 A;  1OM8 A;  2XS3 A;  1YQY A;  5LAB A;  4PKV A;  1UMT A;  3LIR A;  3BA0 A;  4JP4 A;  1ZXC A;  1QJI A;  5I3M A;  3N2U A;  1WNI A;  1KAP P;  1BUD A;  5D1S A;  1BSW A;  3DTK A;  4XBH A;  1OMJ A;  1SAT A;  2OXW A;  1CQR A;  3TSK A;  4H30 A;  3HB2 P;  1JAP A;  1FBL A;  1USN A;  3B2Z A;  1A86 A;  3P24 A;  3DPF A;  1OO9 A;  1XFZ A;  2FV5 A;  2AYK A;  3KEC A;  1CGE A;  2OVZ A;  3F19 A;  1MMR A;  1PWP A;  3TS4 A;  2POJ A;  5I12 A;  3V96 B;  4GF1 A;  2V4B A;  1K7G A;  1JK3 A;  3I7I A;  2A8H A;  1XFU A;  1XAX A;  4JPA A;  1UTT A;  1ZVX A;  4AXQ A;  2K2G A;  1YP1 A;  3E8R A;  2FV9 A;  3O64 A;  1D7X A;  3P1V A;  3F16 A;  3F18 A;  1JKY A;  1KUK A;  4H84 A;  3EDZ A;  1R1I A;  1YCM A;  1DTH A;  1OZ9 A;  1EUB A;  1KUF A;  1BIW A;  1PWQ A;  1HFS A;  4IUW A;  3K7N A;  2YUF A;  4XCT A;  2MZI A;  4L7A A;  1BKC I;  4Q1L A;  2N8R A;  4A7B A;  1KUI A;  1DMT A;  2WOA A;  4L63 A;  4L6T A;  3LUN A;  1RM8 A;  5D1T A;  4WKI A;  4CTH A;  3LE9 A;  1B3D A;  2W12 A;  3RTS A;  3AIG A;  4IN9 A;  3O2X A;  1UEA A;  3L0T A;  3DPE A;  5L7F A;  4PKW A;  3I7G A;  1ZXV A;  1SLN A;  4I03 A;  1Z3J A;  3UVC A; 
#chains in the Genus database with same CATH homology
 1OM6 A;  5D3C A;  1BZS A;  1CXV A;  2RJQ A;  2JIH A;  2D1O A;  1S4B P;  2D1N A;  1XUR A;  4H3X A;  1J7N A;  3EWJ A;  3KWV C;  4JQG A;  4GQL A;  2JSD A;  3MA2 A;  1IAE A;  4EFS A;  4GR8 A;  4GWN A;  4PKU A;  3AYK A;  1SLM A;  456C A;  1G4K A;  4G9L A;  5D2B A;  1JAN A;  1GXD A;  1K7Q A;  1GE7 A;  1MNC A;  1IAD A;  3KRY A;  4H76 A;  3Q2G A;  4H82 A;  4H49 A;  2MZH A;  3LJT A;  3LIL A;  3OHL A;  1CAQ A;  1FLS A;  1D8F A;  1JH1 A;  2W0D A;  3KEJ A;  2RJP A;  1R1H A;  1GE5 A;  5BPA A;  1R55 A;  5I4O A;  2OXZ A;  1PWW A;  3EDH A;  2MZE A;  1Y8J A;  2PJT A;  1Q3A A;  3DTI A;  3SHI A;  4DD8 A;  3LQB A;  3KMC A;  5JMY A;  4AYK A;  3DWB A;  3ZUK A;  4J4M A;  4G0D A;  4R3V A;  1KUH A;  3ZXH A;  1HOV A;  3AYU A;  1SMP A;  4IJO A;  1JAQ A;  1MMQ A;  3HBV P;  1CIZ A;  1H71 P;  2OY2 A;  3VTG A;  5CXA A;  3TT4 A;  3K7L A;  3Q2H A;  1BQO A;  3G5C A;  5B5O A;  1HFC A;  1UMS A;  2YIG A;  1QIB A;  1G12 A;  4JA1 A;  4FVL A;  2ERO A;  1O0T A;  3NX7 A;  2WO9 A;  4GUY A;  1XFW A;  2DDF A;  2W15 A;  1JAO A;  1FM1 A;  1KUG A;  2OXU A;  2OY4 A;  5BOY A;  2HU6 A;  4H2E A;  2E3X A;  5CZM A;  1BM6 A;  3F1A A;  4HX3 A;  2X7M A;  3CKI A;  3N2V A;  1Y0V A;  1GO7 P;  2OI0 A;  3DNG A;  5H8X A;  2KRJ A;  1IAC A;  2X3C A;  3KHI A;  1PWU A;  1MMB A;  1D8M A;  3ELM A;  2DW2 A;  2DDY A;  2J0T A;  1XFX A;  3LK8 A;  1ZS0 A;  1PWV A;  3LQ0 A;  5D7W A;  1O0Q A;  1BKC A;  3HY9 A;  3DL1 A;  1UTZ A;  1OS2 A;  5D1U A;  1OS9 A;  5I2Z A;  5B5P A;  3LJG A;  2JNP A;  2MLS A;  2QPJ A;  2CKI A;  1ZTQ A;  2JT6 A;  2K9C A;  4GWM A;  1I1I P;  1C7K A;  1KBC A;  3USN A;  1CK7 A;  1IAG A;  1XUD A;  1C8T A;  1B8Y A;  2X3A A;  4DPE A;  5BOT A;  2USN A;  2W13 A;  4WZV A;  1ATL A;  4FXQ A;  1IAA A;  1IAB A;  2WO8 A;  3EDG A;  2Y6D A;  5CUH A;  2JT5 A;  3ZVS A;  4AUO A;  4PKQ A;  3EDI A;  1A85 A;  1HV5 A;  3DSL A;  2ERP A;  4DV8 A;  1AYK A;  1CGL A;  1XUC A;  1D5J A;  3EHY A;  1YOU A;  3LGP A;  4XM6 A;  1XFV A;  4PKS A;  4ILW D;  4WF6 A;  4FXY P;  2I47 A;  2O3E A;  1AST A;  3B92 A;  3HY7 A;  4QKZ A;  1ND1 A;  2OZR A;  1BKC E;  2TCL A;  4JIJ A;  1OM7 A;  1I73 A;  5I43 A;  1HY7 A;  1G05 A;  2DW1 A;  2ERQ A;  3KEK A;  2L0R A;  2OVX A;  1JJ9 A;  1QIA A;  3VI1 A;  1QIC A;  3LMC A;  3LKA A;  1G9K A;  2Z2D A;  4GR0 A;  2X3B A;  2AIG P;  3OHO A;  2OW0 A;  2OW2 A;  2OW1 A;  4A3W A;  1JIZ A;  3L0V A;  1XFY A;  1MMP A;  2DW0 A;  3HYG A;  1AF0 A;  3TVC A;  1RMZ A;  1BQQ M;  4PKT A;  4XM7 A;  1SU3 A;  1SRP A;  1GKD A;  4HMA A;  1EAK A;  3DTE A;  3LIK A;  2XS4 A;  1QJJ A;  3RTT A;  2E2D A;  1HTD A;  4GR3 A;  1I76 A;  1R1J A;  1GE6 A;  1EB6 A;  2YB9 A;  1GO8 P;  5L79 A;  4PKR A;  1R54 A;  3LJZ A;  3F15 A;  4ON1 A;  4I35 A;  3LEA A;  2MLR A;  3HDB A;  4FU4 A;  4DF9 A;  2CLT A;  3HDA P;  4AIG A;  3WV3 A;  1K7I A;  2O36 A;  3KME A;  3WV2 A;  3EHX A;  2W14 A;  1GKC A;  3WV1 A;  1C3I A;  1L6J A;  2OW9 A;  830C A;  1QUA A;  5I0L A;  4WK7 A;  3B8Z A;  2Y6C A;  1Y93 A;  4L19 A;  4H1Q A;  2SRT A;  3F17 A;  2J83 A;  1ZP5 A;  3U1R A;  4ZR5 A;  1ROS A;  3LUM A;  1BUV M;  3G42 A;  1JIW P;  4WKE A;  3GBO A;  1AKL A;  1G49 A;  1CGF A;  966C A;  3HBU P;  4XM8 A;  1OM8 A;  2XS3 A;  1YQY A;  5LAB A;  4PKV A;  1UMT A;  3LIR A;  3BA0 A;  4JP4 A;  1ZXC A;  1QJI A;  5I3M A;  3N2U A;  1WNI A;  1KAP P;  1BUD A;  5D1S A;  1BSW A;  3DTK A;  4XBH A;  1OMJ A;  1SAT A;  2OXW A;  1CQR A;  3TSK A;  4H30 A;  3HB2 P;  1JAP A;  1FBL A;  1USN A;  3B2Z A;  1A86 A;  3P24 A;  3DPF A;  1OO9 A;  1XFZ A;  2FV5 A;  2AYK A;  3KEC A;  1CGE A;  2OVZ A;  3F19 A;  1MMR A;  1PWP A;  3TS4 A;  2POJ A;  5I12 A;  3V96 B;  4GF1 A;  2V4B A;  1K7G A;  1JK3 A;  3I7I A;  2A8H A;  1XFU A;  4JPA A;  1UTT A;  1ZVX A;  4AXQ A;  2K2G A;  1YP1 A;  3E8R A;  2FV9 A;  3O64 A;  1D7X A;  3P1V A;  3F16 A;  3F18 A;  1JKY A;  1KUK A;  4H84 A;  3EDZ A;  1R1I A;  1YCM A;  1DTH A;  1EUB A;  1KUF A;  1BIW A;  1PWQ A;  1HFS A;  4IUW A;  3K7N A;  2YUF A;  4XCT A;  2MZI A;  4L7A A;  1BKC I;  4Q1L A;  2N8R A;  4A7B A;  1KUI A;  1DMT A;  2WOA A;  4L63 A;  4L6T A;  3LUN A;  1RM8 A;  5D1T A;  4WKI A;  4CTH A;  3LE9 A;  1B3D A;  2W12 A;  3RTS A;  3AIG A;  4IN9 A;  3O2X A;  1UEA A;  3L0T A;  3DPE A;  5L7F A;  4PKW A;  3I7G A;  1ZXV A;  1SLN A;  4I03 A;  1Z3J A;  3UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...