4JP4A

Mmp13 in complex with a reverse hydroxamate zn-binder
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
165
Chain Sequence
b'YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYHFMLPDDDVQGIQSLYGPGDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Hydantoin based inhibitors of MMP13--discovery of AZD6605.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 165
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jp4A00
3KRYA 4R3VA 2W13A 2W14A 3E8RA 4EFSA 2OY2A 1SLMA 2K2GA 1OM6A 1C3IA 3ELMA 5D1SA 1HV5A 2AYKA 2OW9A 1ZTQA 3LJTA 2D1NA 3HBVP 4G0DA 1IACA 1HTDA 1R1HA 2USNA 4XM8A 456CA 3DPFA 3AYKA 2OXZA 4PKRA 4IUWA 1S4BP 3N2VA 3HBUP 1XURA 1JJ9A 3UVCA 4Q1LA 5I2ZA 3G5CA 1XFZA 1GE5A 4JIJA 4QKZA 2V4BA 3GBOA 1CGFA 3F15A 1QJIA 1MMRA 3LGPA 2RJPA 3VI1A 4H1QA 1D5JA 4AUOA 1YOUA 3K7LA 4AYKA 5BOTA 3HDBA 1KUGA 2MZIA 1BZSA 4H84A 3LUNA 1XFUA 1ZXVA 3NX7A 1IAAA 3KWVC 4GF1A 2JT5A 2E3XA 4XCTA 1B3DA 1YQYA 1Z3JA 3KEKA 1KAPP 1OM8A 3BA0A 3LIRA 1D8MA 2MZHA 5CXAA 2D1OA 4CTHA 1AF0A 1I1IP 1C7KA 3ZVSA 1BKCA 4DF9A 3P24A 1UMSA 1Q3AA 1HY7A 1K7IA 4GR0A 2XS3A 4WK7A 1CK7A 2OW2A 4H2EA 1AKLA 1BSWA 2JSDA 3DWBA 4H49A 1XFWA 1Y0VA 2PJTA 3DNGA 3EDGA 1MNCA 1H71P 5L7FA 1EAKA 1K7QA 1DMTA 1CIZA 1XFXA 1SU3A 3WV2A 2MLRA 3V96B 1BUVM 3LMCA 2YB9A 2J83A 1FBLA 1OO9A 1Y93A 3F17A 1SLNA 5CUHA 3EDIA 1QICA 1SATA 2W15A 3P1VA 3L0TA 3KHIA 1GKCA 4JPAA 2POJA 1CGLA 5I0LA 1EB6A 3EDZA 1IABA 4GR3A 1PWUA 2DDFA 3F16A 3RTSA 4HX3A 3TSKA 4FXQA 1CGEA 3Q2HA 1MMBA 1BUDA 1KUKA 4ZR5A 1G05A 2DDYA 1G9KA 1HFSA 2OY4A 5D1TA 2OXUA 2OXWA 2OW0A 1XFYA 1JK3A 1G4KA 1JAOA 2W0DA 1WNIA 3O2XA 2JNPA 3ZUKA 2EROA 3EHXA 1JAQA 2XS4A 1GE7A 1O0QA 1ZP5A 1XUCA 5I12A 2FV9A 5D2BA 830CA 1JIWP 3MA2A 2Y6DA 3TVCA 1CQRA 4I35A 4IJOA 3LJGA 2E2DA 2DW1A 5JMYA 1YP1A 4XM7A 3DSLA 1BQOA 1OM7A 1YCMA 3N2UA 2KRJA 4FXYP 4JQGA 3SHIA 2SRTA 4PKTA 2CKIA 1GE6A 1PWQA 1IAEA 4A7BA 3TT4A 1JAPA 3L0VA 4WKIA 2L0RA 2MLSA 4H76A 3AYUA 3Q2GA 3OHLA 4GWMA 966CA 1OS9A 5D7WA 1EUBA 1R54A 3RTTA 2CLTA 5I43A 1ZS0A 3KMCA 4PKQA 3KEJA 4ON1A 4PKWA 1JIZA 2X3BA 5LABA 4GWNA 2JT6A 4DD8A 1DTHA 1ROSA 1D7XA 1HOVA 2WO9A 1JKYA 1GO7P 3USNA 2W12A 3F18A 3EHYA 3AIGA 1FLSA 3O64A 1ZVXA 3HB2P 1GKDA 3LILA 1G49A 1KUFA 2JIHA 3VTGA 1A86A 1A85A 4JA1A 3B2ZA 1IAGA 5I4OA 1QIAA 2Z2DA 2OI0A 3HDAP 5BPAA 2J0TA 4IN9A 1BM6A 1ND1A 1B8YA 1XUDA 1GXDA 1ZXCA 4PKUA 4H3XA 4PKSA 1BKCI 1R55A 1UTZA 5D3CA 1OMJA 3OHOA 1L6JA 1Y8JA 4L63A 4FU4A 1KUIA 1K7GA 5B5OA 4HMAA 4WKEA 3EWJA 3LUMA 1I76A 3LJZA 3CKIA 2A8HA 5I3MA 3LK8A 3LE9A 1R1IA 1HFCA 2OVZA 1KBCA 2OZRA 1IADA 4GR8A 1UMTA 2ERPA 2X3CA 4DPEA 3LIKA 4XBHA 5L79A 4WF6A 4G9LA 3EDHA 4I03A 1KUHA 4XM6A 1PWPA 2AIGP 3B92A 3WV1A 3TS4A 4L19A 2ERQA 1G12A 2OVXA 2FV5A 4H82A 2WO8A 4DV8A 3B8ZA 4WZVA 3DPEA 4AIGA 1PWVA 4FVLA 2N8RA 4ILWD 2OW1A 2X7MA 2HU6A 2MZEA 1OS2A 1FM1A 1SMPA 1R1JA 3F1AA 1XFVA 3WV3A 4GUYA 1SRPA 1UTTA 1JH1A 2DW0A 4L6TA 1MMPA 2O3EA 3U1RA 2RJQA 2Y6CA 3LQBA 2DW2A 1CAQA 1RMZA 2WOAA 3F19A 3LEAA 1GO8P 1USNA 3I7IA 3KECA 4PKVA 1QJJA 1I73A 5CZMA 3KMEA 3K7NA 3LKAA 1J7NA 1BIWA 3HY7A 4JP4A 1BQQM 5H8XA 2K9CA 5B5PA 1O0TA 1ASTA 4J4MA 2YIGA 2QPJA 2X3AA 1D8FA 3ZXHA 3G42A 3HY9A 1ATLA 4AXQA 3I7GA 2O36A 1AYKA 1QUAA 5D1UA 3HYGA 1MMQA 1UEAA 4A3WA 1BKCE 4GQLA 1C8TA 1JANA 5BOYA 3DL1A 1PWWA 2I47A 1QIBA 2TCLA 3LQ0A 4H30A 1CXVA 1RM8A
chains in the Genus database with same CATH superfamily
3KRYA 4R3VA 2W13A 2W14A 3E8RA 4EFSA 2OY2A 1SLMA 2K2GA 1OM6A 1C3IA 3ELMA 5D1SA 1HV5A 2AYKA 2OW9A 1ZTQA 3LJTA 4L7AA 2D1NA 3HBVP 4G0DA 1IACA 1HTDA 1R1HA 2USNA 4XM8A 456CA 3DPFA 3AYKA 2OXZA 1TVIA 4PKRA 4IUWA 1S4BP 3N2VA 3HBUP 1XURA 1JJ9A 3UVCA 4Q1LA 5I2ZA 3G5CA 1XFZA 1GE5A 4JIJA 4QKZA 2V4BA 3GBOA 1CGFA 3F15A 1QJIA 1MMRA 3LGPA 2RJPA 3VI1A 4H1QA 1D5JA 4AUOA 1YOUA 3K7LA 4AYKA 5BOTA 3HDBA 1KUGA 2MZIA 1BZSA 4H84A 3LUNA 1XFUA 1ZXVA 3NX7A 1IAAA 3KWVC 4GF1A 2JT5A 2E3XA 4XCTA 1B3DA 1YQYA 1Z3JA 3KEKA 1KAPP 1OM8A 3BA0A 3LIRA 1D8MA 2MZHA 5CXAA 2D1OA 4CTHA 1AF0A 1I1IP 1C7KA 3ZVSA 1BKCA 4DF9A 3P24A 1UMSA 1Q3AA 1HY7A 1K7IA 4GR0A 2XS3A 4WK7A 1CK7A 2OW2A 4H2EA 1AKLA 1BSWA 2JSDA 3DWBA 4H49A 1XFWA 1Y0VA 2PJTA 3DNGA 3EDGA 1MNCA 1H71P 5L7FA 1EAKA 1K7QA 1DMTA 1CIZA 1XFXA 1SU3A 3WV2A 2MLRA 3V96B 1BUVM 3LMCA 2YUFA 2YB9A 2J83A 1FBLA 1OO9A 1Y93A 3F17A 1SLNA 5CUHA 3EDIA 1QICA 1SATA 2W15A 3P1VA 3L0TA 3KHIA 1GKCA 4JPAA 2POJA 1CGLA 5I0LA 1EB6A 3EDZA 1IABA 4GR3A 1PWUA 2DDFA 3F16A 3RTSA 4HX3A 3TSKA 4FXQA 1CGEA 3Q2HA 1MMBA 1BUDA 1KUKA 4ZR5A 1G05A 2DDYA 1G9KA 1HFSA 2OY4A 5D1TA 2OXUA 2OXWA 2OW0A 1XFYA 1JK3A 1G4KA 1JAOA 2W0DA 1WNIA 3O2XA 2JNPA 3ZUKA 2EROA 3EHXA 1JAQA 2XS4A 1GE7A 1O0QA 1ZP5A 1XUCA 5I12A 2FV9A 5D2BA 830CA 1JIWP 3MA2A 2Y6DA 3TVCA 1CQRA 4I35A 4IJOA 3LJGA 2E2DA 2DW1A 5JMYA 1YP1A 4XM7A 3DSLA 1BQOA 1OM7A 1YCMA 3N2UA 2KRJA 4FXYP 4JQGA 3SHIA 2SRTA 4PKTA 2CKIA 1GE6A 1PWQA 1IAEA 4A7BA 3TT4A 1JAPA 3L0VA 4WKIA 2L0RA 2MLSA 4H76A 3AYUA 3Q2GA 3OHLA 4GWMA 966CA 1OS9A 3DTKA 5D7WA 1EUBA 1R54A 3RTTA 2CLTA 5I43A 1ZS0A 3KMCA 4PKQA 3KEJA 4ON1A 4PKWA 1JIZA 2X3BA 5LABA 4GWNA 2JT6A 4DD8A 1DTHA 1ROSA 1D7XA 1HOVA 2WO9A 1JKYA 1GO7P 3USNA 2W12A 3F18A 3EHYA 3AIGA 1FLSA 3O64A 1ZVXA 3HB2P 1GKDA 3LILA 1G49A 1KUFA 2JIHA 3VTGA 1A86A 1A85A 4JA1A 3B2ZA 1IAGA 5I4OA 1QIAA 2Z2DA 2OI0A 3HDAP 5BPAA 2J0TA 4IN9A 1BM6A 1ND1A 1B8YA 1XUDA 1OZ9A 1GXDA 1ZXCA 4PKUA 4H3XA 4PKSA 1BKCI 1R55A 1UTZA 5D3CA 1OMJA 3OHOA 1L6JA 1Y8JA 4L63A 4FU4A 1KUIA 1K7GA 5B5OA 4HMAA 4WKEA 3EWJA 3LUMA 1I76A 3LJZA 3CKIA 2A8HA 5I3MA 3LK8A 3LE9A 1R1IA 1HFCA 2OVZA 1KBCA 2OZRA 1IADA 4GR8A 3DTEA 1UMTA 2ERPA 2X3CA 3DTIA 4DPEA 3LIKA 4XBHA 5L79A 4WF6A 4G9LA 3EDHA 4I03A 1KUHA 4XM6A 1PWPA 2AIGP 3B92A 3WV1A 3TS4A 1XM5A 4L19A 2ERQA 1G12A 2OVXA 2FV5A 4H82A 2WO8A 4DV8A 3B8ZA 4WZVA 3DPEA 4AIGA 1XAXA 1PWVA 4FVLA 2N8RA 4ILWD 2OW1A 2X7MA 2HU6A 2MZEA 1OS2A 1FM1A 1SMPA 1R1JA 3F1AA 1XFVA 3WV3A 4GUYA 1SRPA 1UTTA 1JH1A 2DW0A 4L6TA 1MMPA 2O3EA 3U1RA 2RJQA 2Y6CA 3LQBA 2DW2A 1CAQA 1RMZA 2WOAA 3F19A 3LEAA 1GO8P 1USNA 3I7IA 3KECA 4PKVA 1QJJA 1I73A 5CZMA 3KMEA 3K7NA 3LKAA 1J7NA 1BIWA 3HY7A 4JP4A 1BQQM 5H8XA 2K9CA 5B5PA 1O0TA 1ASTA 4J4MA 2YIGA 2QPJA 2X3AA 1D8FA 3ZXHA 3G42A 3HY9A 1ATLA 4AXQA 3I7GA 2O36A 1AYKA 1QUAA 5D1UA 3HYGA 1MMQA 1UEAA 4A3WA 1BKCE 4GQLA 1C8TA 1JANA 5BOYA 3DL1A 1PWWA 2I47A 1QIBA 2TCLA 3LQ0A 4H30A 1CXVA 1RM8A
chains in the Genus database with same CATH topology
3KRYA 4R3VA 2W13A 2W14A 3E8RA 4EFSA 2OY2A 1SLMA 2K2GA 1OM6A 1C3IA 3ELMA 5D1SA 1HV5A 2AYKA 2OW9A 1ZTQA 3LJTA 4L7AA 2D1NA 3HBVP 4G0DA 1IACA 1HTDA 1R1HA 2USNA 4XM8A 456CA 3DPFA 3AYKA 2OXZA 4PKRA 4IUWA 1S4BP 3N2VA 3HBUP 1XURA 1JJ9A 3UVCA 4Q1LA 5I2ZA 3G5CA 1XFZA 1GE5A 4JIJA 4QKZA 2V4BA 3GBOA 1CGFA 3F15A 1QJIA 1MMRA 3LGPA 2RJPA 3VI1A 4H1QA 1D5JA 4AUOA 1YOUA 3K7LA 4AYKA 5BOTA 3HDBA 1KUGA 2MZIA 1BZSA 4H84A 3LUNA 1XFUA 1ZXVA 3NX7A 1IAAA 3KWVC 4GF1A 2JT5A 2E3XA 4XCTA 1B3DA 1YQYA 1Z3JA 3KEKA 1KAPP 1OM8A 3BA0A 3LIRA 1D8MA 2MZHA 5CXAA 2D1OA 4CTHA 1AF0A 1I1IP 1C7KA 3ZVSA 1BKCA 4DF9A 3P24A 1UMSA 1Q3AA 1HY7A 1K7IA 4GR0A 2XS3A 4WK7A 1CK7A 2OW2A 4H2EA 1AKLA 1BSWA 2JSDA 3DWBA 4H49A 1XFWA 1Y0VA 2PJTA 3DNGA 3EDGA 1MNCA 1H71P 5L7FA 1EAKA 1K7QA 1DMTA 1CIZA 1XFXA 1SU3A 3WV2A 2MLRA 3V96B 1BUVM 3LMCA 2YUFA 2YB9A 2J83A 1FBLA 1OO9A 1Y93A 3F17A 1SLNA 5CUHA 3EDIA 1QICA 1SATA 2W15A 3P1VA 3L0TA 3KHIA 1GKCA 4JPAA 2POJA 1CGLA 5I0LA 1EB6A 3EDZA 1IABA 4GR3A 1PWUA 2DDFA 3F16A 3RTSA 4HX3A 3TSKA 4FXQA 1CGEA 3Q2HA 1MMBA 1BUDA 1KUKA 4ZR5A 1G05A 2DDYA 1G9KA 1HFSA 2OY4A 5D1TA 2OXUA 2OXWA 2OW0A 1XFYA 1JK3A 1G4KA 1JAOA 2W0DA 1WNIA 3O2XA 2JNPA 3ZUKA 2EROA 3EHXA 1JAQA 2XS4A 1GE7A 1O0QA 1ZP5A 1XUCA 5I12A 2FV9A 5D2BA 830CA 1JIWP 3MA2A 2Y6DA 3TVCA 1CQRA 4I35A 4IJOA 3LJGA 2E2DA 2DW1A 5JMYA 1YP1A 4XM7A 3DSLA 1BQOA 1OM7A 1YCMA 3N2UA 2KRJA 4FXYP 4JQGA 3SHIA 2SRTA 4PKTA 2CKIA 1GE6A 1PWQA 1IAEA 4A7BA 3TT4A 1JAPA 3L0VA 4WKIA 2L0RA 2MLSA 4H76A 3AYUA 3Q2GA 3OHLA 4GWMA 966CA 1OS9A 3DTKA 5D7WA 1EUBA 1R54A 3RTTA 2CLTA 5I43A 1ZS0A 3KMCA 4PKQA 3KEJA 4ON1A 4PKWA 1JIZA 2X3BA 5LABA 4GWNA 2JT6A 4DD8A 1DTHA 1ROSA 1D7XA 1HOVA 2WO9A 1JKYA 1GO7P 3USNA 2W12A 3F18A 3EHYA 3AIGA 1FLSA 3O64A 1ZVXA 3HB2P 1GKDA 3LILA 1G49A 1KUFA 2JIHA 3VTGA 1A86A 1A85A 4JA1A 3B2ZA 1IAGA 5I4OA 1QIAA 2Z2DA 2OI0A 3HDAP 5BPAA 2J0TA 4IN9A 1BM6A 1ND1A 1B8YA 1XUDA 1GXDA 1ZXCA 4PKUA 4H3XA 4PKSA 1BKCI 1R55A 1UTZA 5D3CA 1OMJA 3OHOA 1L6JA 1Y8JA 4L63A 4FU4A 1KUIA 1K7GA 5B5OA 4HMAA 4WKEA 3EWJA 3LUMA 1I76A 3LJZA 3CKIA 2A8HA 5I3MA 3LK8A 3LE9A 1R1IA 1HFCA 2OVZA 1KBCA 2OZRA 1IADA 4GR8A 3DTEA 1UMTA 2ERPA 2X3CA 3DTIA 4DPEA 3LIKA 4XBHA 5L79A 4WF6A 4G9LA 3EDHA 4I03A 1KUHA 4XM6A 1PWPA 2AIGP 3B92A 3WV1A 3TS4A 4L19A 2ERQA 1G12A 2OVXA 2FV5A 4H82A 2WO8A 4DV8A 3B8ZA 4WZVA 3DPEA 4AIGA 1PWVA 4FVLA 2N8RA 4ILWD 2OW1A 2X7MA 2HU6A 2MZEA 1OS2A 1FM1A 1SMPA 1R1JA 3F1AA 1XFVA 3WV3A 4GUYA 1SRPA 1UTTA 1JH1A 2DW0A 4L6TA 1MMPA 2O3EA 3U1RA 2RJQA 2Y6CA 3LQBA 2DW2A 1CAQA 1RMZA 2WOAA 3F19A 3LEAA 1GO8P 1USNA 3I7IA 3KECA 4PKVA 1QJJA 1I73A 5CZMA 3KMEA 3K7NA 3LKAA 1J7NA 1BIWA 3HY7A 4JP4A 1BQQM 5H8XA 2K9CA 5B5PA 1O0TA 1ASTA 4J4MA 2YIGA 2QPJA 2X3AA 1D8FA 3ZXHA 3G42A 3HY9A 1ATLA 4AXQA 3I7GA 2O36A 1AYKA 1QUAA 5D1UA 3HYGA 1MMQA 1UEAA 4A3WA 1BKCE 4GQLA 1C8TA 1JANA 5BOYA 3DL1A 1PWWA 2I47A 1QIBA 2TCLA 3LQ0A 4H30A 1CXVA 1RM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRY A;  4R3V A;  2W13 A;  2W14 A;  3E8R A;  4EFS A;  2OY2 A;  1SLM A;  2K2G A;  1OM6 A;  1C3I A;  3ELM A;  5D1S A;  1HV5 A;  2AYK A;  2OW9 A;  1ZTQ A;  3LJT A;  2D1N A;  3HBV P;  4G0D A;  1IAC A;  1HTD A;  1R1H A;  2USN A;  4XM8 A;  456C A;  3DPF A;  3AYK A;  2OXZ A;  4PKR A;  4IUW A;  1S4B P;  3N2V A;  3HBU P;  1XUR A;  1JJ9 A;  3UVC A;  4Q1L A;  5I2Z A;  3G5C A;  1XFZ A;  1GE5 A;  4JIJ A;  4QKZ A;  2V4B A;  3GBO A;  1CGF A;  3F15 A;  1QJI A;  1MMR A;  3LGP A;  2RJP A;  3VI1 A;  4H1Q A;  1D5J A;  4AUO A;  1YOU A;  3K7L A;  4AYK A;  5BOT A;  3HDB A;  1KUG A;  2MZI A;  1BZS A;  4H84 A;  3LUN A;  1XFU A;  1ZXV A;  3NX7 A;  1IAA A;  3KWV C;  4GF1 A;  2JT5 A;  2E3X A;  4XCT A;  1B3D A;  1YQY A;  1Z3J A;  3KEK A;  1KAP P;  1OM8 A;  3BA0 A;  3LIR A;  1D8M A;  2MZH A;  5CXA A;  2D1O A;  4CTH A;  1AF0 A;  1I1I P;  1C7K A;  3ZVS A;  1BKC A;  4DF9 A;  3P24 A;  1UMS A;  1Q3A A;  1HY7 A;  1K7I A;  4GR0 A;  2XS3 A;  4WK7 A;  1CK7 A;  2OW2 A;  4H2E A;  1AKL A;  1BSW A;  2JSD A;  3DWB A;  4H49 A;  1XFW A;  1Y0V A;  2PJT A;  3DNG A;  3EDG A;  1MNC A;  1H71 P;  5L7F A;  1EAK A;  1K7Q A;  1DMT A;  1CIZ A;  1XFX A;  1SU3 A;  3WV2 A;  2MLR A;  3V96 B;  1BUV M;  3LMC A;  2YB9 A;  2J83 A;  1FBL A;  1OO9 A;  1Y93 A;  3F17 A;  1SLN A;  5CUH A;  3EDI A;  1QIC A;  1SAT A;  2W15 A;  3P1V A;  3L0T A;  3KHI A;  1GKC A;  4JPA A;  2POJ A;  1CGL A;  5I0L A;  1EB6 A;  3EDZ A;  1IAB A;  4GR3 A;  1PWU A;  2DDF A;  3F16 A;  3RTS A;  4HX3 A;  3TSK A;  4FXQ A;  1CGE A;  3Q2H A;  1MMB A;  1BUD A;  1KUK A;  4ZR5 A;  1G05 A;  2DDY A;  1G9K A;  1HFS A;  2OY4 A;  5D1T A;  2OXU A;  2OXW A;  2OW0 A;  1XFY A;  1JK3 A;  1G4K A;  1JAO A;  2W0D A;  1WNI A;  3O2X A;  2JNP A;  3ZUK A;  2ERO A;  3EHX A;  1JAQ A;  2XS4 A;  1GE7 A;  1O0Q A;  1ZP5 A;  1XUC A;  5I12 A;  2FV9 A;  5D2B A;  830C A;  1JIW P;  3MA2 A;  2Y6D A;  3TVC A;  1CQR A;  4I35 A;  4IJO A;  3LJG A;  2E2D A;  2DW1 A;  5JMY A;  1YP1 A;  4XM7 A;  3DSL A;  1BQO A;  1OM7 A;  1YCM A;  3N2U A;  2KRJ A;  4FXY P;  4JQG A;  3SHI A;  2SRT A;  4PKT A;  2CKI A;  1GE6 A;  1PWQ A;  1IAE A;  4A7B A;  3TT4 A;  1JAP A;  3L0V A;  4WKI A;  2L0R A;  2MLS A;  4H76 A;  3AYU A;  3Q2G A;  3OHL A;  4GWM A;  966C A;  1OS9 A;  5D7W A;  1EUB A;  1R54 A;  3RTT A;  2CLT A;  5I43 A;  1ZS0 A;  3KMC A;  4PKQ A;  3KEJ A;  4ON1 A;  4PKW A;  1JIZ A;  2X3B A;  5LAB A;  4GWN A;  2JT6 A;  4DD8 A;  1DTH A;  1ROS A;  1D7X A;  1HOV A;  2WO9 A;  1JKY A;  1GO7 P;  3USN A;  2W12 A;  3F18 A;  3EHY A;  3AIG A;  1FLS A;  3O64 A;  1ZVX A;  3HB2 P;  1GKD A;  3LIL A;  1G49 A;  1KUF A;  2JIH A;  3VTG A;  1A86 A;  1A85 A;  4JA1 A;  3B2Z A;  1IAG A;  5I4O A;  1QIA A;  2Z2D A;  2OI0 A;  3HDA P;  5BPA A;  2J0T A;  4IN9 A;  1BM6 A;  1ND1 A;  1B8Y A;  1XUD A;  1GXD A;  1ZXC A;  4PKU A;  4H3X A;  4PKS A;  1BKC I;  1R55 A;  1UTZ A;  5D3C A;  1OMJ A;  3OHO A;  1L6J A;  1Y8J A;  4L63 A;  4FU4 A;  1KUI A;  1K7G A;  5B5O A;  4HMA A;  4WKE A;  3EWJ A;  3LUM A;  1I76 A;  3LJZ A;  3CKI A;  2A8H A;  5I3M A;  3LK8 A;  3LE9 A;  1R1I A;  1HFC A;  2OVZ A;  1KBC A;  2OZR A;  1IAD A;  4GR8 A;  1UMT A;  2ERP A;  2X3C A;  4DPE A;  3LIK A;  4XBH A;  5L79 A;  4WF6 A;  4G9L A;  3EDH A;  4I03 A;  1KUH A;  4XM6 A;  1PWP A;  2AIG P;  3B92 A;  3WV1 A;  3TS4 A;  4L19 A;  2ERQ A;  1G12 A;  2OVX A;  2FV5 A;  4H82 A;  2WO8 A;  4DV8 A;  3B8Z A;  4WZV A;  3DPE A;  4AIG A;  1PWV A;  4FVL A;  2N8R A;  4ILW D;  2OW1 A;  2X7M A;  2HU6 A;  2MZE A;  1OS2 A;  1FM1 A;  1SMP A;  1R1J A;  3F1A A;  1XFV A;  3WV3 A;  4GUY A;  1SRP A;  1UTT A;  1JH1 A;  2DW0 A;  4L6T A;  1MMP A;  2O3E A;  3U1R A;  2RJQ A;  2Y6C A;  3LQB A;  2DW2 A;  1CAQ A;  1RMZ A;  2WOA A;  3F19 A;  3LEA A;  1GO8 P;  1USN A;  3I7I A;  3KEC A;  4PKV A;  1QJJ A;  1I73 A;  5CZM A;  3KME A;  3K7N A;  3LKA A;  1J7N A;  1BIW A;  3HY7 A;  4JP4 A;  1BQQ M;  5H8X A;  2K9C A;  5B5P A;  1O0T A;  1AST A;  4J4M A;  2YIG A;  2QPJ A;  2X3A A;  1D8F A;  3ZXH A;  3G42 A;  3HY9 A;  1ATL A;  4AXQ A;  3I7G A;  2O36 A;  1AYK A;  1QUA A;  5D1U A;  3HYG A;  1MMQ A;  1UEA A;  4A3W A;  1BKC E;  4GQL A;  1C8T A;  1JAN A;  5BOY A;  3DL1 A;  1PWW A;  2I47 A;  1QIB A;  2TCL A;  3LQ0 A;  4H30 A;  1CXV A;  1RM8 A; 
#chains in the Genus database with same CATH topology
 3KRY A;  4R3V A;  2W13 A;  2W14 A;  3E8R A;  4EFS A;  2OY2 A;  1SLM A;  2K2G A;  1OM6 A;  1C3I A;  3ELM A;  5D1S A;  1HV5 A;  2AYK A;  2OW9 A;  1ZTQ A;  3LJT A;  4L7A A;  2D1N A;  3HBV P;  4G0D A;  1IAC A;  1HTD A;  1R1H A;  2USN A;  4XM8 A;  456C A;  3DPF A;  3AYK A;  2OXZ A;  1TVI A;  4PKR A;  4IUW A;  1S4B P;  3N2V A;  3HBU P;  1XUR A;  1JJ9 A;  3UVC A;  4Q1L A;  5I2Z A;  3G5C A;  1XFZ A;  1GE5 A;  4JIJ A;  4QKZ A;  2V4B A;  3GBO A;  1CGF A;  3F15 A;  1QJI A;  1MMR A;  3LGP A;  2RJP A;  3VI1 A;  4H1Q A;  1D5J A;  4AUO A;  1YOU A;  3K7L A;  4AYK A;  5BOT A;  3HDB A;  1KUG A;  2MZI A;  1BZS A;  4H84 A;  3LUN A;  1XFU A;  1ZXV A;  3NX7 A;  1IAA A;  3KWV C;  4GF1 A;  2JT5 A;  2E3X A;  4XCT A;  1B3D A;  1YQY A;  1Z3J A;  3KEK A;  1KAP P;  1OM8 A;  3BA0 A;  3LIR A;  1D8M A;  2MZH A;  5CXA A;  2D1O A;  4CTH A;  1AF0 A;  1I1I P;  1C7K A;  3ZVS A;  1BKC A;  4DF9 A;  3P24 A;  1UMS A;  1Q3A A;  1HY7 A;  1K7I A;  4GR0 A;  2XS3 A;  4WK7 A;  1CK7 A;  2OW2 A;  4H2E A;  1AKL A;  1BSW A;  2JSD A;  3DWB A;  4H49 A;  1XFW A;  1Y0V A;  2PJT A;  3DNG A;  3EDG A;  1MNC A;  1H71 P;  5L7F A;  1EAK A;  1K7Q A;  1DMT A;  1CIZ A;  1XFX A;  1SU3 A;  3WV2 A;  2MLR A;  3V96 B;  1BUV M;  3LMC A;  2YUF A;  2YB9 A;  2J83 A;  1FBL A;  1OO9 A;  1Y93 A;  3F17 A;  1SLN A;  5CUH A;  3EDI A;  1QIC A;  1SAT A;  2W15 A;  3P1V A;  3L0T A;  3KHI A;  1GKC A;  4JPA A;  2POJ A;  1CGL A;  5I0L A;  1EB6 A;  3EDZ A;  1IAB A;  4GR3 A;  1PWU A;  2DDF A;  3F16 A;  3RTS A;  4HX3 A;  3TSK A;  4FXQ A;  1CGE A;  3Q2H A;  1MMB A;  1BUD A;  1KUK A;  4ZR5 A;  1G05 A;  2DDY A;  1G9K A;  1HFS A;  2OY4 A;  5D1T A;  2OXU A;  2OXW A;  2OW0 A;  1XFY A;  1JK3 A;  1G4K A;  1JAO A;  2W0D A;  1WNI A;  3O2X A;  2JNP A;  3ZUK A;  2ERO A;  3EHX A;  1JAQ A;  2XS4 A;  1GE7 A;  1O0Q A;  1ZP5 A;  1XUC A;  5I12 A;  2FV9 A;  5D2B A;  830C A;  1JIW P;  3MA2 A;  2Y6D A;  3TVC A;  1CQR A;  4I35 A;  4IJO A;  3LJG A;  2E2D A;  2DW1 A;  5JMY A;  1YP1 A;  4XM7 A;  3DSL A;  1BQO A;  1OM7 A;  1YCM A;  3N2U A;  2KRJ A;  4FXY P;  4JQG A;  3SHI A;  2SRT A;  4PKT A;  2CKI A;  1GE6 A;  1PWQ A;  1IAE A;  4A7B A;  3TT4 A;  1JAP A;  3L0V A;  4WKI A;  2L0R A;  2MLS A;  4H76 A;  3AYU A;  3Q2G A;  3OHL A;  4GWM A;  966C A;  1OS9 A;  3DTK A;  5D7W A;  1EUB A;  1R54 A;  3RTT A;  2CLT A;  5I43 A;  1ZS0 A;  3KMC A;  4PKQ A;  3KEJ A;  4ON1 A;  4PKW A;  1JIZ A;  2X3B A;  5LAB A;  4GWN A;  2JT6 A;  4DD8 A;  1DTH A;  1ROS A;  1D7X A;  1HOV A;  2WO9 A;  1JKY A;  1GO7 P;  3USN A;  2W12 A;  3F18 A;  3EHY A;  3AIG A;  1FLS A;  3O64 A;  1ZVX A;  3HB2 P;  1GKD A;  3LIL A;  1G49 A;  1KUF A;  2JIH A;  3VTG A;  1A86 A;  1A85 A;  4JA1 A;  3B2Z A;  1IAG A;  5I4O A;  1QIA A;  2Z2D A;  2OI0 A;  3HDA P;  5BPA A;  2J0T A;  4IN9 A;  1BM6 A;  1ND1 A;  1B8Y A;  1XUD A;  1OZ9 A;  1GXD A;  1ZXC A;  4PKU A;  4H3X A;  4PKS A;  1BKC I;  1R55 A;  1UTZ A;  5D3C A;  1OMJ A;  3OHO A;  1L6J A;  1Y8J A;  4L63 A;  4FU4 A;  1KUI A;  1K7G A;  5B5O A;  4HMA A;  4WKE A;  3EWJ A;  3LUM A;  1I76 A;  3LJZ A;  3CKI A;  2A8H A;  5I3M A;  3LK8 A;  3LE9 A;  1R1I A;  1HFC A;  2OVZ A;  1KBC A;  2OZR A;  1IAD A;  4GR8 A;  3DTE A;  1UMT A;  2ERP A;  2X3C A;  3DTI A;  4DPE A;  3LIK A;  4XBH A;  5L79 A;  4WF6 A;  4G9L A;  3EDH A;  4I03 A;  1KUH A;  4XM6 A;  1PWP A;  2AIG P;  3B92 A;  3WV1 A;  3TS4 A;  1XM5 A;  4L19 A;  2ERQ A;  1G12 A;  2OVX A;  2FV5 A;  4H82 A;  2WO8 A;  4DV8 A;  3B8Z A;  4WZV A;  3DPE A;  4AIG A;  1XAX A;  1PWV A;  4FVL A;  2N8R A;  4ILW D;  2OW1 A;  2X7M A;  2HU6 A;  2MZE A;  1OS2 A;  1FM1 A;  1SMP A;  1R1J A;  3F1A A;  1XFV A;  3WV3 A;  4GUY A;  1SRP A;  1UTT A;  1JH1 A;  2DW0 A;  4L6T A;  1MMP A;  2O3E A;  3U1R A;  2RJQ A;  2Y6C A;  3LQB A;  2DW2 A;  1CAQ A;  1RMZ A;  2WOA A;  3F19 A;  3LEA A;  1GO8 P;  1USN A;  3I7I A;  3KEC A;  4PKV A;  1QJJ A;  1I73 A;  5CZM A;  3KME A;  3K7N A;  3LKA A;  1J7N A;  1BIW A;  3HY7 A;  4JP4 A;  1BQQ M;  5H8X A;  2K9C A;  5B5P A;  1O0T A;  1AST A;  4J4M A;  2YIG A;  2QPJ A;  2X3A A;  1D8F A;  3ZXH A;  3G42 A;  3HY9 A;  1ATL A;  4AXQ A;  3I7G A;  2O36 A;  1AYK A;  1QUA A;  5D1U A;  3HYG A;  1MMQ A;  1UEA A;  4A3W A;  1BKC E;  4GQL A;  1C8T A;  1JAN A;  5BOY A;  3DL1 A;  1PWW A;  2I47 A;  1QIB A;  2TCL A;  3LQ0 A;  4H30 A;  1CXV A;  1RM8 A; 
#chains in the Genus database with same CATH homology
 3KRY A;  4R3V A;  2W13 A;  2W14 A;  3E8R A;  4EFS A;  2OY2 A;  1SLM A;  2K2G A;  1OM6 A;  1C3I A;  3ELM A;  5D1S A;  1HV5 A;  2AYK A;  2OW9 A;  1ZTQ A;  3LJT A;  4L7A A;  2D1N A;  3HBV P;  4G0D A;  1IAC A;  1HTD A;  1R1H A;  2USN A;  4XM8 A;  456C A;  3DPF A;  3AYK A;  2OXZ A;  4PKR A;  4IUW A;  1S4B P;  3N2V A;  3HBU P;  1XUR A;  1JJ9 A;  3UVC A;  4Q1L A;  5I2Z A;  3G5C A;  1XFZ A;  1GE5 A;  4JIJ A;  4QKZ A;  2V4B A;  3GBO A;  1CGF A;  3F15 A;  1QJI A;  1MMR A;  3LGP A;  2RJP A;  3VI1 A;  4H1Q A;  1D5J A;  4AUO A;  1YOU A;  3K7L A;  4AYK A;  5BOT A;  3HDB A;  1KUG A;  2MZI A;  1BZS A;  4H84 A;  3LUN A;  1XFU A;  1ZXV A;  3NX7 A;  1IAA A;  3KWV C;  4GF1 A;  2JT5 A;  2E3X A;  4XCT A;  1B3D A;  1YQY A;  1Z3J A;  3KEK A;  1KAP P;  1OM8 A;  3BA0 A;  3LIR A;  1D8M A;  2MZH A;  5CXA A;  2D1O A;  4CTH A;  1AF0 A;  1I1I P;  1C7K A;  3ZVS A;  1BKC A;  4DF9 A;  3P24 A;  1UMS A;  1Q3A A;  1HY7 A;  1K7I A;  4GR0 A;  2XS3 A;  4WK7 A;  1CK7 A;  2OW2 A;  4H2E A;  1AKL A;  1BSW A;  2JSD A;  3DWB A;  4H49 A;  1XFW A;  1Y0V A;  2PJT A;  3DNG A;  3EDG A;  1MNC A;  1H71 P;  5L7F A;  1EAK A;  1K7Q A;  1DMT A;  1CIZ A;  1XFX A;  1SU3 A;  3WV2 A;  2MLR A;  3V96 B;  1BUV M;  3LMC A;  2YUF A;  2YB9 A;  2J83 A;  1FBL A;  1OO9 A;  1Y93 A;  3F17 A;  1SLN A;  5CUH A;  3EDI A;  1QIC A;  1SAT A;  2W15 A;  3P1V A;  3L0T A;  3KHI A;  1GKC A;  4JPA A;  2POJ A;  1CGL A;  5I0L A;  1EB6 A;  3EDZ A;  1IAB A;  4GR3 A;  1PWU A;  2DDF A;  3F16 A;  3RTS A;  4HX3 A;  3TSK A;  4FXQ A;  1CGE A;  3Q2H A;  1MMB A;  1BUD A;  1KUK A;  4ZR5 A;  1G05 A;  2DDY A;  1G9K A;  1HFS A;  2OY4 A;  5D1T A;  2OXU A;  2OXW A;  2OW0 A;  1XFY A;  1JK3 A;  1G4K A;  1JAO A;  2W0D A;  1WNI A;  3O2X A;  2JNP A;  3ZUK A;  2ERO A;  3EHX A;  1JAQ A;  2XS4 A;  1GE7 A;  1O0Q A;  1ZP5 A;  1XUC A;  5I12 A;  2FV9 A;  5D2B A;  830C A;  1JIW P;  3MA2 A;  2Y6D A;  3TVC A;  1CQR A;  4I35 A;  4IJO A;  3LJG A;  2E2D A;  2DW1 A;  5JMY A;  1YP1 A;  4XM7 A;  3DSL A;  1BQO A;  1OM7 A;  1YCM A;  3N2U A;  2KRJ A;  4FXY P;  4JQG A;  3SHI A;  2SRT A;  4PKT A;  2CKI A;  1GE6 A;  1PWQ A;  1IAE A;  4A7B A;  3TT4 A;  1JAP A;  3L0V A;  4WKI A;  2L0R A;  2MLS A;  4H76 A;  3AYU A;  3Q2G A;  3OHL A;  4GWM A;  966C A;  1OS9 A;  3DTK A;  5D7W A;  1EUB A;  1R54 A;  3RTT A;  2CLT A;  5I43 A;  1ZS0 A;  3KMC A;  4PKQ A;  3KEJ A;  4ON1 A;  4PKW A;  1JIZ A;  2X3B A;  5LAB A;  4GWN A;  2JT6 A;  4DD8 A;  1DTH A;  1ROS A;  1D7X A;  1HOV A;  2WO9 A;  1JKY A;  1GO7 P;  3USN A;  2W12 A;  3F18 A;  3EHY A;  3AIG A;  1FLS A;  3O64 A;  1ZVX A;  3HB2 P;  1GKD A;  3LIL A;  1G49 A;  1KUF A;  2JIH A;  3VTG A;  1A86 A;  1A85 A;  4JA1 A;  3B2Z A;  1IAG A;  5I4O A;  1QIA A;  2Z2D A;  2OI0 A;  3HDA P;  5BPA A;  2J0T A;  4IN9 A;  1BM6 A;  1ND1 A;  1B8Y A;  1XUD A;  1GXD A;  1ZXC A;  4PKU A;  4H3X A;  4PKS A;  1BKC I;  1R55 A;  1UTZ A;  5D3C A;  1OMJ A;  3OHO A;  1L6J A;  1Y8J A;  4L63 A;  4FU4 A;  1KUI A;  1K7G A;  5B5O A;  4HMA A;  4WKE A;  3EWJ A;  3LUM A;  1I76 A;  3LJZ A;  3CKI A;  2A8H A;  5I3M A;  3LK8 A;  3LE9 A;  1R1I A;  1HFC A;  2OVZ A;  1KBC A;  2OZR A;  1IAD A;  4GR8 A;  3DTE A;  1UMT A;  2ERP A;  2X3C A;  3DTI A;  4DPE A;  3LIK A;  4XBH A;  5L79 A;  4WF6 A;  4G9L A;  3EDH A;  4I03 A;  1KUH A;  4XM6 A;  1PWP A;  2AIG P;  3B92 A;  3WV1 A;  3TS4 A;  4L19 A;  2ERQ A;  1G12 A;  2OVX A;  2FV5 A;  4H82 A;  2WO8 A;  4DV8 A;  3B8Z A;  4WZV A;  3DPE A;  4AIG A;  1PWV A;  4FVL A;  2N8R A;  4ILW D;  2OW1 A;  2X7M A;  2HU6 A;  2MZE A;  1OS2 A;  1FM1 A;  1SMP A;  1R1J A;  3F1A A;  1XFV A;  3WV3 A;  4GUY A;  1SRP A;  1UTT A;  1JH1 A;  2DW0 A;  4L6T A;  1MMP A;  2O3E A;  3U1R A;  2RJQ A;  2Y6C A;  3LQB A;  2DW2 A;  1CAQ A;  1RMZ A;  2WOA A;  3F19 A;  3LEA A;  1GO8 P;  1USN A;  3I7I A;  3KEC A;  4PKV A;  1QJJ A;  1I73 A;  5CZM A;  3KME A;  3K7N A;  3LKA A;  1J7N A;  1BIW A;  3HY7 A;  4JP4 A;  1BQQ M;  5H8X A;  2K9C A;  5B5P A;  1O0T A;  1AST A;  4J4M A;  2YIG A;  2QPJ A;  2X3A A;  1D8F A;  3ZXH A;  3G42 A;  3HY9 A;  1ATL A;  4AXQ A;  3I7G A;  2O36 A;  1AYK A;  1QUA A;  5D1U A;  3HYG A;  1MMQ A;  1UEA A;  4A3W A;  1BKC E;  4GQL A;  1C8T A;  1JAN A;  5BOY A;  3DL1 A;  1PWW A;  2I47 A;  1QIB A;  2TCL A;  3LQ0 A;  4H30 A;  1CXV A;  1RM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...