4H82A

Crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
b'FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h82A00
1RMZA 1XFYA 1GE5A 1R1HA 3LMCA 5I12A 1Y93A 1CXVA 3Q2GA 3VI1A 2Y6DA 2DDYA 2YIGA 3HY9A 3RTSA 4PKSA 1HFSA 1MNCA 3BA0A 3KHIA 2DDFA 1GE7A 1OS9A 1CGLA 1D7XA 4XM8A 1D8MA 3B92A 1R1IA 4FVLA 3KMCA 1PWQA 3I7IA 1YOUA 4EFSA 2N8RA 3KEKA 1KUFA 3LEAA 1R54A 2J83A 1PWVA 1A86A 1JIWP 4ON1A 1KBCA 3EDGA 4GR0A 3DNGA 2X3BA 5BOYA 3ELMA 1SRPA 5D7WA 2W0DA 1XFUA 2FV5A 1DMTA 4HMAA 1BSWA 3OHLA 1YQYA 1XFZA 1GKDA 1QIBA 1DTHA 1I1IP 2FV9A 2TCLA 3F16A 2AIGP 1G05A 2POJA 1AF0A 1JAOA 3TT4A 3ZUKA 2PJTA 3LIKA 3F15A 3B8ZA 1K7QA 2OXZA 2JNPA 1BUVM 2JT6A 1MMPA 1UMSA 830CA 3EWJA 5D3CA 5I43A 2OI0A 1CIZA 3CKIA 1C3IA 3GBOA 4XM7A 1QICA 1BQOA 1FLSA 1YP1A 2SRTA 1MMBA 1WNIA 1D5JA 2ERQA 4H30A 1EAKA 4PKUA 4JQGA 4H3XA 3P24A 4DPEA 2OXUA 4GQLA 3DPEA 1JAQA 2OW2A 3DWBA 3L0TA 4H76A 3O2XA 5CUHA 5LABA 3KWVC 1IAGA 2OVXA 2K2GA 4ILWD 2OZRA 1L6JA 4G9LA 4IJOA 2CLTA 1KUGA 2Z2DA 2AYKA 3LJGA 3ZXHA 1HFCA 1Q3AA 1SATA 1SLMA 5I4OA 1GKCA 5H8XA 4J4MA 1OM7A 3AYKA 3OHOA 4JIJA 2O3EA 4IUWA 1ROSA 1JK3A 4PKVA 3DPFA 3HDBA 1K7IA 1GE6A 1ASTA 1PWWA 3G42A 3LQBA 4WKEA 3Q2HA 4L63A 3U1RA 2XS3A 3L0VA 2MLRA 2QPJA 3LJTA 2X3CA 1PWPA 3K7NA 1KAPP 3EDHA 1BM6A 4PKQA 1QJIA 4R3VA 4PKRA 1G12A 4WKIA 4AXQA 1IAEA 1ZVXA 2E2DA 2MZEA 2OW1A 1CGEA 5L7FA 1UMTA 4Q1LA 4XM6A 3ZVSA 4DD8A 5D1UA 5D2BA 4DF9A 2RJQA 1CQRA 4JA1A 3SHIA 3AIGA 1G49A 1HY7A 1KUKA 3HB2P 4XCTA 4QKZA 4H84A 4H82A 2DW1A 2JSDA 1USNA 1CK7A 4FXYP 4PKTA 1QIAA 1JANA 2W13A 3I7GA 1IABA 1BIWA 3LUMA 1B3DA 1GO8P 1ZXVA 4A7BA 5CZMA 1GXDA 5I3MA 1ZP5A 1HOVA 5I0LA 1JH1A 5I2ZA 4WZVA 3EHYA 3LILA 1QUAA 1Z3JA 1SU3A 5CXAA 3HDAP 3KEJA 4AYKA 3VTGA 4GR3A 3WV3A 5D1SA 1QJJA 5BOTA 2MZIA 3KECA 4FU4A 5JMYA 1JAPA 1ATLA 3F1AA 1ND1A 3NX7A 4FXQA 4L19A 3P1VA 3HY7A 2RJPA 1MMQA 3HYGA 4GR8A 1B8YA 2K9CA 1K7GA 1OMJA 2EROA 3F18A 3WV1A 2OVZA 2E3XA 4H1QA 1FM1A 3DSLA 1XUDA 3N2VA 4JPAA 1IADA 2D1OA 2J0TA 4IN9A 1XFWA 1BKCE 2DW0A 4A3WA 1C8TA 1A85A 3HBVP 4DV8A 5BPAA 3USNA 2ERPA 2I47A 4PKWA 1HTDA 1IACA 1O0TA 1FBLA 1O0QA 1JJ9A 2MZHA 2OY2A 1SLNA 3G5CA 1PWUA 4WF6A 1R55A 1BZSA 2X3AA 2OW0A 3E8RA 3KRYA 1BKCA 4CTHA 1OM8A 1RM8A 1J7NA 1XUCA 3N2UA 5L79A 2HU6A 3EDIA 2OY4A 1SMPA 1ZTQA 3F17A 4H49A 1BQQM 1ZS0A 1IAAA 1G9KA 1R1JA 2W15A 4JP4A 3K7LA 4XBHA 2YB9A 1OM6A 4L6TA 2L0RA 2WO8A 2A8HA 1EUBA 1UTTA 1GO7P 4GF1A 4HX3A 1MMRA 1CAQA 3HBUP 2W14A 3WV2A 4GWNA 2V4BA 3TS4A 1Y0VA 2KRJA 1H71P 1UEAA 3EDZA 2WO9A 3AYUA 3RTTA 3LK8A 1EB6A 4AUOA 4GUYA 4I35A 1ZXCA 1KUIA 3B2ZA 4G0DA 3TSKA 3LGPA 3MA2A 2JT5A 1JKYA 4ZR5A 1AYKA 4AIGA 2JIHA 3LJZA 3LKAA 1S4BP 1JIZA 2OXWA 1CGFA 3DL1A 5D1TA 2MLSA 1BKCI 3EHXA 5B5PA 1AKLA 2W12A 3LQ0A 1OS2A 1YCMA 2XS4A 1UTZA 966CA 3LE9A 4WK7A 456CA 1XFXA 2DW2A 2O36A 1G4KA 1D8FA 3UVCA 1C7KA 1HV5A 2Y6CA 1BUDA 1XURA 4I03A 2X7MA 3F19A 1I73A 2USNA 1OO9A 3O64A 3TVCA 2D1NA 3KMEA 3LUNA 1KUHA 1Y8JA 1I76A 4GWMA 3LIRA 5B5OA 2OW9A 4H2EA 1XFVA 3V96B 2CKIA 2WOAA
chains in the Genus database with same CATH superfamily
1RMZA 1XFYA 1GE5A 1R1HA 3LMCA 5I12A 1Y93A 1CXVA 3Q2GA 3VI1A 2Y6DA 3DTEA 2DDYA 2YIGA 3HY9A 3RTSA 4PKSA 1HFSA 1MNCA 3BA0A 3KHIA 2DDFA 1GE7A 1OS9A 1CGLA 1D7XA 4XM8A 1D8MA 3B92A 3DTIA 1R1IA 4FVLA 3KMCA 1PWQA 3I7IA 1YOUA 4EFSA 2N8RA 3KEKA 1KUFA 3LEAA 1R54A 2J83A 1PWVA 1A86A 1JIWP 4ON1A 3DTKA 1KBCA 3EDGA 4GR0A 3DNGA 2X3BA 5BOYA 3ELMA 1SRPA 5D7WA 2W0DA 1XFUA 2FV5A 1DMTA 4HMAA 1BSWA 3OHLA 1YQYA 1XFZA 1GKDA 1QIBA 1DTHA 1I1IP 2FV9A 2TCLA 3F16A 2AIGP 1G05A 2POJA 1AF0A 1JAOA 3TT4A 3ZUKA 2PJTA 3LIKA 3F15A 3B8ZA 1K7QA 2OXZA 2JNPA 1BUVM 2JT6A 1MMPA 1UMSA 830CA 3EWJA 5D3CA 5I43A 2OI0A 1CIZA 3CKIA 1C3IA 3GBOA 4XM7A 1QICA 1BQOA 1FLSA 1YP1A 2SRTA 1MMBA 1WNIA 1D5JA 2ERQA 4H30A 1EAKA 4PKUA 4JQGA 4H3XA 3P24A 4DPEA 2OXUA 4GQLA 3DPEA 1JAQA 2OW2A 3DWBA 3L0TA 4H76A 3O2XA 5CUHA 5LABA 3KWVC 1IAGA 2OVXA 2K2GA 4ILWD 2OZRA 1XM5A 1L6JA 4G9LA 4IJOA 2CLTA 1KUGA 2Z2DA 2AYKA 3LJGA 3ZXHA 1HFCA 1Q3AA 1SATA 1SLMA 5I4OA 1GKCA 5H8XA 4J4MA 1OM7A 3AYKA 3OHOA 4JIJA 2O3EA 4IUWA 1ROSA 1JK3A 4PKVA 3DPFA 3HDBA 1K7IA 1GE6A 1ASTA 1PWWA 3G42A 3LQBA 4WKEA 3Q2HA 4L63A 3U1RA 2XS3A 3L0VA 2MLRA 2QPJA 3LJTA 2X3CA 1PWPA 3K7NA 1KAPP 3EDHA 1BM6A 4PKQA 1QJIA 4R3VA 4PKRA 1G12A 4WKIA 4AXQA 1IAEA 1ZVXA 2E2DA 2MZEA 2OW1A 1CGEA 5L7FA 1UMTA 4Q1LA 4XM6A 3ZVSA 4DD8A 5D1UA 5D2BA 4DF9A 2RJQA 1CQRA 4JA1A 3SHIA 3AIGA 1G49A 1HY7A 1KUKA 1XAXA 3HB2P 4XCTA 4QKZA 4H84A 4H82A 2DW1A 2JSDA 1USNA 1CK7A 4FXYP 4PKTA 1QIAA 1JANA 2W13A 3I7GA 1IABA 1BIWA 3LUMA 1B3DA 1GO8P 1ZXVA 4A7BA 5CZMA 1GXDA 5I3MA 1ZP5A 1HOVA 5I0LA 1JH1A 5I2ZA 4WZVA 3EHYA 3LILA 1QUAA 1Z3JA 1SU3A 5CXAA 3HDAP 3KEJA 4AYKA 3VTGA 4GR3A 3WV3A 5D1SA 1QJJA 5BOTA 2MZIA 3KECA 4FU4A 5JMYA 1JAPA 1ATLA 3F1AA 1ND1A 3NX7A 4FXQA 4L19A 3P1VA 3HY7A 2RJPA 1MMQA 3HYGA 4GR8A 1B8YA 2K9CA 1K7GA 1OMJA 2EROA 3F18A 3WV1A 2OVZA 2E3XA 4H1QA 1FM1A 3DSLA 1XUDA 3N2VA 4JPAA 1IADA 2D1OA 2J0TA 4IN9A 1XFWA 1BKCE 2DW0A 4A3WA 1C8TA 1A85A 3HBVP 4DV8A 5BPAA 3USNA 2ERPA 2I47A 4PKWA 1HTDA 1IACA 1O0TA 1FBLA 1O0QA 1JJ9A 2MZHA 2OY2A 1SLNA 3G5CA 1PWUA 4WF6A 1R55A 1BZSA 2X3AA 2OW0A 2YUFA 3E8RA 3KRYA 1BKCA 4CTHA 1OM8A 1RM8A 1J7NA 1XUCA 3N2UA 5L79A 2HU6A 3EDIA 2OY4A 1SMPA 1ZTQA 3F17A 4H49A 1BQQM 1ZS0A 1IAAA 1G9KA 1R1JA 2W15A 4JP4A 3K7LA 4XBHA 2YB9A 1OM6A 4L6TA 2L0RA 2WO8A 2A8HA 1EUBA 1UTTA 1GO7P 4GF1A 4HX3A 1MMRA 1CAQA 3HBUP 4L7AA 2W14A 3WV2A 4GWNA 2V4BA 3TS4A 1Y0VA 2KRJA 1H71P 1UEAA 3EDZA 2WO9A 3AYUA 3RTTA 3LK8A 1EB6A 4AUOA 4GUYA 4I35A 1ZXCA 1KUIA 3B2ZA 4G0DA 3TSKA 3LGPA 3MA2A 2JT5A 1JKYA 4ZR5A 1AYKA 4AIGA 2JIHA 3LJZA 3LKAA 1S4BP 1JIZA 2OXWA 1CGFA 3DL1A 5D1TA 2MLSA 1BKCI 3EHXA 5B5PA 1OZ9A 1AKLA 2W12A 3LQ0A 1OS2A 1YCMA 2XS4A 1UTZA 966CA 3LE9A 4WK7A 456CA 1XFXA 2DW2A 2O36A 1G4KA 1D8FA 3UVCA 1C7KA 1HV5A 2Y6CA 1TVIA 1BUDA 1XURA 4I03A 2X7MA 3F19A 1I73A 2USNA 1OO9A 3O64A 3TVCA 2D1NA 3KMEA 3LUNA 1KUHA 1Y8JA 1I76A 4GWMA 3LIRA 5B5OA 2OW9A 4H2EA 1XFVA 3V96B 2CKIA 2WOAA
chains in the Genus database with same CATH topology
1RMZA 1XFYA 1GE5A 1R1HA 3LMCA 5I12A 1Y93A 1CXVA 3Q2GA 3VI1A 2Y6DA 3DTEA 2DDYA 2YIGA 3HY9A 3RTSA 4PKSA 1HFSA 1MNCA 3BA0A 3KHIA 2DDFA 1GE7A 1OS9A 1CGLA 1D7XA 4XM8A 1D8MA 3B92A 3DTIA 1R1IA 4FVLA 3KMCA 1PWQA 3I7IA 1YOUA 4EFSA 2N8RA 3KEKA 1KUFA 3LEAA 1R54A 2J83A 1PWVA 1A86A 1JIWP 4ON1A 3DTKA 1KBCA 3EDGA 4GR0A 3DNGA 2X3BA 5BOYA 3ELMA 1SRPA 5D7WA 2W0DA 1XFUA 2FV5A 1DMTA 4HMAA 1BSWA 3OHLA 1YQYA 1XFZA 1GKDA 1QIBA 1DTHA 1I1IP 2FV9A 2TCLA 3F16A 2AIGP 1G05A 2POJA 1AF0A 1JAOA 3TT4A 3ZUKA 2PJTA 3LIKA 3F15A 3B8ZA 1K7QA 2OXZA 2JNPA 1BUVM 2JT6A 1MMPA 1UMSA 830CA 3EWJA 5D3CA 5I43A 2OI0A 1CIZA 3CKIA 1C3IA 3GBOA 4XM7A 1QICA 1BQOA 1FLSA 1YP1A 2SRTA 1MMBA 1WNIA 1D5JA 2ERQA 4H30A 1EAKA 4PKUA 4JQGA 4H3XA 3P24A 4DPEA 2OXUA 4GQLA 3DPEA 1JAQA 2OW2A 3DWBA 3L0TA 4H76A 3O2XA 5CUHA 5LABA 3KWVC 1IAGA 2OVXA 2K2GA 4ILWD 2OZRA 1L6JA 4G9LA 4IJOA 2CLTA 1KUGA 2Z2DA 2AYKA 3LJGA 3ZXHA 1HFCA 1Q3AA 1SATA 1SLMA 5I4OA 1GKCA 5H8XA 4J4MA 1OM7A 3AYKA 3OHOA 4JIJA 2O3EA 4IUWA 1ROSA 1JK3A 4PKVA 3DPFA 3HDBA 1K7IA 1GE6A 1ASTA 1PWWA 3G42A 3LQBA 4WKEA 3Q2HA 4L63A 3U1RA 2XS3A 3L0VA 2MLRA 2QPJA 3LJTA 2X3CA 1PWPA 3K7NA 1KAPP 3EDHA 1BM6A 4PKQA 1QJIA 4R3VA 4PKRA 1G12A 4WKIA 4AXQA 1IAEA 1ZVXA 2E2DA 2MZEA 2OW1A 1CGEA 5L7FA 1UMTA 4Q1LA 4XM6A 3ZVSA 4DD8A 5D1UA 5D2BA 4DF9A 2RJQA 1CQRA 4JA1A 3SHIA 3AIGA 1G49A 1HY7A 1KUKA 3HB2P 4XCTA 4QKZA 4H84A 4H82A 2DW1A 2JSDA 1USNA 1CK7A 4FXYP 4PKTA 1QIAA 1JANA 2W13A 3I7GA 1IABA 1BIWA 3LUMA 1B3DA 1GO8P 1ZXVA 4A7BA 5CZMA 1GXDA 5I3MA 1ZP5A 1HOVA 5I0LA 1JH1A 5I2ZA 4WZVA 3EHYA 3LILA 1QUAA 1Z3JA 1SU3A 5CXAA 3HDAP 3KEJA 4AYKA 3VTGA 4GR3A 3WV3A 5D1SA 1QJJA 5BOTA 2MZIA 3KECA 4FU4A 5JMYA 1JAPA 1ATLA 3F1AA 1ND1A 3NX7A 4FXQA 4L19A 3P1VA 3HY7A 2RJPA 1MMQA 3HYGA 4GR8A 1B8YA 2K9CA 1K7GA 1OMJA 2EROA 3F18A 3WV1A 2OVZA 2E3XA 4H1QA 1FM1A 3DSLA 1XUDA 3N2VA 4JPAA 1IADA 2D1OA 2J0TA 4IN9A 1XFWA 1BKCE 2DW0A 4A3WA 1C8TA 1A85A 3HBVP 4DV8A 5BPAA 3USNA 2ERPA 2I47A 4PKWA 1HTDA 1IACA 1O0TA 1FBLA 1O0QA 1JJ9A 2MZHA 2OY2A 1SLNA 3G5CA 1PWUA 4WF6A 1R55A 1BZSA 2X3AA 2OW0A 2YUFA 3E8RA 3KRYA 1BKCA 4CTHA 1OM8A 1RM8A 1J7NA 1XUCA 3N2UA 5L79A 2HU6A 3EDIA 2OY4A 1SMPA 1ZTQA 3F17A 4H49A 1BQQM 1ZS0A 1IAAA 1G9KA 1R1JA 2W15A 4JP4A 3K7LA 4XBHA 2YB9A 1OM6A 4L6TA 2L0RA 2WO8A 2A8HA 1EUBA 1UTTA 1GO7P 4GF1A 4HX3A 1MMRA 1CAQA 3HBUP 4L7AA 2W14A 3WV2A 4GWNA 2V4BA 3TS4A 1Y0VA 2KRJA 1H71P 1UEAA 3EDZA 2WO9A 3AYUA 3RTTA 3LK8A 1EB6A 4AUOA 4GUYA 4I35A 1ZXCA 1KUIA 3B2ZA 4G0DA 3TSKA 3LGPA 3MA2A 2JT5A 1JKYA 4ZR5A 1AYKA 4AIGA 2JIHA 3LJZA 3LKAA 1S4BP 1JIZA 2OXWA 1CGFA 3DL1A 5D1TA 2MLSA 1BKCI 3EHXA 5B5PA 1AKLA 2W12A 3LQ0A 1OS2A 1YCMA 2XS4A 1UTZA 966CA 3LE9A 4WK7A 456CA 1XFXA 2DW2A 2O36A 1G4KA 1D8FA 3UVCA 1C7KA 1HV5A 2Y6CA 1BUDA 1XURA 4I03A 2X7MA 3F19A 1I73A 2USNA 1OO9A 3O64A 3TVCA 2D1NA 3KMEA 3LUNA 1KUHA 1Y8JA 1I76A 4GWMA 3LIRA 5B5OA 2OW9A 4H2EA 1XFVA 3V96B 2CKIA 2WOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMZ A;  1XFY A;  1GE5 A;  1R1H A;  3LMC A;  5I12 A;  1Y93 A;  1CXV A;  3Q2G A;  3VI1 A;  2Y6D A;  2DDY A;  2YIG A;  3HY9 A;  3RTS A;  4PKS A;  1HFS A;  1MNC A;  3BA0 A;  3KHI A;  2DDF A;  1GE7 A;  1OS9 A;  1CGL A;  1D7X A;  4XM8 A;  1D8M A;  3B92 A;  1R1I A;  4FVL A;  3KMC A;  1PWQ A;  3I7I A;  1YOU A;  4EFS A;  2N8R A;  3KEK A;  1KUF A;  3LEA A;  1R54 A;  2J83 A;  1PWV A;  1A86 A;  1JIW P;  4ON1 A;  1KBC A;  3EDG A;  4GR0 A;  3DNG A;  2X3B A;  5BOY A;  3ELM A;  1SRP A;  5D7W A;  2W0D A;  1XFU A;  2FV5 A;  1DMT A;  4HMA A;  1BSW A;  3OHL A;  1YQY A;  1XFZ A;  1GKD A;  1QIB A;  1DTH A;  1I1I P;  2FV9 A;  2TCL A;  3F16 A;  2AIG P;  1G05 A;  2POJ A;  1AF0 A;  1JAO A;  3TT4 A;  3ZUK A;  2PJT A;  3LIK A;  3F15 A;  3B8Z A;  1K7Q A;  2OXZ A;  2JNP A;  1BUV M;  2JT6 A;  1MMP A;  1UMS A;  830C A;  3EWJ A;  5D3C A;  5I43 A;  2OI0 A;  1CIZ A;  3CKI A;  1C3I A;  3GBO A;  4XM7 A;  1QIC A;  1BQO A;  1FLS A;  1YP1 A;  2SRT A;  1MMB A;  1WNI A;  1D5J A;  2ERQ A;  4H30 A;  1EAK A;  4PKU A;  4JQG A;  4H3X A;  3P24 A;  4DPE A;  2OXU A;  4GQL A;  3DPE A;  1JAQ A;  2OW2 A;  3DWB A;  3L0T A;  4H76 A;  3O2X A;  5CUH A;  5LAB A;  3KWV C;  1IAG A;  2OVX A;  2K2G A;  4ILW D;  2OZR A;  1L6J A;  4G9L A;  4IJO A;  2CLT A;  1KUG A;  2Z2D A;  2AYK A;  3LJG A;  3ZXH A;  1HFC A;  1Q3A A;  1SAT A;  1SLM A;  5I4O A;  1GKC A;  5H8X A;  4J4M A;  1OM7 A;  3AYK A;  3OHO A;  4JIJ A;  2O3E A;  4IUW A;  1ROS A;  1JK3 A;  4PKV A;  3DPF A;  3HDB A;  1K7I A;  1GE6 A;  1AST A;  1PWW A;  3G42 A;  3LQB A;  4WKE A;  3Q2H A;  4L63 A;  3U1R A;  2XS3 A;  3L0V A;  2MLR A;  2QPJ A;  3LJT A;  2X3C A;  1PWP A;  3K7N A;  1KAP P;  3EDH A;  1BM6 A;  4PKQ A;  1QJI A;  4R3V A;  4PKR A;  1G12 A;  4WKI A;  4AXQ A;  1IAE A;  1ZVX A;  2E2D A;  2MZE A;  2OW1 A;  1CGE A;  5L7F A;  1UMT A;  4Q1L A;  4XM6 A;  3ZVS A;  4DD8 A;  5D1U A;  5D2B A;  4DF9 A;  2RJQ A;  1CQR A;  4JA1 A;  3SHI A;  3AIG A;  1G49 A;  1HY7 A;  1KUK A;  3HB2 P;  4XCT A;  4QKZ A;  4H84 A;  4H82 A;  2DW1 A;  2JSD A;  1USN A;  1CK7 A;  4FXY P;  4PKT A;  1QIA A;  1JAN A;  2W13 A;  3I7G A;  1IAB A;  1BIW A;  3LUM A;  1B3D A;  1GO8 P;  1ZXV A;  4A7B A;  5CZM A;  1GXD A;  5I3M A;  1ZP5 A;  1HOV A;  5I0L A;  1JH1 A;  5I2Z A;  4WZV A;  3EHY A;  3LIL A;  1QUA A;  1Z3J A;  1SU3 A;  5CXA A;  3HDA P;  3KEJ A;  4AYK A;  3VTG A;  4GR3 A;  3WV3 A;  5D1S A;  1QJJ A;  5BOT A;  2MZI A;  3KEC A;  4FU4 A;  5JMY A;  1JAP A;  1ATL A;  3F1A A;  1ND1 A;  3NX7 A;  4FXQ A;  4L19 A;  3P1V A;  3HY7 A;  2RJP A;  1MMQ A;  3HYG A;  4GR8 A;  1B8Y A;  2K9C A;  1K7G A;  1OMJ A;  2ERO A;  3F18 A;  3WV1 A;  2OVZ A;  2E3X A;  4H1Q A;  1FM1 A;  3DSL A;  1XUD A;  3N2V A;  4JPA A;  1IAD A;  2D1O A;  2J0T A;  4IN9 A;  1XFW A;  1BKC E;  2DW0 A;  4A3W A;  1C8T A;  1A85 A;  3HBV P;  4DV8 A;  5BPA A;  3USN A;  2ERP A;  2I47 A;  4PKW A;  1HTD A;  1IAC A;  1O0T A;  1FBL A;  1O0Q A;  1JJ9 A;  2MZH A;  2OY2 A;  1SLN A;  3G5C A;  1PWU A;  4WF6 A;  1R55 A;  1BZS A;  2X3A A;  2OW0 A;  3E8R A;  3KRY A;  1BKC A;  4CTH A;  1OM8 A;  1RM8 A;  1J7N A;  1XUC A;  3N2U A;  5L79 A;  2HU6 A;  3EDI A;  2OY4 A;  1SMP A;  1ZTQ A;  3F17 A;  4H49 A;  1BQQ M;  1ZS0 A;  1IAA A;  1G9K A;  1R1J A;  2W15 A;  4JP4 A;  3K7L A;  4XBH A;  2YB9 A;  1OM6 A;  4L6T A;  2L0R A;  2WO8 A;  2A8H A;  1EUB A;  1UTT A;  1GO7 P;  4GF1 A;  4HX3 A;  1MMR A;  1CAQ A;  3HBU P;  2W14 A;  3WV2 A;  4GWN A;  2V4B A;  3TS4 A;  1Y0V A;  2KRJ A;  1H71 P;  1UEA A;  3EDZ A;  2WO9 A;  3AYU A;  3RTT A;  3LK8 A;  1EB6 A;  4AUO A;  4GUY A;  4I35 A;  1ZXC A;  1KUI A;  3B2Z A;  4G0D A;  3TSK A;  3LGP A;  3MA2 A;  2JT5 A;  1JKY A;  4ZR5 A;  1AYK A;  4AIG A;  2JIH A;  3LJZ A;  3LKA A;  1S4B P;  1JIZ A;  2OXW A;  1CGF A;  3DL1 A;  5D1T A;  2MLS A;  1BKC I;  3EHX A;  5B5P A;  1AKL A;  2W12 A;  3LQ0 A;  1OS2 A;  1YCM A;  2XS4 A;  1UTZ A;  966C A;  3LE9 A;  4WK7 A;  456C A;  1XFX A;  2DW2 A;  2O36 A;  1G4K A;  1D8F A;  3UVC A;  1C7K A;  1HV5 A;  2Y6C A;  1BUD A;  1XUR A;  4I03 A;  2X7M A;  3F19 A;  1I73 A;  2USN A;  1OO9 A;  3O64 A;  3TVC A;  2D1N A;  3KME A;  3LUN A;  1KUH A;  1Y8J A;  1I76 A;  4GWM A;  3LIR A;  5B5O A;  2OW9 A;  4H2E A;  1XFV A;  3V96 B;  2CKI A;  2WOA A; 
#chains in the Genus database with same CATH topology
 1RMZ A;  1XFY A;  1GE5 A;  1R1H A;  3LMC A;  5I12 A;  1Y93 A;  1CXV A;  3Q2G A;  3VI1 A;  2Y6D A;  3DTE A;  2DDY A;  2YIG A;  3HY9 A;  3RTS A;  4PKS A;  1HFS A;  1MNC A;  3BA0 A;  3KHI A;  2DDF A;  1GE7 A;  1OS9 A;  1CGL A;  1D7X A;  4XM8 A;  1D8M A;  3B92 A;  3DTI A;  1R1I A;  4FVL A;  3KMC A;  1PWQ A;  3I7I A;  1YOU A;  4EFS A;  2N8R A;  3KEK A;  1KUF A;  3LEA A;  1R54 A;  2J83 A;  1PWV A;  1A86 A;  1JIW P;  4ON1 A;  3DTK A;  1KBC A;  3EDG A;  4GR0 A;  3DNG A;  2X3B A;  5BOY A;  3ELM A;  1SRP A;  5D7W A;  2W0D A;  1XFU A;  2FV5 A;  1DMT A;  4HMA A;  1BSW A;  3OHL A;  1YQY A;  1XFZ A;  1GKD A;  1QIB A;  1DTH A;  1I1I P;  2FV9 A;  2TCL A;  3F16 A;  2AIG P;  1G05 A;  2POJ A;  1AF0 A;  1JAO A;  3TT4 A;  3ZUK A;  2PJT A;  3LIK A;  3F15 A;  3B8Z A;  1K7Q A;  2OXZ A;  2JNP A;  1BUV M;  2JT6 A;  1MMP A;  1UMS A;  830C A;  3EWJ A;  5D3C A;  5I43 A;  2OI0 A;  1CIZ A;  3CKI A;  1C3I A;  3GBO A;  4XM7 A;  1QIC A;  1BQO A;  1FLS A;  1YP1 A;  2SRT A;  1MMB A;  1WNI A;  1D5J A;  2ERQ A;  4H30 A;  1EAK A;  4PKU A;  4JQG A;  4H3X A;  3P24 A;  4DPE A;  2OXU A;  4GQL A;  3DPE A;  1JAQ A;  2OW2 A;  3DWB A;  3L0T A;  4H76 A;  3O2X A;  5CUH A;  5LAB A;  3KWV C;  1IAG A;  2OVX A;  2K2G A;  4ILW D;  2OZR A;  1XM5 A;  1L6J A;  4G9L A;  4IJO A;  2CLT A;  1KUG A;  2Z2D A;  2AYK A;  3LJG A;  3ZXH A;  1HFC A;  1Q3A A;  1SAT A;  1SLM A;  5I4O A;  1GKC A;  5H8X A;  4J4M A;  1OM7 A;  3AYK A;  3OHO A;  4JIJ A;  2O3E A;  4IUW A;  1ROS A;  1JK3 A;  4PKV A;  3DPF A;  3HDB A;  1K7I A;  1GE6 A;  1AST A;  1PWW A;  3G42 A;  3LQB A;  4WKE A;  3Q2H A;  4L63 A;  3U1R A;  2XS3 A;  3L0V A;  2MLR A;  2QPJ A;  3LJT A;  2X3C A;  1PWP A;  3K7N A;  1KAP P;  3EDH A;  1BM6 A;  4PKQ A;  1QJI A;  4R3V A;  4PKR A;  1G12 A;  4WKI A;  4AXQ A;  1IAE A;  1ZVX A;  2E2D A;  2MZE A;  2OW1 A;  1CGE A;  5L7F A;  1UMT A;  4Q1L A;  4XM6 A;  3ZVS A;  4DD8 A;  5D1U A;  5D2B A;  4DF9 A;  2RJQ A;  1CQR A;  4JA1 A;  3SHI A;  3AIG A;  1G49 A;  1HY7 A;  1KUK A;  1XAX A;  3HB2 P;  4XCT A;  4QKZ A;  4H84 A;  4H82 A;  2DW1 A;  2JSD A;  1USN A;  1CK7 A;  4FXY P;  4PKT A;  1QIA A;  1JAN A;  2W13 A;  3I7G A;  1IAB A;  1BIW A;  3LUM A;  1B3D A;  1GO8 P;  1ZXV A;  4A7B A;  5CZM A;  1GXD A;  5I3M A;  1ZP5 A;  1HOV A;  5I0L A;  1JH1 A;  5I2Z A;  4WZV A;  3EHY A;  3LIL A;  1QUA A;  1Z3J A;  1SU3 A;  5CXA A;  3HDA P;  3KEJ A;  4AYK A;  3VTG A;  4GR3 A;  3WV3 A;  5D1S A;  1QJJ A;  5BOT A;  2MZI A;  3KEC A;  4FU4 A;  5JMY A;  1JAP A;  1ATL A;  3F1A A;  1ND1 A;  3NX7 A;  4FXQ A;  4L19 A;  3P1V A;  3HY7 A;  2RJP A;  1MMQ A;  3HYG A;  4GR8 A;  1B8Y A;  2K9C A;  1K7G A;  1OMJ A;  2ERO A;  3F18 A;  3WV1 A;  2OVZ A;  2E3X A;  4H1Q A;  1FM1 A;  3DSL A;  1XUD A;  3N2V A;  4JPA A;  1IAD A;  2D1O A;  2J0T A;  4IN9 A;  1XFW A;  1BKC E;  2DW0 A;  4A3W A;  1C8T A;  1A85 A;  3HBV P;  4DV8 A;  5BPA A;  3USN A;  2ERP A;  2I47 A;  4PKW A;  1HTD A;  1IAC A;  1O0T A;  1FBL A;  1O0Q A;  1JJ9 A;  2MZH A;  2OY2 A;  1SLN A;  3G5C A;  1PWU A;  4WF6 A;  1R55 A;  1BZS A;  2X3A A;  2OW0 A;  2YUF A;  3E8R A;  3KRY A;  1BKC A;  4CTH A;  1OM8 A;  1RM8 A;  1J7N A;  1XUC A;  3N2U A;  5L79 A;  2HU6 A;  3EDI A;  2OY4 A;  1SMP A;  1ZTQ A;  3F17 A;  4H49 A;  1BQQ M;  1ZS0 A;  1IAA A;  1G9K A;  1R1J A;  2W15 A;  4JP4 A;  3K7L A;  4XBH A;  2YB9 A;  1OM6 A;  4L6T A;  2L0R A;  2WO8 A;  2A8H A;  1EUB A;  1UTT A;  1GO7 P;  4GF1 A;  4HX3 A;  1MMR A;  1CAQ A;  3HBU P;  4L7A A;  2W14 A;  3WV2 A;  4GWN A;  2V4B A;  3TS4 A;  1Y0V A;  2KRJ A;  1H71 P;  1UEA A;  3EDZ A;  2WO9 A;  3AYU A;  3RTT A;  3LK8 A;  1EB6 A;  4AUO A;  4GUY A;  4I35 A;  1ZXC A;  1KUI A;  3B2Z A;  4G0D A;  3TSK A;  3LGP A;  3MA2 A;  2JT5 A;  1JKY A;  4ZR5 A;  1AYK A;  4AIG A;  2JIH A;  3LJZ A;  3LKA A;  1S4B P;  1JIZ A;  2OXW A;  1CGF A;  3DL1 A;  5D1T A;  2MLS A;  1BKC I;  3EHX A;  5B5P A;  1OZ9 A;  1AKL A;  2W12 A;  3LQ0 A;  1OS2 A;  1YCM A;  2XS4 A;  1UTZ A;  966C A;  3LE9 A;  4WK7 A;  456C A;  1XFX A;  2DW2 A;  2O36 A;  1G4K A;  1D8F A;  3UVC A;  1C7K A;  1HV5 A;  2Y6C A;  1TVI A;  1BUD A;  1XUR A;  4I03 A;  2X7M A;  3F19 A;  1I73 A;  2USN A;  1OO9 A;  3O64 A;  3TVC A;  2D1N A;  3KME A;  3LUN A;  1KUH A;  1Y8J A;  1I76 A;  4GWM A;  3LIR A;  5B5O A;  2OW9 A;  4H2E A;  1XFV A;  3V96 B;  2CKI A;  2WOA A; 
#chains in the Genus database with same CATH homology
 1RMZ A;  1XFY A;  1GE5 A;  1R1H A;  3LMC A;  5I12 A;  1Y93 A;  1CXV A;  3Q2G A;  3VI1 A;  2Y6D A;  3DTE A;  2DDY A;  2YIG A;  3HY9 A;  3RTS A;  4PKS A;  1HFS A;  1MNC A;  3BA0 A;  3KHI A;  2DDF A;  1GE7 A;  1OS9 A;  1CGL A;  1D7X A;  4XM8 A;  1D8M A;  3B92 A;  3DTI A;  1R1I A;  4FVL A;  3KMC A;  1PWQ A;  3I7I A;  1YOU A;  4EFS A;  2N8R A;  3KEK A;  1KUF A;  3LEA A;  1R54 A;  2J83 A;  1PWV A;  1A86 A;  1JIW P;  4ON1 A;  3DTK A;  1KBC A;  3EDG A;  4GR0 A;  3DNG A;  2X3B A;  5BOY A;  3ELM A;  1SRP A;  5D7W A;  2W0D A;  1XFU A;  2FV5 A;  1DMT A;  4HMA A;  1BSW A;  3OHL A;  1YQY A;  1XFZ A;  1GKD A;  1QIB A;  1DTH A;  1I1I P;  2FV9 A;  2TCL A;  3F16 A;  2AIG P;  1G05 A;  2POJ A;  1AF0 A;  1JAO A;  3TT4 A;  3ZUK A;  2PJT A;  3LIK A;  3F15 A;  3B8Z A;  1K7Q A;  2OXZ A;  2JNP A;  1BUV M;  2JT6 A;  1MMP A;  1UMS A;  830C A;  3EWJ A;  5D3C A;  5I43 A;  2OI0 A;  1CIZ A;  3CKI A;  1C3I A;  3GBO A;  4XM7 A;  1QIC A;  1BQO A;  1FLS A;  1YP1 A;  2SRT A;  1MMB A;  1WNI A;  1D5J A;  2ERQ A;  4H30 A;  1EAK A;  4PKU A;  4JQG A;  4H3X A;  3P24 A;  4DPE A;  2OXU A;  4GQL A;  3DPE A;  1JAQ A;  2OW2 A;  3DWB A;  3L0T A;  4H76 A;  3O2X A;  5CUH A;  5LAB A;  3KWV C;  1IAG A;  2OVX A;  2K2G A;  4ILW D;  2OZR A;  1L6J A;  4G9L A;  4IJO A;  2CLT A;  1KUG A;  2Z2D A;  2AYK A;  3LJG A;  3ZXH A;  1HFC A;  1Q3A A;  1SAT A;  1SLM A;  5I4O A;  1GKC A;  5H8X A;  4J4M A;  1OM7 A;  3AYK A;  3OHO A;  4JIJ A;  2O3E A;  4IUW A;  1ROS A;  1JK3 A;  4PKV A;  3DPF A;  3HDB A;  1K7I A;  1GE6 A;  1AST A;  1PWW A;  3G42 A;  3LQB A;  4WKE A;  3Q2H A;  4L63 A;  3U1R A;  2XS3 A;  3L0V A;  2MLR A;  2QPJ A;  3LJT A;  2X3C A;  1PWP A;  3K7N A;  1KAP P;  3EDH A;  1BM6 A;  4PKQ A;  1QJI A;  4R3V A;  4PKR A;  1G12 A;  4WKI A;  4AXQ A;  1IAE A;  1ZVX A;  2E2D A;  2MZE A;  2OW1 A;  1CGE A;  5L7F A;  1UMT A;  4Q1L A;  4XM6 A;  3ZVS A;  4DD8 A;  5D1U A;  5D2B A;  4DF9 A;  2RJQ A;  1CQR A;  4JA1 A;  3SHI A;  3AIG A;  1G49 A;  1HY7 A;  1KUK A;  3HB2 P;  4XCT A;  4QKZ A;  4H84 A;  4H82 A;  2DW1 A;  2JSD A;  1USN A;  1CK7 A;  4FXY P;  4PKT A;  1QIA A;  1JAN A;  2W13 A;  3I7G A;  1IAB A;  1BIW A;  3LUM A;  1B3D A;  1GO8 P;  1ZXV A;  4A7B A;  5CZM A;  1GXD A;  5I3M A;  1ZP5 A;  1HOV A;  5I0L A;  1JH1 A;  5I2Z A;  4WZV A;  3EHY A;  3LIL A;  1QUA A;  1Z3J A;  1SU3 A;  5CXA A;  3HDA P;  3KEJ A;  4AYK A;  3VTG A;  4GR3 A;  3WV3 A;  5D1S A;  1QJJ A;  5BOT A;  2MZI A;  3KEC A;  4FU4 A;  5JMY A;  1JAP A;  1ATL A;  3F1A A;  1ND1 A;  3NX7 A;  4FXQ A;  4L19 A;  3P1V A;  3HY7 A;  2RJP A;  1MMQ A;  3HYG A;  4GR8 A;  1B8Y A;  2K9C A;  1K7G A;  1OMJ A;  2ERO A;  3F18 A;  3WV1 A;  2OVZ A;  2E3X A;  4H1Q A;  1FM1 A;  3DSL A;  1XUD A;  3N2V A;  4JPA A;  1IAD A;  2D1O A;  2J0T A;  4IN9 A;  1XFW A;  1BKC E;  2DW0 A;  4A3W A;  1C8T A;  1A85 A;  3HBV P;  4DV8 A;  5BPA A;  3USN A;  2ERP A;  2I47 A;  4PKW A;  1HTD A;  1IAC A;  1O0T A;  1FBL A;  1O0Q A;  1JJ9 A;  2MZH A;  2OY2 A;  1SLN A;  3G5C A;  1PWU A;  4WF6 A;  1R55 A;  1BZS A;  2X3A A;  2OW0 A;  2YUF A;  3E8R A;  3KRY A;  1BKC A;  4CTH A;  1OM8 A;  1RM8 A;  1J7N A;  1XUC A;  3N2U A;  5L79 A;  2HU6 A;  3EDI A;  2OY4 A;  1SMP A;  1ZTQ A;  3F17 A;  4H49 A;  1BQQ M;  1ZS0 A;  1IAA A;  1G9K A;  1R1J A;  2W15 A;  4JP4 A;  3K7L A;  4XBH A;  2YB9 A;  1OM6 A;  4L6T A;  2L0R A;  2WO8 A;  2A8H A;  1EUB A;  1UTT A;  1GO7 P;  4GF1 A;  4HX3 A;  1MMR A;  1CAQ A;  3HBU P;  4L7A A;  2W14 A;  3WV2 A;  4GWN A;  2V4B A;  3TS4 A;  1Y0V A;  2KRJ A;  1H71 P;  1UEA A;  3EDZ A;  2WO9 A;  3AYU A;  3RTT A;  3LK8 A;  1EB6 A;  4AUO A;  4GUY A;  4I35 A;  1ZXC A;  1KUI A;  3B2Z A;  4G0D A;  3TSK A;  3LGP A;  3MA2 A;  2JT5 A;  1JKY A;  4ZR5 A;  1AYK A;  4AIG A;  2JIH A;  3LJZ A;  3LKA A;  1S4B P;  1JIZ A;  2OXW A;  1CGF A;  3DL1 A;  5D1T A;  2MLS A;  1BKC I;  3EHX A;  5B5P A;  1AKL A;  2W12 A;  3LQ0 A;  1OS2 A;  1YCM A;  2XS4 A;  1UTZ A;  966C A;  3LE9 A;  4WK7 A;  456C A;  1XFX A;  2DW2 A;  2O36 A;  1G4K A;  1D8F A;  3UVC A;  1C7K A;  1HV5 A;  2Y6C A;  1BUD A;  1XUR A;  4I03 A;  2X7M A;  3F19 A;  1I73 A;  2USN A;  1OO9 A;  3O64 A;  3TVC A;  2D1N A;  3KME A;  3LUN A;  1KUH A;  1Y8J A;  1I76 A;  4GWM A;  3LIR A;  5B5O A;  2OW9 A;  4H2E A;  1XFV A;  3V96 B;  2CKI A;  2WOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...