4H82A

Crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
160
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metalloproteinase-9
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h82A00
3TVCA 3MA2A 2JT5A 1SATA 2YB9A 1OS2A 4AUOA 3B2ZA 1GE7A 1HOVA 1QIBA 1GO7P 1QIAA 3U1RA 5D1UA 3LMCA 1B3DA 3F16A 1ASTA 2ERPA 1SU3A 2E2DA 3K7LA 1RMZA 3B92A 4WKIA 3LJTA 2DDFA 3DWBA 2JIHA 1BZSA 2EROA 1BQOA 4WKEA 2W15A 1JIZA 1B8YA 2MZIA 1MMBA 4PKUA 4EFSA 3TT4A 4ILWD 1R1IA 4G9LA 1BUDA 1YOUA 5BPAA 4H30A 1UEAA 4R3VA 4GR8A 4GUYA 3O64A 4H82A 2KRJA 3EHXA 3DPEA 3WV2A 3EWJA 2DW1A 1GKDA 1PWUA 1SLNA 4JQGA 2CLTA 4CTHA 3L0TA 4GR3A 3ZXHA 1L6JA 2J0TA 1BSWA 1JKYA 2SRTA 4FU4A 1RM8A 4H2EA 1CQRA 2N8RA 3L0VA 3HBUP 5D2BA 1OS9A 2MZEA 3OHLA 1KUIA 3HY9A 1DTHA 4DD8A 3G42A 3F19A 3HBVP 4GR0A 1IAGA 2D1NA 1GE5A 3I7GA 2D1OA 1FM1A 1D8MA 1MNCA 3WV3A 1XURA 4GWMA 2OVZA 1Y0VA 5CXAA 2W14A 1KBCA 1CIZA 1GO8P 5LABA 2DW0A 1ZS0A 2RJPA 3BA0A 1G9KA 3LILA 4FXYP 3RTSA 4H1QA 3EDZA 4PKVA 3F18A 3LKAA 1CAQA 3N2UA 1J7NA 1AYKA 4XCTA 1UTZA 1ROSA 1KUFA 456CA 1R1JA 1JJ9A 1K7GA 4DF9A 2FV5A 1G05A 3ZVSA 3WV1A 2OW0A 2DDYA 2Y6CA 1H71P 4L19A 3LK8A 2OY2A 3N2VA 1YP1A 3DNGA 1UMSA 1EB6A 1SLMA 1JH1A 5CZMA 3KEKA 3CKIA 5H8XA 1PWWA 3HB2P 3DPFA 4XM8A 3AYUA 3LIRA 2X3BA 3LIKA 830CA 1I73A 2OVXA 5CUHA 3RTTA 1HY7A 1IAEA 3KMEA 3LGPA 1OM8A 3LJGA 1Y8JA 2V4BA 1GE6A 2W13A 1OM7A 3ZUKA 3P24A 1G12A 1CK7A 1ZVXA 1HV5A 3LJZA 2K9CA 4QKZA 1BUVM 1OMJA 2TCLA 1KUKA 3VTGA 1JK3A 1HTDA 1OM6A 4FXQA 2POJA 5JMYA 3G5CA 4Q1LA 4AXQA 2WOAA 1MMPA 2AYKA 4IJOA 2OXZA 3ELMA 1C8TA 4HX3A 3HY7A 1I76A 2HU6A 5I2ZA 2WO8A 1XUDA 4PKWA 3LEAA 3LE9A 2O3EA 5BOYA 1BIWA 1IACA 5L7FA 3LQBA 2AIGP 1BKCA 2YIGA 4I03A 2W0DA 4JA1A 1AKLA 4H84A 2W12A 3DSLA 2A8HA 1QUAA 1CGLA 1D5JA 3KEJA 1HFCA 3TS4A 3HDBA 3LUNA 1UMTA 5D1TA 1R1HA 1ZP5A 2MLSA 4XM7A 1Y93A 3F15A 1CGEA 4JPAA 1IADA 2OW9A 2WO9A 3Q2GA 3SHIA 4HMAA 3HYGA 4PKQA 1ATLA 4J4MA 4ON1A 1XUCA 3LQ0A 4ZR5A 4AIGA 1CXVA 1QJJA 1XFWA 3EDIA 1G49A 2CKIA 4H49A 1XFYA 4L63A 1K7QA 5B5PA 5D3CA 1BKCI 1ZTQA 1XFVA 2OW1A 4IN9A 2JT6A 4L6TA 3USNA 1XFZA 4GQLA 2OXUA 1ZXCA 4I35A 3AYKA 3GBOA 2XS3A 3AIGA 4H3XA 1QJIA 2JSDA 3UVCA 1O0QA 3P1VA 1USNA 1S4BP 1A86A 1GXDA 4XM6A 4DPEA 2OZRA 3EDGA 5B5OA 2K2GA 1JIWP 1HFSA 1ZXVA 3K7NA 1FBLA 5I12A 1KUGA 3TSKA 4PKSA 1ND1A 2OI0A 3KRYA 4PKRA 1O0TA 1BKCE 1BM6A 1D8FA 1FLSA 5D1SA 1IABA 1SMPA 2RJQA 1BQQM 2O36A 2QPJA 1KUHA 5I3MA 4PKTA 3F17A 3KHIA 1YQYA 4JP4A 4XBHA 3LUMA 966CA 2JNPA 1A85A 4GWNA 1D7XA 3EHYA 4WZVA 1EUBA 2OW2A 3DL1A 4WF6A 1K7IA 2X7MA 5D7WA 4WK7A 2ERQA 4AYKA 1JAOA 4GF1A 1SRPA 3O2XA 1XFXA 1WNIA 2X3CA 1PWPA 2L0RA 1UTTA 2Y6DA 1CGFA 1Z3JA 3KWVC 1OO9A 1G4KA 4DV8A 1DMTA 5I4OA 3VI1A 1JANA 2PJTA 2DW2A 1C3IA 2OY4A 2MLRA 2MZHA 4A7BA 1KAPP 2XS4A 1PWVA 4H76A 5I0LA 3V96B 2X3AA 3EDHA 3OHOA 3Q2HA 2I47A 2USNA 5BOTA 1R54A 3KECA 1MMQA 4FVLA 3E8RA 2E3XA 3HDAP 1QICA 1GKCA 4A3WA 1JAQA 3KMCA 1MMRA 5L79A 3I7IA 3B8ZA 3F1AA 1EAKA 1AF0A 2FV9A 1IAAA 4IUWA 4JIJA 1YCMA 3NX7A 1JAPA 2J83A 2OXWA 1Q3AA 1R55A 1C7KA 4G0DA 1I1IP 5I43A 1PWQA 1XFUA 2Z2DA
chains in the Genus database with same CATH superfamily
3TVCA 3MA2A 2JT5A 1SATA 2YB9A 1OS2A 4AUOA 3B2ZA 1GE7A 1HOVA 1QIBA 1GO7P 1QIAA 3U1RA 5D1UA 3LMCA 1B3DA 3F16A 1ASTA 2ERPA 1SU3A 2E2DA 3K7LA 1RMZA 3B92A 4WKIA 3LJTA 2DDFA 3DWBA 2JIHA 1BZSA 2EROA 1BQOA 4WKEA 2W15A 1JIZA 1B8YA 2MZIA 1MMBA 4PKUA 4EFSA 3TT4A 4ILWD 1R1IA 4G9LA 1BUDA 1YOUA 5BPAA 4H30A 1UEAA 4R3VA 4GR8A 4GUYA 3O64A 4H82A 2KRJA 3EHXA 3DPEA 3WV2A 3EWJA 2DW1A 1GKDA 1PWUA 1SLNA 4JQGA 2CLTA 4CTHA 3L0TA 4GR3A 3ZXHA 1L6JA 2J0TA 1BSWA 1JKYA 2SRTA 4FU4A 1RM8A 4H2EA 1CQRA 2N8RA 3L0VA 3HBUP 5D2BA 1OS9A 2MZEA 3OHLA 1KUIA 3HY9A 1DTHA 4DD8A 3G42A 3F19A 3HBVP 4GR0A 1IAGA 2D1NA 1GE5A 3I7GA 2D1OA 1FM1A 1D8MA 1MNCA 3WV3A 1XURA 4GWMA 2OVZA 1Y0VA 5CXAA 1TVIA 2W14A 1KBCA 1CIZA 1GO8P 5LABA 2DW0A 1ZS0A 2RJPA 3BA0A 1G9KA 3LILA 4FXYP 3RTSA 4H1QA 3EDZA 4PKVA 3F18A 3LKAA 1CAQA 3N2UA 1J7NA 1AYKA 4XCTA 1UTZA 1ROSA 1KUFA 456CA 1R1JA 1JJ9A 1K7GA 4DF9A 2FV5A 1G05A 3ZVSA 3WV1A 2OW0A 2DDYA 2Y6CA 1H71P 4L19A 3LK8A 2OY2A 3N2VA 1YP1A 3DNGA 1UMSA 1EB6A 1SLMA 1JH1A 5CZMA 3KEKA 3CKIA 5H8XA 1PWWA 3HB2P 3DPFA 4XM8A 3AYUA 3LIRA 2X3BA 3LIKA 830CA 1I73A 2OVXA 5CUHA 3RTTA 1HY7A 1IAEA 3KMEA 3LGPA 1OM8A 3LJGA 1Y8JA 2V4BA 1GE6A 1XAXA 2W13A 1OM7A 3ZUKA 3P24A 3DTIA 1G12A 1CK7A 1ZVXA 1HV5A 3LJZA 2K9CA 4QKZA 1BUVM 1OMJA 2TCLA 1KUKA 3VTGA 1JK3A 1HTDA 1OM6A 4FXQA 2POJA 5JMYA 3G5CA 4Q1LA 4AXQA 2WOAA 1MMPA 2AYKA 4IJOA 2OXZA 3ELMA 1C8TA 4HX3A 3HY7A 1I76A 2HU6A 5I2ZA 2WO8A 1XUDA 4PKWA 3LEAA 3LE9A 2O3EA 5BOYA 1BIWA 1IACA 5L7FA 3LQBA 2AIGP 1BKCA 2YIGA 4I03A 2W0DA 4JA1A 1AKLA 4H84A 2W12A 3DSLA 2A8HA 1QUAA 1CGLA 1D5JA 3KEJA 1HFCA 3TS4A 3HDBA 3LUNA 1UMTA 5D1TA 1R1HA 1ZP5A 2MLSA 4XM7A 1Y93A 3F15A 1CGEA 4JPAA 1IADA 2OW9A 2WO9A 3Q2GA 3SHIA 4HMAA 3HYGA 4PKQA 1ATLA 4J4MA 4ON1A 1XUCA 3LQ0A 4ZR5A 4AIGA 1CXVA 1QJJA 1XFWA 3EDIA 1G49A 2CKIA 4H49A 1XFYA 4L63A 1K7QA 5B5PA 5D3CA 1BKCI 1ZTQA 1XFVA 2OW1A 4IN9A 2JT6A 4L6TA 3USNA 1XFZA 4GQLA 2OXUA 1ZXCA 4I35A 3AYKA 3GBOA 2XS3A 3AIGA 4H3XA 1QJIA 2JSDA 3UVCA 1O0QA 3P1VA 4L7AA 1USNA 1S4BP 1A86A 1GXDA 4XM6A 4DPEA 2OZRA 3EDGA 5B5OA 2K2GA 1JIWP 1HFSA 1ZXVA 3K7NA 1FBLA 5I12A 1KUGA 3TSKA 4PKSA 1ND1A 2YUFA 2OI0A 3KRYA 4PKRA 1O0TA 1BKCE 1BM6A 1D8FA 1FLSA 5D1SA 1IABA 1SMPA 2RJQA 1BQQM 2O36A 2QPJA 1KUHA 5I3MA 4PKTA 3F17A 3KHIA 1YQYA 4JP4A 4XBHA 3LUMA 966CA 2JNPA 1A85A 4GWNA 1D7XA 3EHYA 4WZVA 1EUBA 2OW2A 3DL1A 4WF6A 1K7IA 2X7MA 5D7WA 4WK7A 2ERQA 4AYKA 1JAOA 4GF1A 1SRPA 3O2XA 3DTKA 1XFXA 1WNIA 2X3CA 1PWPA 2L0RA 1UTTA 2Y6DA 1CGFA 1Z3JA 3KWVC 1OO9A 1G4KA 4DV8A 1DMTA 5I4OA 3VI1A 1JANA 2PJTA 1XM5A 2DW2A 1C3IA 2OY4A 2MLRA 2MZHA 4A7BA 1KAPP 3DTEA 2XS4A 1PWVA 4H76A 5I0LA 3V96B 2X3AA 3EDHA 1OZ9A 3OHOA 3Q2HA 2I47A 2USNA 5BOTA 1R54A 3KECA 1MMQA 4FVLA 3E8RA 2E3XA 3HDAP 1QICA 1GKCA 4A3WA 1JAQA 3KMCA 1MMRA 5L79A 3I7IA 3B8ZA 3F1AA 1EAKA 1AF0A 2FV9A 1IAAA 4IUWA 4JIJA 1YCMA 3NX7A 1JAPA 2J83A 2OXWA 1Q3AA 1R55A 1C7KA 4G0DA 1I1IP 5I43A 1PWQA 1XFUA 2Z2DA
chains in the Genus database with same CATH topology
3TVCA 3MA2A 2JT5A 1SATA 2YB9A 1OS2A 4AUOA 3B2ZA 1GE7A 1HOVA 1QIBA 1GO7P 1QIAA 3U1RA 5D1UA 3LMCA 1B3DA 3F16A 1ASTA 2ERPA 1SU3A 2E2DA 3K7LA 1RMZA 3B92A 4WKIA 3LJTA 2DDFA 3DWBA 2JIHA 1BZSA 2EROA 1BQOA 4WKEA 2W15A 1JIZA 1B8YA 2MZIA 1MMBA 4PKUA 4EFSA 3TT4A 4ILWD 1R1IA 4G9LA 1BUDA 1YOUA 5BPAA 4H30A 1UEAA 4R3VA 4GR8A 4GUYA 3O64A 4H82A 2KRJA 3EHXA 3DPEA 3WV2A 3EWJA 2DW1A 1GKDA 1PWUA 1SLNA 4JQGA 2CLTA 4CTHA 3L0TA 4GR3A 3ZXHA 1L6JA 2J0TA 1BSWA 1JKYA 2SRTA 4FU4A 1RM8A 4H2EA 1CQRA 2N8RA 3L0VA 3HBUP 5D2BA 1OS9A 2MZEA 3OHLA 1KUIA 3HY9A 1DTHA 4DD8A 3G42A 3F19A 3HBVP 4GR0A 1IAGA 2D1NA 1GE5A 3I7GA 2D1OA 1FM1A 1D8MA 1MNCA 3WV3A 1XURA 4GWMA 2OVZA 1Y0VA 5CXAA 2W14A 1KBCA 1CIZA 1GO8P 5LABA 2DW0A 1ZS0A 2RJPA 3BA0A 1G9KA 3LILA 4FXYP 3RTSA 4H1QA 3EDZA 4PKVA 3F18A 3LKAA 1CAQA 3N2UA 1J7NA 1AYKA 4XCTA 1UTZA 1ROSA 1KUFA 456CA 1R1JA 1JJ9A 1K7GA 4DF9A 2FV5A 1G05A 3ZVSA 3WV1A 2OW0A 2DDYA 2Y6CA 1H71P 4L19A 3LK8A 2OY2A 3N2VA 1YP1A 3DNGA 1UMSA 1EB6A 1SLMA 1JH1A 5CZMA 3KEKA 3CKIA 5H8XA 1PWWA 3HB2P 3DPFA 4XM8A 3AYUA 3LIRA 2X3BA 3LIKA 830CA 1I73A 2OVXA 5CUHA 3RTTA 1HY7A 1IAEA 3KMEA 3LGPA 1OM8A 3LJGA 1Y8JA 2V4BA 1GE6A 2W13A 1OM7A 3ZUKA 3P24A 3DTIA 1G12A 1CK7A 1ZVXA 1HV5A 3LJZA 2K9CA 4QKZA 1BUVM 1OMJA 2TCLA 1KUKA 3VTGA 1JK3A 1HTDA 1OM6A 4FXQA 2POJA 5JMYA 3G5CA 4Q1LA 4AXQA 2WOAA 1MMPA 2AYKA 4IJOA 2OXZA 3ELMA 1C8TA 4HX3A 3HY7A 1I76A 2HU6A 5I2ZA 2WO8A 1XUDA 4PKWA 3LEAA 3LE9A 2O3EA 5BOYA 1BIWA 1IACA 5L7FA 3LQBA 2AIGP 1BKCA 2YIGA 4I03A 2W0DA 4JA1A 1AKLA 4H84A 2W12A 3DSLA 2A8HA 1QUAA 1CGLA 1D5JA 3KEJA 1HFCA 3TS4A 3HDBA 3LUNA 1UMTA 5D1TA 1R1HA 1ZP5A 2MLSA 4XM7A 1Y93A 3F15A 1CGEA 4JPAA 1IADA 2OW9A 2WO9A 3Q2GA 3SHIA 4HMAA 3HYGA 4PKQA 1ATLA 4J4MA 4ON1A 1XUCA 3LQ0A 4ZR5A 4AIGA 1CXVA 1QJJA 1XFWA 3EDIA 1G49A 2CKIA 4H49A 1XFYA 4L63A 1K7QA 5B5PA 5D3CA 1BKCI 1ZTQA 1XFVA 2OW1A 4IN9A 2JT6A 4L6TA 3USNA 1XFZA 4GQLA 2OXUA 1ZXCA 4I35A 3AYKA 3GBOA 2XS3A 3AIGA 4H3XA 1QJIA 2JSDA 3UVCA 1O0QA 3P1VA 4L7AA 1USNA 1S4BP 1A86A 1GXDA 4XM6A 4DPEA 2OZRA 3EDGA 5B5OA 2K2GA 1JIWP 1HFSA 1ZXVA 3K7NA 1FBLA 5I12A 1KUGA 3TSKA 4PKSA 1ND1A 2YUFA 2OI0A 3KRYA 4PKRA 1O0TA 1BKCE 1BM6A 1D8FA 1FLSA 5D1SA 1IABA 1SMPA 2RJQA 1BQQM 2O36A 2QPJA 1KUHA 5I3MA 4PKTA 3F17A 3KHIA 1YQYA 4JP4A 4XBHA 3LUMA 966CA 2JNPA 1A85A 4GWNA 1D7XA 3EHYA 4WZVA 1EUBA 2OW2A 3DL1A 4WF6A 1K7IA 2X7MA 5D7WA 4WK7A 2ERQA 4AYKA 1JAOA 4GF1A 1SRPA 3O2XA 3DTKA 1XFXA 1WNIA 2X3CA 1PWPA 2L0RA 1UTTA 2Y6DA 1CGFA 1Z3JA 3KWVC 1OO9A 1G4KA 4DV8A 1DMTA 5I4OA 3VI1A 1JANA 2PJTA 2DW2A 1C3IA 2OY4A 2MLRA 2MZHA 4A7BA 1KAPP 3DTEA 2XS4A 1PWVA 4H76A 5I0LA 3V96B 2X3AA 3EDHA 3OHOA 3Q2HA 2I47A 2USNA 5BOTA 1R54A 3KECA 1MMQA 4FVLA 3E8RA 2E3XA 3HDAP 1QICA 1GKCA 4A3WA 1JAQA 3KMCA 1MMRA 5L79A 3I7IA 3B8ZA 3F1AA 1EAKA 1AF0A 2FV9A 1IAAA 4IUWA 4JIJA 1YCMA 3NX7A 1JAPA 2J83A 2OXWA 1Q3AA 1R55A 1C7KA 4G0DA 1I1IP 5I43A 1PWQA 1XFUA 2Z2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVC A;  3MA2 A;  2JT5 A;  1SAT A;  2YB9 A;  1OS2 A;  4AUO A;  3B2Z A;  1GE7 A;  1HOV A;  1QIB A;  1GO7 P;  1QIA A;  3U1R A;  5D1U A;  3LMC A;  1B3D A;  3F16 A;  1AST A;  2ERP A;  1SU3 A;  2E2D A;  3K7L A;  1RMZ A;  3B92 A;  4WKI A;  3LJT A;  2DDF A;  3DWB A;  2JIH A;  1BZS A;  2ERO A;  1BQO A;  4WKE A;  2W15 A;  1JIZ A;  1B8Y A;  2MZI A;  1MMB A;  4PKU A;  4EFS A;  3TT4 A;  4ILW D;  1R1I A;  4G9L A;  1BUD A;  1YOU A;  5BPA A;  4H30 A;  1UEA A;  4R3V A;  4GR8 A;  4GUY A;  3O64 A;  4H82 A;  2KRJ A;  3EHX A;  3DPE A;  3WV2 A;  3EWJ A;  2DW1 A;  1GKD A;  1PWU A;  1SLN A;  4JQG A;  2CLT A;  4CTH A;  3L0T A;  4GR3 A;  3ZXH A;  1L6J A;  2J0T A;  1BSW A;  1JKY A;  2SRT A;  4FU4 A;  1RM8 A;  4H2E A;  1CQR A;  2N8R A;  3L0V A;  3HBU P;  5D2B A;  1OS9 A;  2MZE A;  3OHL A;  1KUI A;  3HY9 A;  1DTH A;  4DD8 A;  3G42 A;  3F19 A;  3HBV P;  4GR0 A;  1IAG A;  2D1N A;  1GE5 A;  3I7G A;  2D1O A;  1FM1 A;  1D8M A;  1MNC A;  3WV3 A;  1XUR A;  4GWM A;  2OVZ A;  1Y0V A;  5CXA A;  2W14 A;  1KBC A;  1CIZ A;  1GO8 P;  5LAB A;  2DW0 A;  1ZS0 A;  2RJP A;  3BA0 A;  1G9K A;  3LIL A;  4FXY P;  3RTS A;  4H1Q A;  3EDZ A;  4PKV A;  3F18 A;  3LKA A;  1CAQ A;  3N2U A;  1J7N A;  1AYK A;  4XCT A;  1UTZ A;  1ROS A;  1KUF A;  456C A;  1R1J A;  1JJ9 A;  1K7G A;  4DF9 A;  2FV5 A;  1G05 A;  3ZVS A;  3WV1 A;  2OW0 A;  2DDY A;  2Y6C A;  1H71 P;  4L19 A;  3LK8 A;  2OY2 A;  3N2V A;  1YP1 A;  3DNG A;  1UMS A;  1EB6 A;  1SLM A;  1JH1 A;  5CZM A;  3KEK A;  3CKI A;  5H8X A;  1PWW A;  3HB2 P;  3DPF A;  4XM8 A;  3AYU A;  3LIR A;  2X3B A;  3LIK A;  830C A;  1I73 A;  2OVX A;  5CUH A;  3RTT A;  1HY7 A;  1IAE A;  3KME A;  3LGP A;  1OM8 A;  3LJG A;  1Y8J A;  2V4B A;  1GE6 A;  2W13 A;  1OM7 A;  3ZUK A;  3P24 A;  1G12 A;  1CK7 A;  1ZVX A;  1HV5 A;  3LJZ A;  2K9C A;  4QKZ A;  1BUV M;  1OMJ A;  2TCL A;  1KUK A;  3VTG A;  1JK3 A;  1HTD A;  1OM6 A;  4FXQ A;  2POJ A;  5JMY A;  3G5C A;  4Q1L A;  4AXQ A;  2WOA A;  1MMP A;  2AYK A;  4IJO A;  2OXZ A;  3ELM A;  1C8T A;  4HX3 A;  3HY7 A;  1I76 A;  2HU6 A;  5I2Z A;  2WO8 A;  1XUD A;  4PKW A;  3LEA A;  3LE9 A;  2O3E A;  5BOY A;  1BIW A;  1IAC A;  5L7F A;  3LQB A;  2AIG P;  1BKC A;  2YIG A;  4I03 A;  2W0D A;  4JA1 A;  1AKL A;  4H84 A;  2W12 A;  3DSL A;  2A8H A;  1QUA A;  1CGL A;  1D5J A;  3KEJ A;  1HFC A;  3TS4 A;  3HDB A;  3LUN A;  1UMT A;  5D1T A;  1R1H A;  1ZP5 A;  2MLS A;  4XM7 A;  1Y93 A;  3F15 A;  1CGE A;  4JPA A;  1IAD A;  2OW9 A;  2WO9 A;  3Q2G A;  3SHI A;  4HMA A;  3HYG A;  4PKQ A;  1ATL A;  4J4M A;  4ON1 A;  1XUC A;  3LQ0 A;  4ZR5 A;  4AIG A;  1CXV A;  1QJJ A;  1XFW A;  3EDI A;  1G49 A;  2CKI A;  4H49 A;  1XFY A;  4L63 A;  1K7Q A;  5B5P A;  5D3C A;  1BKC I;  1ZTQ A;  1XFV A;  2OW1 A;  4IN9 A;  2JT6 A;  4L6T A;  3USN A;  1XFZ A;  4GQL A;  2OXU A;  1ZXC A;  4I35 A;  3AYK A;  3GBO A;  2XS3 A;  3AIG A;  4H3X A;  1QJI A;  2JSD A;  3UVC A;  1O0Q A;  3P1V A;  1USN A;  1S4B P;  1A86 A;  1GXD A;  4XM6 A;  4DPE A;  2OZR A;  3EDG A;  5B5O A;  2K2G A;  1JIW P;  1HFS A;  1ZXV A;  3K7N A;  1FBL A;  5I12 A;  1KUG A;  3TSK A;  4PKS A;  1ND1 A;  2OI0 A;  3KRY A;  4PKR A;  1O0T A;  1BKC E;  1BM6 A;  1D8F A;  1FLS A;  5D1S A;  1IAB A;  1SMP A;  2RJQ A;  1BQQ M;  2O36 A;  2QPJ A;  1KUH A;  5I3M A;  4PKT A;  3F17 A;  3KHI A;  1YQY A;  4JP4 A;  4XBH A;  3LUM A;  966C A;  2JNP A;  1A85 A;  4GWN A;  1D7X A;  3EHY A;  4WZV A;  1EUB A;  2OW2 A;  3DL1 A;  4WF6 A;  1K7I A;  2X7M A;  5D7W A;  4WK7 A;  2ERQ A;  4AYK A;  1JAO A;  4GF1 A;  1SRP A;  3O2X A;  1XFX A;  1WNI A;  2X3C A;  1PWP A;  2L0R A;  1UTT A;  2Y6D A;  1CGF A;  1Z3J A;  3KWV C;  1OO9 A;  1G4K A;  4DV8 A;  1DMT A;  5I4O A;  3VI1 A;  1JAN A;  2PJT A;  2DW2 A;  1C3I A;  2OY4 A;  2MLR A;  2MZH A;  4A7B A;  1KAP P;  2XS4 A;  1PWV A;  4H76 A;  5I0L A;  3V96 B;  2X3A A;  3EDH A;  3OHO A;  3Q2H A;  2I47 A;  2USN A;  5BOT A;  1R54 A;  3KEC A;  1MMQ A;  4FVL A;  3E8R A;  2E3X A;  3HDA P;  1QIC A;  1GKC A;  4A3W A;  1JAQ A;  3KMC A;  1MMR A;  5L79 A;  3I7I A;  3B8Z A;  3F1A A;  1EAK A;  1AF0 A;  2FV9 A;  1IAA A;  4IUW A;  4JIJ A;  1YCM A;  3NX7 A;  1JAP A;  2J83 A;  2OXW A;  1Q3A A;  1R55 A;  1C7K A;  4G0D A;  1I1I P;  5I43 A;  1PWQ A;  1XFU A;  2Z2D A; 
#chains in the Genus database with same CATH topology
 3TVC A;  3MA2 A;  2JT5 A;  1SAT A;  2YB9 A;  1OS2 A;  4AUO A;  3B2Z A;  1GE7 A;  1HOV A;  1QIB A;  1GO7 P;  1QIA A;  3U1R A;  5D1U A;  3LMC A;  1B3D A;  3F16 A;  1AST A;  2ERP A;  1SU3 A;  2E2D A;  3K7L A;  1RMZ A;  3B92 A;  4WKI A;  3LJT A;  2DDF A;  3DWB A;  2JIH A;  1BZS A;  2ERO A;  1BQO A;  4WKE A;  2W15 A;  1JIZ A;  1B8Y A;  2MZI A;  1MMB A;  4PKU A;  4EFS A;  3TT4 A;  4ILW D;  1R1I A;  4G9L A;  1BUD A;  1YOU A;  5BPA A;  4H30 A;  1UEA A;  4R3V A;  4GR8 A;  4GUY A;  3O64 A;  4H82 A;  2KRJ A;  3EHX A;  3DPE A;  3WV2 A;  3EWJ A;  2DW1 A;  1GKD A;  1PWU A;  1SLN A;  4JQG A;  2CLT A;  4CTH A;  3L0T A;  4GR3 A;  3ZXH A;  1L6J A;  2J0T A;  1BSW A;  1JKY A;  2SRT A;  4FU4 A;  1RM8 A;  4H2E A;  1CQR A;  2N8R A;  3L0V A;  3HBU P;  5D2B A;  1OS9 A;  2MZE A;  3OHL A;  1KUI A;  3HY9 A;  1DTH A;  4DD8 A;  3G42 A;  3F19 A;  3HBV P;  4GR0 A;  1IAG A;  2D1N A;  1GE5 A;  3I7G A;  2D1O A;  1FM1 A;  1D8M A;  1MNC A;  3WV3 A;  1XUR A;  4GWM A;  2OVZ A;  1Y0V A;  5CXA A;  1TVI A;  2W14 A;  1KBC A;  1CIZ A;  1GO8 P;  5LAB A;  2DW0 A;  1ZS0 A;  2RJP A;  3BA0 A;  1G9K A;  3LIL A;  4FXY P;  3RTS A;  4H1Q A;  3EDZ A;  4PKV A;  3F18 A;  3LKA A;  1CAQ A;  3N2U A;  1J7N A;  1AYK A;  4XCT A;  1UTZ A;  1ROS A;  1KUF A;  456C A;  1R1J A;  1JJ9 A;  1K7G A;  4DF9 A;  2FV5 A;  1G05 A;  3ZVS A;  3WV1 A;  2OW0 A;  2DDY A;  2Y6C A;  1H71 P;  4L19 A;  3LK8 A;  2OY2 A;  3N2V A;  1YP1 A;  3DNG A;  1UMS A;  1EB6 A;  1SLM A;  1JH1 A;  5CZM A;  3KEK A;  3CKI A;  5H8X A;  1PWW A;  3HB2 P;  3DPF A;  4XM8 A;  3AYU A;  3LIR A;  2X3B A;  3LIK A;  830C A;  1I73 A;  2OVX A;  5CUH A;  3RTT A;  1HY7 A;  1IAE A;  3KME A;  3LGP A;  1OM8 A;  3LJG A;  1Y8J A;  2V4B A;  1GE6 A;  1XAX A;  2W13 A;  1OM7 A;  3ZUK A;  3P24 A;  3DTI A;  1G12 A;  1CK7 A;  1ZVX A;  1HV5 A;  3LJZ A;  2K9C A;  4QKZ A;  1BUV M;  1OMJ A;  2TCL A;  1KUK A;  3VTG A;  1JK3 A;  1HTD A;  1OM6 A;  4FXQ A;  2POJ A;  5JMY A;  3G5C A;  4Q1L A;  4AXQ A;  2WOA A;  1MMP A;  2AYK A;  4IJO A;  2OXZ A;  3ELM A;  1C8T A;  4HX3 A;  3HY7 A;  1I76 A;  2HU6 A;  5I2Z A;  2WO8 A;  1XUD A;  4PKW A;  3LEA A;  3LE9 A;  2O3E A;  5BOY A;  1BIW A;  1IAC A;  5L7F A;  3LQB A;  2AIG P;  1BKC A;  2YIG A;  4I03 A;  2W0D A;  4JA1 A;  1AKL A;  4H84 A;  2W12 A;  3DSL A;  2A8H A;  1QUA A;  1CGL A;  1D5J A;  3KEJ A;  1HFC A;  3TS4 A;  3HDB A;  3LUN A;  1UMT A;  5D1T A;  1R1H A;  1ZP5 A;  2MLS A;  4XM7 A;  1Y93 A;  3F15 A;  1CGE A;  4JPA A;  1IAD A;  2OW9 A;  2WO9 A;  3Q2G A;  3SHI A;  4HMA A;  3HYG A;  4PKQ A;  1ATL A;  4J4M A;  4ON1 A;  1XUC A;  3LQ0 A;  4ZR5 A;  4AIG A;  1CXV A;  1QJJ A;  1XFW A;  3EDI A;  1G49 A;  2CKI A;  4H49 A;  1XFY A;  4L63 A;  1K7Q A;  5B5P A;  5D3C A;  1BKC I;  1ZTQ A;  1XFV A;  2OW1 A;  4IN9 A;  2JT6 A;  4L6T A;  3USN A;  1XFZ A;  4GQL A;  2OXU A;  1ZXC A;  4I35 A;  3AYK A;  3GBO A;  2XS3 A;  3AIG A;  4H3X A;  1QJI A;  2JSD A;  3UVC A;  1O0Q A;  3P1V A;  4L7A A;  1USN A;  1S4B P;  1A86 A;  1GXD A;  4XM6 A;  4DPE A;  2OZR A;  3EDG A;  5B5O A;  2K2G A;  1JIW P;  1HFS A;  1ZXV A;  3K7N A;  1FBL A;  5I12 A;  1KUG A;  3TSK A;  4PKS A;  1ND1 A;  2YUF A;  2OI0 A;  3KRY A;  4PKR A;  1O0T A;  1BKC E;  1BM6 A;  1D8F A;  1FLS A;  5D1S A;  1IAB A;  1SMP A;  2RJQ A;  1BQQ M;  2O36 A;  2QPJ A;  1KUH A;  5I3M A;  4PKT A;  3F17 A;  3KHI A;  1YQY A;  4JP4 A;  4XBH A;  3LUM A;  966C A;  2JNP A;  1A85 A;  4GWN A;  1D7X A;  3EHY A;  4WZV A;  1EUB A;  2OW2 A;  3DL1 A;  4WF6 A;  1K7I A;  2X7M A;  5D7W A;  4WK7 A;  2ERQ A;  4AYK A;  1JAO A;  4GF1 A;  1SRP A;  3O2X A;  3DTK A;  1XFX A;  1WNI A;  2X3C A;  1PWP A;  2L0R A;  1UTT A;  2Y6D A;  1CGF A;  1Z3J A;  3KWV C;  1OO9 A;  1G4K A;  4DV8 A;  1DMT A;  5I4O A;  3VI1 A;  1JAN A;  2PJT A;  1XM5 A;  2DW2 A;  1C3I A;  2OY4 A;  2MLR A;  2MZH A;  4A7B A;  1KAP P;  3DTE A;  2XS4 A;  1PWV A;  4H76 A;  5I0L A;  3V96 B;  2X3A A;  3EDH A;  1OZ9 A;  3OHO A;  3Q2H A;  2I47 A;  2USN A;  5BOT A;  1R54 A;  3KEC A;  1MMQ A;  4FVL A;  3E8R A;  2E3X A;  3HDA P;  1QIC A;  1GKC A;  4A3W A;  1JAQ A;  3KMC A;  1MMR A;  5L79 A;  3I7I A;  3B8Z A;  3F1A A;  1EAK A;  1AF0 A;  2FV9 A;  1IAA A;  4IUW A;  4JIJ A;  1YCM A;  3NX7 A;  1JAP A;  2J83 A;  2OXW A;  1Q3A A;  1R55 A;  1C7K A;  4G0D A;  1I1I P;  5I43 A;  1PWQ A;  1XFU A;  2Z2D A; 
#chains in the Genus database with same CATH homology
 3TVC A;  3MA2 A;  2JT5 A;  1SAT A;  2YB9 A;  1OS2 A;  4AUO A;  3B2Z A;  1GE7 A;  1HOV A;  1QIB A;  1GO7 P;  1QIA A;  3U1R A;  5D1U A;  3LMC A;  1B3D A;  3F16 A;  1AST A;  2ERP A;  1SU3 A;  2E2D A;  3K7L A;  1RMZ A;  3B92 A;  4WKI A;  3LJT A;  2DDF A;  3DWB A;  2JIH A;  1BZS A;  2ERO A;  1BQO A;  4WKE A;  2W15 A;  1JIZ A;  1B8Y A;  2MZI A;  1MMB A;  4PKU A;  4EFS A;  3TT4 A;  4ILW D;  1R1I A;  4G9L A;  1BUD A;  1YOU A;  5BPA A;  4H30 A;  1UEA A;  4R3V A;  4GR8 A;  4GUY A;  3O64 A;  4H82 A;  2KRJ A;  3EHX A;  3DPE A;  3WV2 A;  3EWJ A;  2DW1 A;  1GKD A;  1PWU A;  1SLN A;  4JQG A;  2CLT A;  4CTH A;  3L0T A;  4GR3 A;  3ZXH A;  1L6J A;  2J0T A;  1BSW A;  1JKY A;  2SRT A;  4FU4 A;  1RM8 A;  4H2E A;  1CQR A;  2N8R A;  3L0V A;  3HBU P;  5D2B A;  1OS9 A;  2MZE A;  3OHL A;  1KUI A;  3HY9 A;  1DTH A;  4DD8 A;  3G42 A;  3F19 A;  3HBV P;  4GR0 A;  1IAG A;  2D1N A;  1GE5 A;  3I7G A;  2D1O A;  1FM1 A;  1D8M A;  1MNC A;  3WV3 A;  1XUR A;  4GWM A;  2OVZ A;  1Y0V A;  5CXA A;  2W14 A;  1KBC A;  1CIZ A;  1GO8 P;  5LAB A;  2DW0 A;  1ZS0 A;  2RJP A;  3BA0 A;  1G9K A;  3LIL A;  4FXY P;  3RTS A;  4H1Q A;  3EDZ A;  4PKV A;  3F18 A;  3LKA A;  1CAQ A;  3N2U A;  1J7N A;  1AYK A;  4XCT A;  1UTZ A;  1ROS A;  1KUF A;  456C A;  1R1J A;  1JJ9 A;  1K7G A;  4DF9 A;  2FV5 A;  1G05 A;  3ZVS A;  3WV1 A;  2OW0 A;  2DDY A;  2Y6C A;  1H71 P;  4L19 A;  3LK8 A;  2OY2 A;  3N2V A;  1YP1 A;  3DNG A;  1UMS A;  1EB6 A;  1SLM A;  1JH1 A;  5CZM A;  3KEK A;  3CKI A;  5H8X A;  1PWW A;  3HB2 P;  3DPF A;  4XM8 A;  3AYU A;  3LIR A;  2X3B A;  3LIK A;  830C A;  1I73 A;  2OVX A;  5CUH A;  3RTT A;  1HY7 A;  1IAE A;  3KME A;  3LGP A;  1OM8 A;  3LJG A;  1Y8J A;  2V4B A;  1GE6 A;  2W13 A;  1OM7 A;  3ZUK A;  3P24 A;  3DTI A;  1G12 A;  1CK7 A;  1ZVX A;  1HV5 A;  3LJZ A;  2K9C A;  4QKZ A;  1BUV M;  1OMJ A;  2TCL A;  1KUK A;  3VTG A;  1JK3 A;  1HTD A;  1OM6 A;  4FXQ A;  2POJ A;  5JMY A;  3G5C A;  4Q1L A;  4AXQ A;  2WOA A;  1MMP A;  2AYK A;  4IJO A;  2OXZ A;  3ELM A;  1C8T A;  4HX3 A;  3HY7 A;  1I76 A;  2HU6 A;  5I2Z A;  2WO8 A;  1XUD A;  4PKW A;  3LEA A;  3LE9 A;  2O3E A;  5BOY A;  1BIW A;  1IAC A;  5L7F A;  3LQB A;  2AIG P;  1BKC A;  2YIG A;  4I03 A;  2W0D A;  4JA1 A;  1AKL A;  4H84 A;  2W12 A;  3DSL A;  2A8H A;  1QUA A;  1CGL A;  1D5J A;  3KEJ A;  1HFC A;  3TS4 A;  3HDB A;  3LUN A;  1UMT A;  5D1T A;  1R1H A;  1ZP5 A;  2MLS A;  4XM7 A;  1Y93 A;  3F15 A;  1CGE A;  4JPA A;  1IAD A;  2OW9 A;  2WO9 A;  3Q2G A;  3SHI A;  4HMA A;  3HYG A;  4PKQ A;  1ATL A;  4J4M A;  4ON1 A;  1XUC A;  3LQ0 A;  4ZR5 A;  4AIG A;  1CXV A;  1QJJ A;  1XFW A;  3EDI A;  1G49 A;  2CKI A;  4H49 A;  1XFY A;  4L63 A;  1K7Q A;  5B5P A;  5D3C A;  1BKC I;  1ZTQ A;  1XFV A;  2OW1 A;  4IN9 A;  2JT6 A;  4L6T A;  3USN A;  1XFZ A;  4GQL A;  2OXU A;  1ZXC A;  4I35 A;  3AYK A;  3GBO A;  2XS3 A;  3AIG A;  4H3X A;  1QJI A;  2JSD A;  3UVC A;  1O0Q A;  3P1V A;  4L7A A;  1USN A;  1S4B P;  1A86 A;  1GXD A;  4XM6 A;  4DPE A;  2OZR A;  3EDG A;  5B5O A;  2K2G A;  1JIW P;  1HFS A;  1ZXV A;  3K7N A;  1FBL A;  5I12 A;  1KUG A;  3TSK A;  4PKS A;  1ND1 A;  2YUF A;  2OI0 A;  3KRY A;  4PKR A;  1O0T A;  1BKC E;  1BM6 A;  1D8F A;  1FLS A;  5D1S A;  1IAB A;  1SMP A;  2RJQ A;  1BQQ M;  2O36 A;  2QPJ A;  1KUH A;  5I3M A;  4PKT A;  3F17 A;  3KHI A;  1YQY A;  4JP4 A;  4XBH A;  3LUM A;  966C A;  2JNP A;  1A85 A;  4GWN A;  1D7X A;  3EHY A;  4WZV A;  1EUB A;  2OW2 A;  3DL1 A;  4WF6 A;  1K7I A;  2X7M A;  5D7W A;  4WK7 A;  2ERQ A;  4AYK A;  1JAO A;  4GF1 A;  1SRP A;  3O2X A;  3DTK A;  1XFX A;  1WNI A;  2X3C A;  1PWP A;  2L0R A;  1UTT A;  2Y6D A;  1CGF A;  1Z3J A;  3KWV C;  1OO9 A;  1G4K A;  4DV8 A;  1DMT A;  5I4O A;  3VI1 A;  1JAN A;  2PJT A;  2DW2 A;  1C3I A;  2OY4 A;  2MLR A;  2MZH A;  4A7B A;  1KAP P;  3DTE A;  2XS4 A;  1PWV A;  4H76 A;  5I0L A;  3V96 B;  2X3A A;  3EDH A;  3OHO A;  3Q2H A;  2I47 A;  2USN A;  5BOT A;  1R54 A;  3KEC A;  1MMQ A;  4FVL A;  3E8R A;  2E3X A;  3HDA P;  1QIC A;  1GKC A;  4A3W A;  1JAQ A;  3KMC A;  1MMR A;  5L79 A;  3I7I A;  3B8Z A;  3F1A A;  1EAK A;  1AF0 A;  2FV9 A;  1IAA A;  4IUW A;  4JIJ A;  1YCM A;  3NX7 A;  1JAP A;  2J83 A;  2OXW A;  1Q3A A;  1R55 A;  1C7K A;  4G0D A;  1I1I P;  5I43 A;  1PWQ A;  1XFU A;  2Z2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...