4JPAA

Mmp13 in complex with a piperazine hydantoin ligand
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
165
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYHFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Collagenase 3
publication title Hydantoin based inhibitors of MMP13--discovery of AZD6605.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 165
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jpaA00
1C8TA 4DPEA 5CUHA 3DWBA 4WF6A 3B2ZA 3AIGA 3DL1A 966CA 1Y93A 3HDBA 1G49A 2MZHA 4J4MA 1D5JA 2Z2DA 2XS3A 1PWPA 1GE7A 3LJTA 2KRJA 2FV5A 3I7IA 1K7QA 1BSWA 3G42A 1JIZA 2OW1A 5L79A 2E2DA 1KUFA 2WO8A 2K9CA 3KECA 2D1OA 3HY9A 1JAQA 1PWQA 1JKYA 3LE9A 4G0DA 2YB9A 1AF0A 3I7GA 1DTHA 1IACA 1XURA 2ERPA 4GWNA 4GWMA 4GR0A 1ASTA 1C3IA 1DMTA 4PKUA 2QPJA 4H3XA 4QKZA 3OHLA 1IAGA 4I35A 5CZMA 3O2XA 2PJTA 3K7NA 1SRPA 5H8XA 3KWVC 4XM7A 2X3AA 4A7BA 3L0TA 3B8ZA 5I0LA 3LJGA 1D8FA 4EFSA 1ZXVA 1GO7P 2AIGP 1AYKA 4JIJA 2HU6A 2W13A 2FV9A 4L19A 830CA 4H84A 1YCMA 1MMBA 5BOYA 1JJ9A 2WOAA 3F15A 1KUKA 1PWWA 2CLTA 4WK7A 1OS9A 3E8RA 3KRYA 1BQQM 3HDAP 1B3DA 1KBCA 2D1NA 1GXDA 4AUOA 1FM1A 1OM8A 1EAKA 1ROSA 2AYKA 3HY7A 1HTDA 1L6JA 2CKIA 3NX7A 3KEKA 3F18A 1XUDA 1UTZA 3HBUP 1BM6A 5LABA 2K2GA 3RTSA 456CA 1PWUA 5D1SA 4XM8A 3F16A 1R54A 3MA2A 3LILA 3ZUKA 1WNIA 3ZVSA 1QIAA 1RMZA 5I43A 4FU4A 3LMCA 4GF1A 1IAAA 4R3VA 1UMTA 3LQBA 1JH1A 1JIWP 3DPEA 5BOTA 4L6TA 1SU3A 2RJQA 4GUYA 4JPAA 1QUAA 3LUMA 3EHXA 4FXQA 2JT5A 1OS2A 4ILWD 1D7XA 1ZVXA 1S4BP 1GKDA 1ZTQA 1OM6A 1CGFA 3Q2HA 1K7GA 1R1IA 1G4KA 4GR3A 3KMCA 2O36A 2RJPA 1JANA 3EHYA 4L63A 4PKWA 3WV3A 3ZXHA 2WO9A 2V4BA 3LK8A 4HMAA 5B5OA 1EUBA 3OHOA 1EB6A 1OO9A 4AIGA 1BKCE 1MNCA 3DNGA 1YQYA 2X7MA 1XFYA 1CQRA 3TSKA 1ZS0A 2DDFA 1A86A 1HV5A 5D3CA 4XM6A 3AYUA 1YOUA 4IJOA 4IN9A 1O0QA 1KUIA 2DW0A 3LJZA 4H82A 2JT6A 3VTGA 1CGLA 3BA0A 4WKEA 1QJIA 1CK7A 2A8HA 2JNPA 4H30A 2OW9A 1KUGA 2DW1A 3N2VA 5BPAA 2XS4A 4DD8A 3U1RA 3DSLA 2OVXA 4I03A 4G9LA 3TT4A 1QIBA 1HFSA 3F17A 5D2BA 3HBVP 3O64A 5I4OA 1CAQA 1PWVA 1MMRA 4PKQA 2OI0A 3DPFA 1SATA 3WV2A 4XCTA 3ELMA 1BQOA 1IAEA 4H49A 1BIWA 1OMJA 2OXUA 1B8YA 1KAPP 4ZR5A 1GKCA 2OW0A 3HYGA 1Y0VA 1JK3A 2OZRA 2J0TA 1G9KA 1D8MA 1CGEA 5JMYA 4WZVA 2X3CA 3CKIA 4DV8A 3LKAA 5I2ZA 1R55A 1XFWA 4GR8A 1R1HA 2E3XA 3LIKA 3AYKA 5L7FA 3EDGA 4AYKA 1C7KA 4PKRA 1SMPA 1G05A 1ZP5A 4H1QA 1RM8A 5I3MA 1CXVA 4PKTA 1GE6A 3LGPA 1UEAA 1I1IP 2ERQA 1K7IA 2W14A 3EDIA 3P1VA 1BUDA 1J7NA 3K7LA 4ON1A 5D1TA 3B92A 1QJJA 5CXAA 1BKCI 4Q1LA 3TVCA 1CIZA 1I76A 1GO8P 1OM7A 2TCLA 3F19A 4JQGA 2MLSA 2O3EA 1MMPA 1YP1A 2OY4A 2W15A 5D1UA 1MMQA 2W0DA 1Y8JA 2OXZA 3GBOA 1H71P 2EROA 2DDYA 2N8RA 4HX3A 2L0RA 1ZXCA 3KHIA 4FVLA 2OY2A 1G12A 4GQLA 2JIHA 3SHIA 3LEAA 1KUHA 5B5PA 2SRTA 1USNA 2MZEA 1XFUA 2I47A 3USNA 3KEJA 1AKLA 1QICA 3P24A 4FXYP 2YIGA 1XFZA 1A85A 1HY7A 1GE5A 1FBLA 4JA1A 1XUCA 1BKCA 4H76A 4PKSA 1HOVA 1O0TA 5D7WA 1IADA 3L0VA 2OXWA 2X3BA 3EWJA 2Y6CA 2USNA 3WV1A 3LIRA 1XFXA 3LUNA 3KMEA 4AXQA 2W12A 1HFCA 2OW2A 1BZSA 3VI1A 4JP4A 1XFVA 4H2EA 4DF9A 2POJA 1R1JA 1UTTA 1SLMA 4IUWA 1Q3AA 2MLRA 3LQ0A 2MZIA 2Y6DA 1Z3JA 2J83A 3HB2P 3RTTA 4CTHA 1I73A 1FLSA 4A3WA 2DW2A 3TS4A 1IABA 1UMSA 4XBHA 3V96B 1JAPA 3EDZA 1JAOA 2OVZA 3UVCA 3G5CA 3N2UA 3EDHA 3F1AA 4WKIA 1SLNA 1ND1A 3Q2GA 1BUVM 2JSDA 1ATLA 4PKVA 5I12A
chains in the Genus database with same CATH superfamily
1C8TA 4DPEA 5CUHA 3DWBA 4WF6A 2YUFA 3B2ZA 3AIGA 3DL1A 966CA 1Y93A 3HDBA 1G49A 2MZHA 4J4MA 1D5JA 2Z2DA 2XS3A 1PWPA 1GE7A 3LJTA 2KRJA 2FV5A 3I7IA 1K7QA 1BSWA 3G42A 1JIZA 2OW1A 5L79A 2E2DA 1KUFA 2WO8A 2K9CA 3KECA 2D1OA 3HY9A 1JAQA 1PWQA 1JKYA 3LE9A 4G0DA 2YB9A 1AF0A 3I7GA 1DTHA 1IACA 1XURA 2ERPA 4GWNA 4GWMA 4GR0A 1ASTA 1C3IA 1DMTA 4PKUA 2QPJA 4H3XA 4QKZA 3OHLA 1IAGA 4I35A 5CZMA 3O2XA 2PJTA 3K7NA 1SRPA 5H8XA 3KWVC 4XM7A 2X3AA 4A7BA 3L0TA 3B8ZA 5I0LA 3LJGA 1D8FA 4EFSA 1ZXVA 1GO7P 2AIGP 1AYKA 4JIJA 2HU6A 2W13A 2FV9A 4L19A 3DTEA 830CA 4H84A 1YCMA 1MMBA 5BOYA 1JJ9A 2WOAA 3F15A 1KUKA 1PWWA 2CLTA 4WK7A 1OS9A 3E8RA 3KRYA 1BQQM 3HDAP 1B3DA 1KBCA 2D1NA 1GXDA 4AUOA 1FM1A 1OM8A 1EAKA 1ROSA 2AYKA 3HY7A 1HTDA 1L6JA 2CKIA 3NX7A 3KEKA 3F18A 1XUDA 1UTZA 3HBUP 1BM6A 5LABA 2K2GA 3RTSA 456CA 1PWUA 5D1SA 4XM8A 3F16A 1R54A 3MA2A 3LILA 3ZUKA 1WNIA 3ZVSA 1QIAA 1RMZA 5I43A 4FU4A 3LMCA 4GF1A 1IAAA 4R3VA 1UMTA 3LQBA 1JH1A 1JIWP 3DPEA 5BOTA 4L6TA 1SU3A 2RJQA 4GUYA 4JPAA 1QUAA 3LUMA 3EHXA 4FXQA 2JT5A 1OS2A 4ILWD 1D7XA 1ZVXA 1S4BP 1GKDA 1ZTQA 1OM6A 1CGFA 3Q2HA 1K7GA 1R1IA 1G4KA 4GR3A 3KMCA 2O36A 2RJPA 1JANA 3EHYA 4L63A 4PKWA 3DTKA 3WV3A 3ZXHA 2WO9A 2V4BA 3LK8A 4HMAA 5B5OA 1EUBA 3OHOA 1EB6A 1OO9A 4AIGA 1BKCE 1MNCA 3DNGA 1YQYA 2X7MA 1XFYA 1CQRA 3TSKA 1ZS0A 2DDFA 1A86A 1HV5A 5D3CA 4XM6A 3AYUA 1YOUA 4IJOA 4IN9A 1O0QA 1KUIA 2DW0A 3LJZA 4H82A 2JT6A 3VTGA 1CGLA 3BA0A 4WKEA 1QJIA 1CK7A 2A8HA 2JNPA 4H30A 2OW9A 1KUGA 2DW1A 3N2VA 5BPAA 2XS4A 4DD8A 3U1RA 3DSLA 2OVXA 4I03A 4G9LA 3TT4A 1QIBA 1HFSA 3F17A 5D2BA 3HBVP 3O64A 5I4OA 1CAQA 1PWVA 1MMRA 4PKQA 2OI0A 3DPFA 1SATA 3WV2A 4XCTA 3ELMA 1BQOA 1IAEA 4H49A 1BIWA 1OMJA 2OXUA 1B8YA 1KAPP 4ZR5A 1GKCA 2OW0A 3HYGA 1Y0VA 1JK3A 1XM5A 2OZRA 2J0TA 1G9KA 1D8MA 1CGEA 5JMYA 4WZVA 2X3CA 3CKIA 4DV8A 3LKAA 5I2ZA 1R55A 1XFWA 4GR8A 1R1HA 2E3XA 3LIKA 3AYKA 5L7FA 3EDGA 4AYKA 1C7KA 4PKRA 1SMPA 1G05A 1ZP5A 4H1QA 1RM8A 5I3MA 1CXVA 4PKTA 1GE6A 3LGPA 1UEAA 1I1IP 2ERQA 1K7IA 2W14A 3EDIA 3P1VA 1BUDA 1J7NA 3K7LA 4ON1A 5D1TA 3B92A 1QJJA 5CXAA 1BKCI 4Q1LA 3TVCA 1CIZA 1I76A 1GO8P 1OM7A 2TCLA 3F19A 4JQGA 2MLSA 2O3EA 1MMPA 1YP1A 2OY4A 2W15A 5D1UA 1MMQA 2W0DA 1Y8JA 2OXZA 3GBOA 1OZ9A 1H71P 2EROA 2DDYA 4L7AA 2N8RA 4HX3A 2L0RA 1ZXCA 3KHIA 4FVLA 2OY2A 1G12A 4GQLA 2JIHA 3SHIA 3LEAA 1KUHA 5B5PA 2SRTA 1USNA 2MZEA 1XFUA 2I47A 3USNA 3KEJA 1AKLA 1QICA 3P24A 4FXYP 2YIGA 1XFZA 1A85A 1HY7A 1GE5A 1FBLA 4JA1A 1XUCA 1BKCA 4H76A 4PKSA 1HOVA 1O0TA 3DTIA 5D7WA 1IADA 3L0VA 2OXWA 2X3BA 3EWJA 2Y6CA 2USNA 3WV1A 3LIRA 1XFXA 3LUNA 3KMEA 4AXQA 2W12A 1HFCA 2OW2A 1BZSA 3VI1A 4JP4A 1XFVA 4H2EA 4DF9A 2POJA 1R1JA 1UTTA 1SLMA 4IUWA 1Q3AA 2MLRA 3LQ0A 2MZIA 2Y6DA 1Z3JA 2J83A 3HB2P 3RTTA 4CTHA 1I73A 1FLSA 1XAXA 4A3WA 2DW2A 3TS4A 1TVIA 1IABA 1UMSA 4XBHA 3V96B 1JAPA 3EDZA 1JAOA 2OVZA 3UVCA 3G5CA 3N2UA 3EDHA 3F1AA 4WKIA 1SLNA 1ND1A 3Q2GA 1BUVM 2JSDA 1ATLA 4PKVA 5I12A
chains in the Genus database with same CATH topology
1C8TA 4DPEA 5CUHA 3DWBA 4WF6A 2YUFA 3B2ZA 3AIGA 3DL1A 966CA 1Y93A 3HDBA 1G49A 2MZHA 4J4MA 1D5JA 2Z2DA 2XS3A 1PWPA 1GE7A 3LJTA 2KRJA 2FV5A 3I7IA 1K7QA 1BSWA 3G42A 1JIZA 2OW1A 5L79A 2E2DA 1KUFA 2WO8A 2K9CA 3KECA 2D1OA 3HY9A 1JAQA 1PWQA 1JKYA 3LE9A 4G0DA 2YB9A 1AF0A 3I7GA 1DTHA 1IACA 1XURA 2ERPA 4GWNA 4GWMA 4GR0A 1ASTA 1C3IA 1DMTA 4PKUA 2QPJA 4H3XA 4QKZA 3OHLA 1IAGA 4I35A 5CZMA 3O2XA 2PJTA 3K7NA 1SRPA 5H8XA 3KWVC 4XM7A 2X3AA 4A7BA 3L0TA 3B8ZA 5I0LA 3LJGA 1D8FA 4EFSA 1ZXVA 1GO7P 2AIGP 1AYKA 4JIJA 2HU6A 2W13A 2FV9A 4L19A 3DTEA 830CA 4H84A 1YCMA 1MMBA 5BOYA 1JJ9A 2WOAA 3F15A 1KUKA 1PWWA 2CLTA 4WK7A 1OS9A 3E8RA 3KRYA 1BQQM 3HDAP 1B3DA 1KBCA 2D1NA 1GXDA 4AUOA 1FM1A 1OM8A 1EAKA 1ROSA 2AYKA 3HY7A 1HTDA 1L6JA 2CKIA 3NX7A 3KEKA 3F18A 1XUDA 1UTZA 3HBUP 1BM6A 5LABA 2K2GA 3RTSA 456CA 1PWUA 5D1SA 4XM8A 3F16A 1R54A 3MA2A 3LILA 3ZUKA 1WNIA 3ZVSA 1QIAA 1RMZA 5I43A 4FU4A 3LMCA 4GF1A 1IAAA 4R3VA 1UMTA 3LQBA 1JH1A 1JIWP 3DPEA 5BOTA 4L6TA 1SU3A 2RJQA 4GUYA 4JPAA 1QUAA 3LUMA 3EHXA 4FXQA 2JT5A 1OS2A 4ILWD 1D7XA 1ZVXA 1S4BP 1GKDA 1ZTQA 1OM6A 1CGFA 3Q2HA 1K7GA 1R1IA 1G4KA 4GR3A 3KMCA 2O36A 2RJPA 1JANA 3EHYA 4L63A 4PKWA 3DTKA 3WV3A 3ZXHA 2WO9A 2V4BA 3LK8A 4HMAA 5B5OA 1EUBA 3OHOA 1EB6A 1OO9A 4AIGA 1BKCE 1MNCA 3DNGA 1YQYA 2X7MA 1XFYA 1CQRA 3TSKA 1ZS0A 2DDFA 1A86A 1HV5A 5D3CA 4XM6A 3AYUA 1YOUA 4IJOA 4IN9A 1O0QA 1KUIA 2DW0A 3LJZA 4H82A 2JT6A 3VTGA 1CGLA 3BA0A 4WKEA 1QJIA 1CK7A 2A8HA 2JNPA 4H30A 2OW9A 1KUGA 2DW1A 3N2VA 5BPAA 2XS4A 4DD8A 3U1RA 3DSLA 2OVXA 4I03A 4G9LA 3TT4A 1QIBA 1HFSA 3F17A 5D2BA 3HBVP 3O64A 5I4OA 1CAQA 1PWVA 1MMRA 4PKQA 2OI0A 3DPFA 1SATA 3WV2A 4XCTA 3ELMA 1BQOA 1IAEA 4H49A 1BIWA 1OMJA 2OXUA 1B8YA 1KAPP 4ZR5A 1GKCA 2OW0A 3HYGA 1Y0VA 1JK3A 2OZRA 2J0TA 1G9KA 1D8MA 1CGEA 5JMYA 4WZVA 2X3CA 3CKIA 4DV8A 3LKAA 5I2ZA 1R55A 1XFWA 4GR8A 1R1HA 2E3XA 3LIKA 3AYKA 5L7FA 3EDGA 4AYKA 1C7KA 4PKRA 1SMPA 1G05A 1ZP5A 4H1QA 1RM8A 5I3MA 1CXVA 4PKTA 1GE6A 3LGPA 1UEAA 1I1IP 2ERQA 1K7IA 2W14A 3EDIA 3P1VA 1BUDA 1J7NA 3K7LA 4ON1A 5D1TA 3B92A 1QJJA 5CXAA 1BKCI 4Q1LA 3TVCA 1CIZA 1I76A 1GO8P 1OM7A 2TCLA 3F19A 4JQGA 2MLSA 2O3EA 1MMPA 1YP1A 2OY4A 2W15A 5D1UA 1MMQA 2W0DA 1Y8JA 2OXZA 3GBOA 1H71P 2EROA 2DDYA 4L7AA 2N8RA 4HX3A 2L0RA 1ZXCA 3KHIA 4FVLA 2OY2A 1G12A 4GQLA 2JIHA 3SHIA 3LEAA 1KUHA 5B5PA 2SRTA 1USNA 2MZEA 1XFUA 2I47A 3USNA 3KEJA 1AKLA 1QICA 3P24A 4FXYP 2YIGA 1XFZA 1A85A 1HY7A 1GE5A 1FBLA 4JA1A 1XUCA 1BKCA 4H76A 4PKSA 1HOVA 1O0TA 3DTIA 5D7WA 1IADA 3L0VA 2OXWA 2X3BA 3EWJA 2Y6CA 2USNA 3WV1A 3LIRA 1XFXA 3LUNA 3KMEA 4AXQA 2W12A 1HFCA 2OW2A 1BZSA 3VI1A 4JP4A 1XFVA 4H2EA 4DF9A 2POJA 1R1JA 1UTTA 1SLMA 4IUWA 1Q3AA 2MLRA 3LQ0A 2MZIA 2Y6DA 1Z3JA 2J83A 3HB2P 3RTTA 4CTHA 1I73A 1FLSA 4A3WA 2DW2A 3TS4A 1IABA 1UMSA 4XBHA 3V96B 1JAPA 3EDZA 1JAOA 2OVZA 3UVCA 3G5CA 3N2UA 3EDHA 3F1AA 4WKIA 1SLNA 1ND1A 3Q2GA 1BUVM 2JSDA 1ATLA 4PKVA 5I12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C8T A;  4DPE A;  5CUH A;  3DWB A;  4WF6 A;  3B2Z A;  3AIG A;  3DL1 A;  966C A;  1Y93 A;  3HDB A;  1G49 A;  2MZH A;  4J4M A;  1D5J A;  2Z2D A;  2XS3 A;  1PWP A;  1GE7 A;  3LJT A;  2KRJ A;  2FV5 A;  3I7I A;  1K7Q A;  1BSW A;  3G42 A;  1JIZ A;  2OW1 A;  5L79 A;  2E2D A;  1KUF A;  2WO8 A;  2K9C A;  3KEC A;  2D1O A;  3HY9 A;  1JAQ A;  1PWQ A;  1JKY A;  3LE9 A;  4G0D A;  2YB9 A;  1AF0 A;  3I7G A;  1DTH A;  1IAC A;  1XUR A;  2ERP A;  4GWN A;  4GWM A;  4GR0 A;  1AST A;  1C3I A;  1DMT A;  4PKU A;  2QPJ A;  4H3X A;  4QKZ A;  3OHL A;  1IAG A;  4I35 A;  5CZM A;  3O2X A;  2PJT A;  3K7N A;  1SRP A;  5H8X A;  3KWV C;  4XM7 A;  2X3A A;  4A7B A;  3L0T A;  3B8Z A;  5I0L A;  3LJG A;  1D8F A;  4EFS A;  1ZXV A;  1GO7 P;  2AIG P;  1AYK A;  4JIJ A;  2HU6 A;  2W13 A;  2FV9 A;  4L19 A;  830C A;  4H84 A;  1YCM A;  1MMB A;  5BOY A;  1JJ9 A;  2WOA A;  3F15 A;  1KUK A;  1PWW A;  2CLT A;  4WK7 A;  1OS9 A;  3E8R A;  3KRY A;  1BQQ M;  3HDA P;  1B3D A;  1KBC A;  2D1N A;  1GXD A;  4AUO A;  1FM1 A;  1OM8 A;  1EAK A;  1ROS A;  2AYK A;  3HY7 A;  1HTD A;  1L6J A;  2CKI A;  3NX7 A;  3KEK A;  3F18 A;  1XUD A;  1UTZ A;  3HBU P;  1BM6 A;  5LAB A;  2K2G A;  3RTS A;  456C A;  1PWU A;  5D1S A;  4XM8 A;  3F16 A;  1R54 A;  3MA2 A;  3LIL A;  3ZUK A;  1WNI A;  3ZVS A;  1QIA A;  1RMZ A;  5I43 A;  4FU4 A;  3LMC A;  4GF1 A;  1IAA A;  4R3V A;  1UMT A;  3LQB A;  1JH1 A;  1JIW P;  3DPE A;  5BOT A;  4L6T A;  1SU3 A;  2RJQ A;  4GUY A;  4JPA A;  1QUA A;  3LUM A;  3EHX A;  4FXQ A;  2JT5 A;  1OS2 A;  4ILW D;  1D7X A;  1ZVX A;  1S4B P;  1GKD A;  1ZTQ A;  1OM6 A;  1CGF A;  3Q2H A;  1K7G A;  1R1I A;  1G4K A;  4GR3 A;  3KMC A;  2O36 A;  2RJP A;  1JAN A;  3EHY A;  4L63 A;  4PKW A;  3WV3 A;  3ZXH A;  2WO9 A;  2V4B A;  3LK8 A;  4HMA A;  5B5O A;  1EUB A;  3OHO A;  1EB6 A;  1OO9 A;  4AIG A;  1BKC E;  1MNC A;  3DNG A;  1YQY A;  2X7M A;  1XFY A;  1CQR A;  3TSK A;  1ZS0 A;  2DDF A;  1A86 A;  1HV5 A;  5D3C A;  4XM6 A;  3AYU A;  1YOU A;  4IJO A;  4IN9 A;  1O0Q A;  1KUI A;  2DW0 A;  3LJZ A;  4H82 A;  2JT6 A;  3VTG A;  1CGL A;  3BA0 A;  4WKE A;  1QJI A;  1CK7 A;  2A8H A;  2JNP A;  4H30 A;  2OW9 A;  1KUG A;  2DW1 A;  3N2V A;  5BPA A;  2XS4 A;  4DD8 A;  3U1R A;  3DSL A;  2OVX A;  4I03 A;  4G9L A;  3TT4 A;  1QIB A;  1HFS A;  3F17 A;  5D2B A;  3HBV P;  3O64 A;  5I4O A;  1CAQ A;  1PWV A;  1MMR A;  4PKQ A;  2OI0 A;  3DPF A;  1SAT A;  3WV2 A;  4XCT A;  3ELM A;  1BQO A;  1IAE A;  4H49 A;  1BIW A;  1OMJ A;  2OXU A;  1B8Y A;  1KAP P;  4ZR5 A;  1GKC A;  2OW0 A;  3HYG A;  1Y0V A;  1JK3 A;  2OZR A;  2J0T A;  1G9K A;  1D8M A;  1CGE A;  5JMY A;  4WZV A;  2X3C A;  3CKI A;  4DV8 A;  3LKA A;  5I2Z A;  1R55 A;  1XFW A;  4GR8 A;  1R1H A;  2E3X A;  3LIK A;  3AYK A;  5L7F A;  3EDG A;  4AYK A;  1C7K A;  4PKR A;  1SMP A;  1G05 A;  1ZP5 A;  4H1Q A;  1RM8 A;  5I3M A;  1CXV A;  4PKT A;  1GE6 A;  3LGP A;  1UEA A;  1I1I P;  2ERQ A;  1K7I A;  2W14 A;  3EDI A;  3P1V A;  1BUD A;  1J7N A;  3K7L A;  4ON1 A;  5D1T A;  3B92 A;  1QJJ A;  5CXA A;  1BKC I;  4Q1L A;  3TVC A;  1CIZ A;  1I76 A;  1GO8 P;  1OM7 A;  2TCL A;  3F19 A;  4JQG A;  2MLS A;  2O3E A;  1MMP A;  1YP1 A;  2OY4 A;  2W15 A;  5D1U A;  1MMQ A;  2W0D A;  1Y8J A;  2OXZ A;  3GBO A;  1H71 P;  2ERO A;  2DDY A;  2N8R A;  4HX3 A;  2L0R A;  1ZXC A;  3KHI A;  4FVL A;  2OY2 A;  1G12 A;  4GQL A;  2JIH A;  3SHI A;  3LEA A;  1KUH A;  5B5P A;  2SRT A;  1USN A;  2MZE A;  1XFU A;  2I47 A;  3USN A;  3KEJ A;  1AKL A;  1QIC A;  3P24 A;  4FXY P;  2YIG A;  1XFZ A;  1A85 A;  1HY7 A;  1GE5 A;  1FBL A;  4JA1 A;  1XUC A;  1BKC A;  4H76 A;  4PKS A;  1HOV A;  1O0T A;  5D7W A;  1IAD A;  3L0V A;  2OXW A;  2X3B A;  3EWJ A;  2Y6C A;  2USN A;  3WV1 A;  3LIR A;  1XFX A;  3LUN A;  3KME A;  4AXQ A;  2W12 A;  1HFC A;  2OW2 A;  1BZS A;  3VI1 A;  4JP4 A;  1XFV A;  4H2E A;  4DF9 A;  2POJ A;  1R1J A;  1UTT A;  1SLM A;  4IUW A;  1Q3A A;  2MLR A;  3LQ0 A;  2MZI A;  2Y6D A;  1Z3J A;  2J83 A;  3HB2 P;  3RTT A;  4CTH A;  1I73 A;  1FLS A;  4A3W A;  2DW2 A;  3TS4 A;  1IAB A;  1UMS A;  4XBH A;  3V96 B;  1JAP A;  3EDZ A;  1JAO A;  2OVZ A;  3UVC A;  3G5C A;  3N2U A;  3EDH A;  3F1A A;  4WKI A;  1SLN A;  1ND1 A;  3Q2G A;  1BUV M;  2JSD A;  1ATL A;  4PKV A;  5I12 A; 
#chains in the Genus database with same CATH topology
 1C8T A;  4DPE A;  5CUH A;  3DWB A;  4WF6 A;  2YUF A;  3B2Z A;  3AIG A;  3DL1 A;  966C A;  1Y93 A;  3HDB A;  1G49 A;  2MZH A;  4J4M A;  1D5J A;  2Z2D A;  2XS3 A;  1PWP A;  1GE7 A;  3LJT A;  2KRJ A;  2FV5 A;  3I7I A;  1K7Q A;  1BSW A;  3G42 A;  1JIZ A;  2OW1 A;  5L79 A;  2E2D A;  1KUF A;  2WO8 A;  2K9C A;  3KEC A;  2D1O A;  3HY9 A;  1JAQ A;  1PWQ A;  1JKY A;  3LE9 A;  4G0D A;  2YB9 A;  1AF0 A;  3I7G A;  1DTH A;  1IAC A;  1XUR A;  2ERP A;  4GWN A;  4GWM A;  4GR0 A;  1AST A;  1C3I A;  1DMT A;  4PKU A;  2QPJ A;  4H3X A;  4QKZ A;  3OHL A;  1IAG A;  4I35 A;  5CZM A;  3O2X A;  2PJT A;  3K7N A;  1SRP A;  5H8X A;  3KWV C;  4XM7 A;  2X3A A;  4A7B A;  3L0T A;  3B8Z A;  5I0L A;  3LJG A;  1D8F A;  4EFS A;  1ZXV A;  1GO7 P;  2AIG P;  1AYK A;  4JIJ A;  2HU6 A;  2W13 A;  2FV9 A;  4L19 A;  3DTE A;  830C A;  4H84 A;  1YCM A;  1MMB A;  5BOY A;  1JJ9 A;  2WOA A;  3F15 A;  1KUK A;  1PWW A;  2CLT A;  4WK7 A;  1OS9 A;  3E8R A;  3KRY A;  1BQQ M;  3HDA P;  1B3D A;  1KBC A;  2D1N A;  1GXD A;  4AUO A;  1FM1 A;  1OM8 A;  1EAK A;  1ROS A;  2AYK A;  3HY7 A;  1HTD A;  1L6J A;  2CKI A;  3NX7 A;  3KEK A;  3F18 A;  1XUD A;  1UTZ A;  3HBU P;  1BM6 A;  5LAB A;  2K2G A;  3RTS A;  456C A;  1PWU A;  5D1S A;  4XM8 A;  3F16 A;  1R54 A;  3MA2 A;  3LIL A;  3ZUK A;  1WNI A;  3ZVS A;  1QIA A;  1RMZ A;  5I43 A;  4FU4 A;  3LMC A;  4GF1 A;  1IAA A;  4R3V A;  1UMT A;  3LQB A;  1JH1 A;  1JIW P;  3DPE A;  5BOT A;  4L6T A;  1SU3 A;  2RJQ A;  4GUY A;  4JPA A;  1QUA A;  3LUM A;  3EHX A;  4FXQ A;  2JT5 A;  1OS2 A;  4ILW D;  1D7X A;  1ZVX A;  1S4B P;  1GKD A;  1ZTQ A;  1OM6 A;  1CGF A;  3Q2H A;  1K7G A;  1R1I A;  1G4K A;  4GR3 A;  3KMC A;  2O36 A;  2RJP A;  1JAN A;  3EHY A;  4L63 A;  4PKW A;  3DTK A;  3WV3 A;  3ZXH A;  2WO9 A;  2V4B A;  3LK8 A;  4HMA A;  5B5O A;  1EUB A;  3OHO A;  1EB6 A;  1OO9 A;  4AIG A;  1BKC E;  1MNC A;  3DNG A;  1YQY A;  2X7M A;  1XFY A;  1CQR A;  3TSK A;  1ZS0 A;  2DDF A;  1A86 A;  1HV5 A;  5D3C A;  4XM6 A;  3AYU A;  1YOU A;  4IJO A;  4IN9 A;  1O0Q A;  1KUI A;  2DW0 A;  3LJZ A;  4H82 A;  2JT6 A;  3VTG A;  1CGL A;  3BA0 A;  4WKE A;  1QJI A;  1CK7 A;  2A8H A;  2JNP A;  4H30 A;  2OW9 A;  1KUG A;  2DW1 A;  3N2V A;  5BPA A;  2XS4 A;  4DD8 A;  3U1R A;  3DSL A;  2OVX A;  4I03 A;  4G9L A;  3TT4 A;  1QIB A;  1HFS A;  3F17 A;  5D2B A;  3HBV P;  3O64 A;  5I4O A;  1CAQ A;  1PWV A;  1MMR A;  4PKQ A;  2OI0 A;  3DPF A;  1SAT A;  3WV2 A;  4XCT A;  3ELM A;  1BQO A;  1IAE A;  4H49 A;  1BIW A;  1OMJ A;  2OXU A;  1B8Y A;  1KAP P;  4ZR5 A;  1GKC A;  2OW0 A;  3HYG A;  1Y0V A;  1JK3 A;  1XM5 A;  2OZR A;  2J0T A;  1G9K A;  1D8M A;  1CGE A;  5JMY A;  4WZV A;  2X3C A;  3CKI A;  4DV8 A;  3LKA A;  5I2Z A;  1R55 A;  1XFW A;  4GR8 A;  1R1H A;  2E3X A;  3LIK A;  3AYK A;  5L7F A;  3EDG A;  4AYK A;  1C7K A;  4PKR A;  1SMP A;  1G05 A;  1ZP5 A;  4H1Q A;  1RM8 A;  5I3M A;  1CXV A;  4PKT A;  1GE6 A;  3LGP A;  1UEA A;  1I1I P;  2ERQ A;  1K7I A;  2W14 A;  3EDI A;  3P1V A;  1BUD A;  1J7N A;  3K7L A;  4ON1 A;  5D1T A;  3B92 A;  1QJJ A;  5CXA A;  1BKC I;  4Q1L A;  3TVC A;  1CIZ A;  1I76 A;  1GO8 P;  1OM7 A;  2TCL A;  3F19 A;  4JQG A;  2MLS A;  2O3E A;  1MMP A;  1YP1 A;  2OY4 A;  2W15 A;  5D1U A;  1MMQ A;  2W0D A;  1Y8J A;  2OXZ A;  3GBO A;  1OZ9 A;  1H71 P;  2ERO A;  2DDY A;  4L7A A;  2N8R A;  4HX3 A;  2L0R A;  1ZXC A;  3KHI A;  4FVL A;  2OY2 A;  1G12 A;  4GQL A;  2JIH A;  3SHI A;  3LEA A;  1KUH A;  5B5P A;  2SRT A;  1USN A;  2MZE A;  1XFU A;  2I47 A;  3USN A;  3KEJ A;  1AKL A;  1QIC A;  3P24 A;  4FXY P;  2YIG A;  1XFZ A;  1A85 A;  1HY7 A;  1GE5 A;  1FBL A;  4JA1 A;  1XUC A;  1BKC A;  4H76 A;  4PKS A;  1HOV A;  1O0T A;  3DTI A;  5D7W A;  1IAD A;  3L0V A;  2OXW A;  2X3B A;  3EWJ A;  2Y6C A;  2USN A;  3WV1 A;  3LIR A;  1XFX A;  3LUN A;  3KME A;  4AXQ A;  2W12 A;  1HFC A;  2OW2 A;  1BZS A;  3VI1 A;  4JP4 A;  1XFV A;  4H2E A;  4DF9 A;  2POJ A;  1R1J A;  1UTT A;  1SLM A;  4IUW A;  1Q3A A;  2MLR A;  3LQ0 A;  2MZI A;  2Y6D A;  1Z3J A;  2J83 A;  3HB2 P;  3RTT A;  4CTH A;  1I73 A;  1FLS A;  1XAX A;  4A3W A;  2DW2 A;  3TS4 A;  1TVI A;  1IAB A;  1UMS A;  4XBH A;  3V96 B;  1JAP A;  3EDZ A;  1JAO A;  2OVZ A;  3UVC A;  3G5C A;  3N2U A;  3EDH A;  3F1A A;  4WKI A;  1SLN A;  1ND1 A;  3Q2G A;  1BUV M;  2JSD A;  1ATL A;  4PKV A;  5I12 A; 
#chains in the Genus database with same CATH homology
 1C8T A;  4DPE A;  5CUH A;  3DWB A;  4WF6 A;  2YUF A;  3B2Z A;  3AIG A;  3DL1 A;  966C A;  1Y93 A;  3HDB A;  1G49 A;  2MZH A;  4J4M A;  1D5J A;  2Z2D A;  2XS3 A;  1PWP A;  1GE7 A;  3LJT A;  2KRJ A;  2FV5 A;  3I7I A;  1K7Q A;  1BSW A;  3G42 A;  1JIZ A;  2OW1 A;  5L79 A;  2E2D A;  1KUF A;  2WO8 A;  2K9C A;  3KEC A;  2D1O A;  3HY9 A;  1JAQ A;  1PWQ A;  1JKY A;  3LE9 A;  4G0D A;  2YB9 A;  1AF0 A;  3I7G A;  1DTH A;  1IAC A;  1XUR A;  2ERP A;  4GWN A;  4GWM A;  4GR0 A;  1AST A;  1C3I A;  1DMT A;  4PKU A;  2QPJ A;  4H3X A;  4QKZ A;  3OHL A;  1IAG A;  4I35 A;  5CZM A;  3O2X A;  2PJT A;  3K7N A;  1SRP A;  5H8X A;  3KWV C;  4XM7 A;  2X3A A;  4A7B A;  3L0T A;  3B8Z A;  5I0L A;  3LJG A;  1D8F A;  4EFS A;  1ZXV A;  1GO7 P;  2AIG P;  1AYK A;  4JIJ A;  2HU6 A;  2W13 A;  2FV9 A;  4L19 A;  3DTE A;  830C A;  4H84 A;  1YCM A;  1MMB A;  5BOY A;  1JJ9 A;  2WOA A;  3F15 A;  1KUK A;  1PWW A;  2CLT A;  4WK7 A;  1OS9 A;  3E8R A;  3KRY A;  1BQQ M;  3HDA P;  1B3D A;  1KBC A;  2D1N A;  1GXD A;  4AUO A;  1FM1 A;  1OM8 A;  1EAK A;  1ROS A;  2AYK A;  3HY7 A;  1HTD A;  1L6J A;  2CKI A;  3NX7 A;  3KEK A;  3F18 A;  1XUD A;  1UTZ A;  3HBU P;  1BM6 A;  5LAB A;  2K2G A;  3RTS A;  456C A;  1PWU A;  5D1S A;  4XM8 A;  3F16 A;  1R54 A;  3MA2 A;  3LIL A;  3ZUK A;  1WNI A;  3ZVS A;  1QIA A;  1RMZ A;  5I43 A;  4FU4 A;  3LMC A;  4GF1 A;  1IAA A;  4R3V A;  1UMT A;  3LQB A;  1JH1 A;  1JIW P;  3DPE A;  5BOT A;  4L6T A;  1SU3 A;  2RJQ A;  4GUY A;  4JPA A;  1QUA A;  3LUM A;  3EHX A;  4FXQ A;  2JT5 A;  1OS2 A;  4ILW D;  1D7X A;  1ZVX A;  1S4B P;  1GKD A;  1ZTQ A;  1OM6 A;  1CGF A;  3Q2H A;  1K7G A;  1R1I A;  1G4K A;  4GR3 A;  3KMC A;  2O36 A;  2RJP A;  1JAN A;  3EHY A;  4L63 A;  4PKW A;  3DTK A;  3WV3 A;  3ZXH A;  2WO9 A;  2V4B A;  3LK8 A;  4HMA A;  5B5O A;  1EUB A;  3OHO A;  1EB6 A;  1OO9 A;  4AIG A;  1BKC E;  1MNC A;  3DNG A;  1YQY A;  2X7M A;  1XFY A;  1CQR A;  3TSK A;  1ZS0 A;  2DDF A;  1A86 A;  1HV5 A;  5D3C A;  4XM6 A;  3AYU A;  1YOU A;  4IJO A;  4IN9 A;  1O0Q A;  1KUI A;  2DW0 A;  3LJZ A;  4H82 A;  2JT6 A;  3VTG A;  1CGL A;  3BA0 A;  4WKE A;  1QJI A;  1CK7 A;  2A8H A;  2JNP A;  4H30 A;  2OW9 A;  1KUG A;  2DW1 A;  3N2V A;  5BPA A;  2XS4 A;  4DD8 A;  3U1R A;  3DSL A;  2OVX A;  4I03 A;  4G9L A;  3TT4 A;  1QIB A;  1HFS A;  3F17 A;  5D2B A;  3HBV P;  3O64 A;  5I4O A;  1CAQ A;  1PWV A;  1MMR A;  4PKQ A;  2OI0 A;  3DPF A;  1SAT A;  3WV2 A;  4XCT A;  3ELM A;  1BQO A;  1IAE A;  4H49 A;  1BIW A;  1OMJ A;  2OXU A;  1B8Y A;  1KAP P;  4ZR5 A;  1GKC A;  2OW0 A;  3HYG A;  1Y0V A;  1JK3 A;  2OZR A;  2J0T A;  1G9K A;  1D8M A;  1CGE A;  5JMY A;  4WZV A;  2X3C A;  3CKI A;  4DV8 A;  3LKA A;  5I2Z A;  1R55 A;  1XFW A;  4GR8 A;  1R1H A;  2E3X A;  3LIK A;  3AYK A;  5L7F A;  3EDG A;  4AYK A;  1C7K A;  4PKR A;  1SMP A;  1G05 A;  1ZP5 A;  4H1Q A;  1RM8 A;  5I3M A;  1CXV A;  4PKT A;  1GE6 A;  3LGP A;  1UEA A;  1I1I P;  2ERQ A;  1K7I A;  2W14 A;  3EDI A;  3P1V A;  1BUD A;  1J7N A;  3K7L A;  4ON1 A;  5D1T A;  3B92 A;  1QJJ A;  5CXA A;  1BKC I;  4Q1L A;  3TVC A;  1CIZ A;  1I76 A;  1GO8 P;  1OM7 A;  2TCL A;  3F19 A;  4JQG A;  2MLS A;  2O3E A;  1MMP A;  1YP1 A;  2OY4 A;  2W15 A;  5D1U A;  1MMQ A;  2W0D A;  1Y8J A;  2OXZ A;  3GBO A;  1H71 P;  2ERO A;  2DDY A;  4L7A A;  2N8R A;  4HX3 A;  2L0R A;  1ZXC A;  3KHI A;  4FVL A;  2OY2 A;  1G12 A;  4GQL A;  2JIH A;  3SHI A;  3LEA A;  1KUH A;  5B5P A;  2SRT A;  1USN A;  2MZE A;  1XFU A;  2I47 A;  3USN A;  3KEJ A;  1AKL A;  1QIC A;  3P24 A;  4FXY P;  2YIG A;  1XFZ A;  1A85 A;  1HY7 A;  1GE5 A;  1FBL A;  4JA1 A;  1XUC A;  1BKC A;  4H76 A;  4PKS A;  1HOV A;  1O0T A;  3DTI A;  5D7W A;  1IAD A;  3L0V A;  2OXW A;  2X3B A;  3EWJ A;  2Y6C A;  2USN A;  3WV1 A;  3LIR A;  1XFX A;  3LUN A;  3KME A;  4AXQ A;  2W12 A;  1HFC A;  2OW2 A;  1BZS A;  3VI1 A;  4JP4 A;  1XFV A;  4H2E A;  4DF9 A;  2POJ A;  1R1J A;  1UTT A;  1SLM A;  4IUW A;  1Q3A A;  2MLR A;  3LQ0 A;  2MZI A;  2Y6D A;  1Z3J A;  2J83 A;  3HB2 P;  3RTT A;  4CTH A;  1I73 A;  1FLS A;  4A3W A;  2DW2 A;  3TS4 A;  1IAB A;  1UMS A;  4XBH A;  3V96 B;  1JAP A;  3EDZ A;  1JAO A;  2OVZ A;  3UVC A;  3G5C A;  3N2U A;  3EDH A;  3F1A A;  4WKI A;  1SLN A;  1ND1 A;  3Q2G A;  1BUV M;  2JSD A;  1ATL A;  4PKV A;  5I12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...