3I7IA

Mmp-13 in complex with a non zinc-chelating inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
165
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Improving potency and selectivity of a new class of non-Zn-chelating MMP-13 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 165
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3i7iA00
1XUCA 2Y6DA 1IAEA 3Q2HA 3LIKA 2N8RA 2E2DA 1R54A 4PKUA 3EHYA 1AKLA 4XM6A 1MMPA 2DDFA 1EAKA 2DW0A 3HDAP 2I47A 4DD8A 1D5JA 4DPEA 1I76A 1G9KA 3EHXA 2OY2A 2OVXA 2MLSA 4L63A 1XFXA 5L7FA 4AYKA 4ON1A 1EB6A 2WO9A 1Y93A 4GR3A 4WKIA 4AUOA 5D2BA 4XBHA 1CGEA 5BOTA 5BOYA 3EWJA 3DNGA 1BUVM 4PKRA 1AF0A 1RM8A 1O0QA 2AYKA 2ERQA 5D1UA 2MZHA 3O2XA 4G0DA 1ASTA 1GE7A 1IAAA 4H1QA 1OM8A 1XFVA 2CKIA 1ZTQA 1SATA 5L79A 3HBUP 4A3WA 4JIJA 5B5OA 1PWUA 3I7IA 1G49A 1GKCA 1R1JA 2YB9A 2OXUA 2X3CA 4WKEA 2Y6CA 4XM8A 3KMEA 1BKCE 1ROSA 3KECA 1EUBA 3G42A 1QJIA 1MMBA 2X7MA 1PWVA 1XURA 2JT5A 1HOVA 1KUHA 4WF6A 4GWMA 3P1VA 4XM7A 966CA 5I4OA 1YP1A 2K9CA 3DL1A 1XFUA 1CGLA 3F1AA 4PKTA 4FVLA 2FV5A 2PJTA 2W15A 1I1IP 3LUMA 4FXQA 4H76A 1FM1A 1OM6A 1HFCA 1MMQA 2O36A 1B8YA 3Q2GA 1HFSA 3B2ZA 3RTSA 456CA 1KBCA 4DF9A 3WV2A 2OVZA 4WK7A 2K2GA 3G5CA 1C8TA 3F16A 4I03A 5CXAA 1R1HA 2D1OA 5I2ZA 2OZRA 1KUKA 4GR0A 1BZSA 2XS3A 3CKIA 4PKVA 1C7KA 1RMZA 4PKSA 2D1NA 3LUNA 1YQYA 2J0TA 2OXWA 3LKAA 2X3AA 3LGPA 1GXDA 3TVCA 3MA2A 4ZR5A 1XUDA 1Y0VA 2OW2A 1GE5A 3GBOA 4H30A 2JT6A 1PWWA 1CGFA 1YOUA 1BUDA 1BIWA 4I35A 5CUHA 1HV5A 5CZMA 1OS2A 2AIGP 1ZXVA 3LJTA 2JSDA 1IAGA 2MZIA 2EROA 1UMSA 3ZVSA 1QJJA 3KWVC 3O64A 3TS4A 4JQGA 1DMTA 1JIWP 3ZXHA 4G9LA 3ZUKA 1JAPA 1H71P 3WV1A 1L6JA 2J83A 1JJ9A 1BM6A 2OW9A 4AXQA 1GKDA 4IJOA 3B8ZA 3KMCA 5BPAA 5JMYA 4GF1A 3HBVP 1C3IA 3ELMA 1SU3A 4ILWD 5D3CA 4L6TA 4EFSA 3KHIA 4FU4A 4H2EA 3DPEA 3TT4A 5I0LA 2A8HA 1YCMA 1OMJA 3HYGA 2DW1A 1SLNA 3LK8A 1USNA 1Q3AA 2USNA 4JPAA 1R55A 2WOAA 1FLSA 1JAQA 1AYKA 1UEAA 4Q1LA 3AYKA 4AIGA 3LJZA 3OHOA 2X3BA 3USNA 2O3EA 1DTHA 3LQBA 1CAQA 4H3XA 3F19A 5D1SA 3NX7A 3KEJA 1PWPA 1SMPA 1S4BP 2TCLA 3L0VA 3LILA 1R1IA 2CLTA 2E3XA 3I7GA 4GWNA 3UVCA 3N2VA 4H49A 1J7NA 3OHLA 2OW1A 2XS4A 3F18A 2MZEA 4PKQA 3VTGA 1CIZA 1A86A 1QICA 3F17A 1G12A 2SRTA 3HDBA 1SLMA 3AIGA 5I3MA 1UTZA 2MLRA 1HY7A 1BQQM 3HY9A 1K7QA 2OXZA 5B5PA 3EDGA 3TSKA 1K7IA 2W14A 2W0DA 4L19A 2JIHA 1CQRA 5H8XA 4HMAA 1BKCA 1UMTA 3E8RA 4JP4A 2W13A 3K7NA 1GO8P 2FV9A 2DDYA 1JAOA 1MNCA 1IADA 1CK7A 1Y8JA 3K7LA 1JK3A 4JA1A 5I43A 4QKZA 2OI0A 5I12A 4GR8A 1KUGA 4GQLA 3P24A 2JNPA 1SRPA 2YIGA 3HB2P 1D8MA 1K7GA 3V96B 3VI1A 1I73A 1JIZA 2W12A 4CTHA 3EDZA 5LABA 1IACA 3EDIA 1GE6A 2KRJA 1BSWA 2ERPA 1B3DA 3DWBA 1BKCI 1QUAA 3N2UA 1Z3JA 1BQOA 2RJQA 1XFWA 4GUYA 3LEAA 1CXVA 3AYUA 4IN9A 4HX3A 1OO9A 1ZS0A 3KRYA 2POJA 3HY7A 3KEKA 2DW2A 1JKYA 4FXYP 3DPFA 2RJPA 3WV3A 1KUFA 2L0RA 1JH1A 5D1TA 1JANA 2Z2DA 1OM7A 3BA0A 1UTTA 1FBLA 4XCTA 1ND1A 4DV8A 1D7XA 1KAPP 4H84A 3RTTA 2OW0A 3LIRA 1GO7P 1XFZA 4PKWA 4R3VA 830CA 1IABA 4A7BA 1QIAA 1ZP5A 1QIBA 3LE9A 3SHIA 1PWQA 3LJGA 4J4MA 3F15A 3U1RA 2QPJA 1ATLA 5D7WA 1G4KA 4WZVA 2WO8A 1OS9A 1O0TA 3DSLA 3EDHA 1A85A 1G05A 1WNIA 3L0TA 2V4BA 2HU6A 1ZXCA 2OY4A 3LQ0A 4IUWA 1D8FA 1XFYA 1KUIA 3B92A 1HTDA 1ZVXA 4H82A 3LMCA 1MMRA
chains in the Genus database with same CATH superfamily
1XUCA 2Y6DA 1IAEA 3Q2HA 3LIKA 2N8RA 2E2DA 1R54A 4PKUA 3EHYA 1AKLA 4XM6A 1MMPA 2DDFA 1EAKA 2DW0A 3HDAP 2I47A 4DD8A 1D5JA 4DPEA 1I76A 1G9KA 3EHXA 2OY2A 2OVXA 2MLSA 4L63A 1XFXA 5L7FA 4AYKA 4ON1A 1EB6A 2WO9A 1Y93A 4GR3A 4WKIA 4AUOA 5D2BA 4XBHA 1CGEA 5BOTA 5BOYA 3EWJA 3DNGA 1BUVM 4PKRA 1AF0A 1RM8A 1O0QA 2AYKA 2ERQA 5D1UA 2MZHA 3O2XA 4G0DA 1ASTA 1GE7A 1IAAA 4H1QA 1OM8A 1XFVA 2CKIA 1ZTQA 1SATA 5L79A 3HBUP 4A3WA 4JIJA 5B5OA 1PWUA 3I7IA 1G49A 1GKCA 1R1JA 2YB9A 2OXUA 2X3CA 4WKEA 2Y6CA 4XM8A 3KMEA 1BKCE 1ROSA 3KECA 1EUBA 3G42A 1QJIA 1MMBA 2X7MA 1PWVA 1XURA 2JT5A 1HOVA 1KUHA 4WF6A 4GWMA 3P1VA 4XM7A 966CA 5I4OA 1YP1A 2K9CA 3DL1A 1XFUA 1CGLA 3F1AA 4PKTA 4FVLA 2FV5A 2PJTA 2W15A 1I1IP 3LUMA 4FXQA 4H76A 1FM1A 1OZ9A 1OM6A 1HFCA 1MMQA 2O36A 1B8YA 3Q2GA 1HFSA 3B2ZA 3RTSA 456CA 1KBCA 4DF9A 3WV2A 2OVZA 4WK7A 2K2GA 3G5CA 1C8TA 3F16A 4I03A 5CXAA 1R1HA 2D1OA 5I2ZA 2OZRA 1KUKA 4GR0A 1BZSA 2XS3A 3CKIA 4PKVA 1C7KA 1RMZA 4PKSA 2D1NA 3LUNA 1YQYA 2J0TA 2OXWA 3LKAA 2X3AA 3LGPA 1GXDA 3TVCA 3MA2A 4ZR5A 1XUDA 1Y0VA 2OW2A 1GE5A 3GBOA 4H30A 2JT6A 1PWWA 1CGFA 1YOUA 1BUDA 1BIWA 4I35A 5CUHA 1HV5A 5CZMA 1OS2A 2AIGP 1ZXVA 3LJTA 2JSDA 1IAGA 2MZIA 2EROA 1UMSA 3ZVSA 1QJJA 3KWVC 3O64A 3TS4A 4JQGA 1DMTA 1JIWP 3ZXHA 4G9LA 3ZUKA 1JAPA 1H71P 3WV1A 1L6JA 2J83A 1JJ9A 3DTIA 1BM6A 2OW9A 4AXQA 1GKDA 4IJOA 3B8ZA 3KMCA 5BPAA 5JMYA 4GF1A 3HBVP 1C3IA 2YUFA 3ELMA 1SU3A 4ILWD 5D3CA 1XAXA 4L6TA 3KHIA 4EFSA 4FU4A 4H2EA 3DPEA 3TT4A 5I0LA 3DTEA 2A8HA 1YCMA 1OMJA 3HYGA 2DW1A 1SLNA 3LK8A 1USNA 1Q3AA 2USNA 4JPAA 1R55A 2WOAA 1FLSA 1JAQA 1AYKA 1UEAA 4Q1LA 3AYKA 4AIGA 3LJZA 3OHOA 2X3BA 3USNA 2O3EA 1DTHA 3LQBA 1CAQA 4H3XA 3F19A 5D1SA 3NX7A 3KEJA 1PWPA 1SMPA 1S4BP 2TCLA 3L0VA 3LILA 1R1IA 2CLTA 2E3XA 3I7GA 4GWNA 3UVCA 3N2VA 4H49A 1J7NA 3OHLA 2OW1A 2XS4A 3F18A 2MZEA 4PKQA 3VTGA 1CIZA 1A86A 1QICA 3F17A 1G12A 2SRTA 3HDBA 1SLMA 3AIGA 5I3MA 1UTZA 2MLRA 1HY7A 1BQQM 3HY9A 1K7QA 2OXZA 5B5PA 3EDGA 3TSKA 1K7IA 2W14A 2W0DA 4L19A 2JIHA 1CQRA 4L7AA 5H8XA 4HMAA 1BKCA 1UMTA 3E8RA 4JP4A 2W13A 3K7NA 1GO8P 2FV9A 2DDYA 1JAOA 1MNCA 1IADA 1CK7A 1Y8JA 3K7LA 1TVIA 1JK3A 4JA1A 5I43A 4QKZA 2OI0A 5I12A 4GR8A 1KUGA 4GQLA 3P24A 2JNPA 1SRPA 2YIGA 3HB2P 1D8MA 1K7GA 3V96B 3VI1A 1I73A 1JIZA 2W12A 3DTKA 4CTHA 3EDZA 5LABA 1IACA 3EDIA 1GE6A 2KRJA 1BSWA 2ERPA 1B3DA 3DWBA 1BKCI 1QUAA 3N2UA 1Z3JA 1BQOA 2RJQA 1XFWA 4GUYA 3LEAA 1CXVA 3AYUA 4IN9A 4HX3A 1OO9A 1ZS0A 3KRYA 2POJA 3HY7A 3KEKA 2DW2A 1JKYA 4FXYP 3DPFA 2RJPA 3WV3A 1KUFA 2L0RA 1JH1A 5D1TA 1JANA 2Z2DA 1OM7A 3BA0A 1UTTA 1FBLA 4XCTA 1ND1A 4DV8A 1D7XA 1KAPP 4H84A 3RTTA 2OW0A 3LIRA 1GO7P 1XFZA 4PKWA 4R3VA 830CA 1IABA 4A7BA 1QIAA 1ZP5A 1QIBA 3LE9A 3SHIA 1PWQA 1XM5A 3LJGA 4J4MA 3F15A 3U1RA 2QPJA 1ATLA 5D7WA 1G4KA 4WZVA 2WO8A 1OS9A 1O0TA 3DSLA 3EDHA 1A85A 1G05A 1WNIA 3L0TA 2V4BA 2HU6A 1ZXCA 2OY4A 3LQ0A 4IUWA 1D8FA 1XFYA 1KUIA 3B92A 1HTDA 1ZVXA 4H82A 3LMCA 1MMRA
chains in the Genus database with same CATH topology
1XUCA 2Y6DA 1IAEA 3Q2HA 3LIKA 2N8RA 2E2DA 1R54A 4PKUA 3EHYA 1AKLA 4XM6A 1MMPA 2DDFA 1EAKA 2DW0A 3HDAP 2I47A 4DD8A 1D5JA 4DPEA 1I76A 1G9KA 3EHXA 2OY2A 2OVXA 2MLSA 4L63A 1XFXA 5L7FA 4AYKA 4ON1A 1EB6A 2WO9A 1Y93A 4GR3A 4WKIA 4AUOA 5D2BA 4XBHA 1CGEA 5BOTA 5BOYA 3EWJA 3DNGA 1BUVM 4PKRA 1AF0A 1RM8A 1O0QA 2AYKA 2ERQA 5D1UA 2MZHA 3O2XA 4G0DA 1ASTA 1GE7A 1IAAA 4H1QA 1OM8A 1XFVA 2CKIA 1ZTQA 1SATA 5L79A 3HBUP 4A3WA 4JIJA 5B5OA 1PWUA 3I7IA 1G49A 1GKCA 1R1JA 2YB9A 2OXUA 2X3CA 4WKEA 2Y6CA 4XM8A 3KMEA 1BKCE 1ROSA 3KECA 1EUBA 3G42A 1QJIA 1MMBA 2X7MA 1PWVA 1XURA 2JT5A 1HOVA 1KUHA 4WF6A 4GWMA 3P1VA 4XM7A 966CA 5I4OA 1YP1A 2K9CA 3DL1A 1XFUA 1CGLA 3F1AA 4PKTA 4FVLA 2FV5A 2PJTA 2W15A 1I1IP 3LUMA 4FXQA 4H76A 1FM1A 1OM6A 1HFCA 1MMQA 2O36A 1B8YA 3Q2GA 1HFSA 3B2ZA 3RTSA 456CA 1KBCA 4DF9A 3WV2A 2OVZA 4WK7A 2K2GA 3G5CA 1C8TA 3F16A 4I03A 5CXAA 1R1HA 2D1OA 5I2ZA 2OZRA 1KUKA 4GR0A 1BZSA 2XS3A 3CKIA 4PKVA 1C7KA 1RMZA 4PKSA 2D1NA 3LUNA 1YQYA 2J0TA 2OXWA 3LKAA 2X3AA 3LGPA 1GXDA 3TVCA 3MA2A 4ZR5A 1XUDA 1Y0VA 2OW2A 1GE5A 3GBOA 4H30A 2JT6A 1PWWA 1CGFA 1YOUA 1BUDA 1BIWA 4I35A 5CUHA 1HV5A 5CZMA 1OS2A 2AIGP 1ZXVA 3LJTA 2JSDA 1IAGA 2MZIA 2EROA 1UMSA 3ZVSA 1QJJA 3KWVC 3O64A 3TS4A 4JQGA 1DMTA 1JIWP 3ZXHA 4G9LA 3ZUKA 1JAPA 1H71P 3WV1A 1L6JA 2J83A 1JJ9A 3DTIA 1BM6A 2OW9A 4AXQA 1GKDA 4IJOA 3B8ZA 3KMCA 5BPAA 5JMYA 4GF1A 3HBVP 1C3IA 2YUFA 3ELMA 1SU3A 4ILWD 5D3CA 4L6TA 4EFSA 3KHIA 4FU4A 4H2EA 3DPEA 3TT4A 5I0LA 3DTEA 2A8HA 1YCMA 1OMJA 3HYGA 2DW1A 1SLNA 3LK8A 1USNA 1Q3AA 2USNA 4JPAA 1R55A 2WOAA 1FLSA 1JAQA 1AYKA 1UEAA 4Q1LA 3AYKA 4AIGA 3LJZA 3OHOA 2X3BA 3USNA 2O3EA 1DTHA 3LQBA 1CAQA 4H3XA 3F19A 5D1SA 3NX7A 3KEJA 1PWPA 1SMPA 1S4BP 2TCLA 3L0VA 3LILA 1R1IA 2CLTA 2E3XA 3I7GA 4GWNA 3UVCA 3N2VA 4H49A 1J7NA 3OHLA 2OW1A 2XS4A 3F18A 2MZEA 4PKQA 3VTGA 1CIZA 1A86A 1QICA 3F17A 1G12A 2SRTA 3HDBA 1SLMA 3AIGA 5I3MA 1UTZA 2MLRA 1HY7A 1BQQM 3HY9A 1K7QA 2OXZA 5B5PA 3EDGA 3TSKA 1K7IA 2W14A 2W0DA 4L19A 2JIHA 1CQRA 4L7AA 5H8XA 4HMAA 1BKCA 1UMTA 3E8RA 4JP4A 2W13A 3K7NA 1GO8P 2FV9A 2DDYA 1JAOA 1MNCA 1IADA 1CK7A 1Y8JA 3K7LA 1JK3A 4JA1A 5I43A 4QKZA 2OI0A 5I12A 4GR8A 1KUGA 4GQLA 3P24A 2JNPA 1SRPA 2YIGA 3HB2P 1D8MA 1K7GA 3V96B 3VI1A 1I73A 1JIZA 2W12A 3DTKA 4CTHA 3EDZA 5LABA 1IACA 3EDIA 1GE6A 2KRJA 1BSWA 2ERPA 1B3DA 3DWBA 1BKCI 1QUAA 3N2UA 1Z3JA 1BQOA 2RJQA 1XFWA 4GUYA 3LEAA 1CXVA 3AYUA 4IN9A 4HX3A 1OO9A 1ZS0A 3KRYA 2POJA 3HY7A 3KEKA 2DW2A 1JKYA 4FXYP 3DPFA 2RJPA 3WV3A 1KUFA 2L0RA 1JH1A 5D1TA 1JANA 2Z2DA 1OM7A 3BA0A 1UTTA 1FBLA 4XCTA 1ND1A 4DV8A 1D7XA 1KAPP 4H84A 3RTTA 2OW0A 3LIRA 1GO7P 1XFZA 4PKWA 4R3VA 830CA 1IABA 4A7BA 1QIAA 1ZP5A 1QIBA 3LE9A 3SHIA 1PWQA 3LJGA 4J4MA 3F15A 3U1RA 2QPJA 1ATLA 5D7WA 1G4KA 4WZVA 2WO8A 1OS9A 1O0TA 3DSLA 3EDHA 1A85A 1G05A 1WNIA 3L0TA 2V4BA 2HU6A 1ZXCA 2OY4A 3LQ0A 4IUWA 1D8FA 1XFYA 1KUIA 3B92A 1HTDA 1ZVXA 4H82A 3LMCA 1MMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUC A;  2Y6D A;  1IAE A;  3Q2H A;  3LIK A;  2N8R A;  2E2D A;  1R54 A;  4PKU A;  3EHY A;  1AKL A;  4XM6 A;  1MMP A;  2DDF A;  1EAK A;  2DW0 A;  3HDA P;  2I47 A;  4DD8 A;  1D5J A;  4DPE A;  1I76 A;  1G9K A;  3EHX A;  2OY2 A;  2OVX A;  2MLS A;  4L63 A;  1XFX A;  5L7F A;  4AYK A;  4ON1 A;  1EB6 A;  2WO9 A;  1Y93 A;  4GR3 A;  4WKI A;  4AUO A;  5D2B A;  4XBH A;  1CGE A;  5BOT A;  5BOY A;  3EWJ A;  3DNG A;  1BUV M;  4PKR A;  1AF0 A;  1RM8 A;  1O0Q A;  2AYK A;  2ERQ A;  5D1U A;  2MZH A;  3O2X A;  4G0D A;  1AST A;  1GE7 A;  1IAA A;  4H1Q A;  1OM8 A;  1XFV A;  2CKI A;  1ZTQ A;  1SAT A;  5L79 A;  3HBU P;  4A3W A;  4JIJ A;  5B5O A;  1PWU A;  3I7I A;  1G49 A;  1GKC A;  1R1J A;  2YB9 A;  2OXU A;  2X3C A;  4WKE A;  2Y6C A;  4XM8 A;  3KME A;  1BKC E;  1ROS A;  3KEC A;  1EUB A;  3G42 A;  1QJI A;  1MMB A;  2X7M A;  1PWV A;  1XUR A;  2JT5 A;  1HOV A;  1KUH A;  4WF6 A;  4GWM A;  3P1V A;  4XM7 A;  966C A;  5I4O A;  1YP1 A;  2K9C A;  3DL1 A;  1XFU A;  1CGL A;  3F1A A;  4PKT A;  4FVL A;  2FV5 A;  2PJT A;  2W15 A;  1I1I P;  3LUM A;  4FXQ A;  4H76 A;  1FM1 A;  1OM6 A;  1HFC A;  1MMQ A;  2O36 A;  1B8Y A;  3Q2G A;  1HFS A;  3B2Z A;  3RTS A;  456C A;  1KBC A;  4DF9 A;  3WV2 A;  2OVZ A;  4WK7 A;  2K2G A;  3G5C A;  1C8T A;  3F16 A;  4I03 A;  5CXA A;  1R1H A;  2D1O A;  5I2Z A;  2OZR A;  1KUK A;  4GR0 A;  1BZS A;  2XS3 A;  3CKI A;  4PKV A;  1C7K A;  1RMZ A;  4PKS A;  2D1N A;  3LUN A;  1YQY A;  2J0T A;  2OXW A;  3LKA A;  2X3A A;  3LGP A;  1GXD A;  3TVC A;  3MA2 A;  4ZR5 A;  1XUD A;  1Y0V A;  2OW2 A;  1GE5 A;  3GBO A;  4H30 A;  2JT6 A;  1PWW A;  1CGF A;  1YOU A;  1BUD A;  1BIW A;  4I35 A;  5CUH A;  1HV5 A;  5CZM A;  1OS2 A;  2AIG P;  1ZXV A;  3LJT A;  2JSD A;  1IAG A;  2MZI A;  2ERO A;  1UMS A;  3ZVS A;  1QJJ A;  3KWV C;  3O64 A;  3TS4 A;  4JQG A;  1DMT A;  1JIW P;  3ZXH A;  4G9L A;  3ZUK A;  1JAP A;  1H71 P;  3WV1 A;  1L6J A;  2J83 A;  1JJ9 A;  1BM6 A;  2OW9 A;  4AXQ A;  1GKD A;  4IJO A;  3B8Z A;  3KMC A;  5BPA A;  5JMY A;  4GF1 A;  3HBV P;  1C3I A;  3ELM A;  1SU3 A;  4ILW D;  5D3C A;  4L6T A;  4EFS A;  3KHI A;  4FU4 A;  4H2E A;  3DPE A;  3TT4 A;  5I0L A;  2A8H A;  1YCM A;  1OMJ A;  3HYG A;  2DW1 A;  1SLN A;  3LK8 A;  1USN A;  1Q3A A;  2USN A;  4JPA A;  1R55 A;  2WOA A;  1FLS A;  1JAQ A;  1AYK A;  1UEA A;  4Q1L A;  3AYK A;  4AIG A;  3LJZ A;  3OHO A;  2X3B A;  3USN A;  2O3E A;  1DTH A;  3LQB A;  1CAQ A;  4H3X A;  3F19 A;  5D1S A;  3NX7 A;  3KEJ A;  1PWP A;  1SMP A;  1S4B P;  2TCL A;  3L0V A;  3LIL A;  1R1I A;  2CLT A;  2E3X A;  3I7G A;  4GWN A;  3UVC A;  3N2V A;  4H49 A;  1J7N A;  3OHL A;  2OW1 A;  2XS4 A;  3F18 A;  2MZE A;  4PKQ A;  3VTG A;  1CIZ A;  1A86 A;  1QIC A;  3F17 A;  1G12 A;  2SRT A;  3HDB A;  1SLM A;  3AIG A;  5I3M A;  1UTZ A;  2MLR A;  1HY7 A;  1BQQ M;  3HY9 A;  1K7Q A;  2OXZ A;  5B5P A;  3EDG A;  3TSK A;  1K7I A;  2W14 A;  2W0D A;  4L19 A;  2JIH A;  1CQR A;  5H8X A;  4HMA A;  1BKC A;  1UMT A;  3E8R A;  4JP4 A;  2W13 A;  3K7N A;  1GO8 P;  2FV9 A;  2DDY A;  1JAO A;  1MNC A;  1IAD A;  1CK7 A;  1Y8J A;  3K7L A;  1JK3 A;  4JA1 A;  5I43 A;  4QKZ A;  2OI0 A;  5I12 A;  4GR8 A;  1KUG A;  4GQL A;  3P24 A;  2JNP A;  1SRP A;  2YIG A;  3HB2 P;  1D8M A;  1K7G A;  3V96 B;  3VI1 A;  1I73 A;  1JIZ A;  2W12 A;  4CTH A;  3EDZ A;  5LAB A;  1IAC A;  3EDI A;  1GE6 A;  2KRJ A;  1BSW A;  2ERP A;  1B3D A;  3DWB A;  1BKC I;  1QUA A;  3N2U A;  1Z3J A;  1BQO A;  2RJQ A;  1XFW A;  4GUY A;  3LEA A;  1CXV A;  3AYU A;  4IN9 A;  4HX3 A;  1OO9 A;  1ZS0 A;  3KRY A;  2POJ A;  3HY7 A;  3KEK A;  2DW2 A;  1JKY A;  4FXY P;  3DPF A;  2RJP A;  3WV3 A;  1KUF A;  2L0R A;  1JH1 A;  5D1T A;  1JAN A;  2Z2D A;  1OM7 A;  3BA0 A;  1UTT A;  1FBL A;  4XCT A;  1ND1 A;  4DV8 A;  1D7X A;  1KAP P;  4H84 A;  3RTT A;  2OW0 A;  3LIR A;  1GO7 P;  1XFZ A;  4PKW A;  4R3V A;  830C A;  1IAB A;  4A7B A;  1QIA A;  1ZP5 A;  1QIB A;  3LE9 A;  3SHI A;  1PWQ A;  3LJG A;  4J4M A;  3F15 A;  3U1R A;  2QPJ A;  1ATL A;  5D7W A;  1G4K A;  4WZV A;  2WO8 A;  1OS9 A;  1O0T A;  3DSL A;  3EDH A;  1A85 A;  1G05 A;  1WNI A;  3L0T A;  2V4B A;  2HU6 A;  1ZXC A;  2OY4 A;  3LQ0 A;  4IUW A;  1D8F A;  1XFY A;  1KUI A;  3B92 A;  1HTD A;  1ZVX A;  4H82 A;  3LMC A;  1MMR A; 
#chains in the Genus database with same CATH topology
 1XUC A;  2Y6D A;  1IAE A;  3Q2H A;  3LIK A;  2N8R A;  2E2D A;  1R54 A;  4PKU A;  3EHY A;  1AKL A;  4XM6 A;  1MMP A;  2DDF A;  1EAK A;  2DW0 A;  3HDA P;  2I47 A;  4DD8 A;  1D5J A;  4DPE A;  1I76 A;  1G9K A;  3EHX A;  2OY2 A;  2OVX A;  2MLS A;  4L63 A;  1XFX A;  5L7F A;  4AYK A;  4ON1 A;  1EB6 A;  2WO9 A;  1Y93 A;  4GR3 A;  4WKI A;  4AUO A;  5D2B A;  4XBH A;  1CGE A;  5BOT A;  5BOY A;  3EWJ A;  3DNG A;  1BUV M;  4PKR A;  1AF0 A;  1RM8 A;  1O0Q A;  2AYK A;  2ERQ A;  5D1U A;  2MZH A;  3O2X A;  4G0D A;  1AST A;  1GE7 A;  1IAA A;  4H1Q A;  1OM8 A;  1XFV A;  2CKI A;  1ZTQ A;  1SAT A;  5L79 A;  3HBU P;  4A3W A;  4JIJ A;  5B5O A;  1PWU A;  3I7I A;  1G49 A;  1GKC A;  1R1J A;  2YB9 A;  2OXU A;  2X3C A;  4WKE A;  2Y6C A;  4XM8 A;  3KME A;  1BKC E;  1ROS A;  3KEC A;  1EUB A;  3G42 A;  1QJI A;  1MMB A;  2X7M A;  1PWV A;  1XUR A;  2JT5 A;  1HOV A;  1KUH A;  4WF6 A;  4GWM A;  3P1V A;  4XM7 A;  966C A;  5I4O A;  1YP1 A;  2K9C A;  3DL1 A;  1XFU A;  1CGL A;  3F1A A;  4PKT A;  4FVL A;  2FV5 A;  2PJT A;  2W15 A;  1I1I P;  3LUM A;  4FXQ A;  4H76 A;  1FM1 A;  1OZ9 A;  1OM6 A;  1HFC A;  1MMQ A;  2O36 A;  1B8Y A;  3Q2G A;  1HFS A;  3B2Z A;  3RTS A;  456C A;  1KBC A;  4DF9 A;  3WV2 A;  2OVZ A;  4WK7 A;  2K2G A;  3G5C A;  1C8T A;  3F16 A;  4I03 A;  5CXA A;  1R1H A;  2D1O A;  5I2Z A;  2OZR A;  1KUK A;  4GR0 A;  1BZS A;  2XS3 A;  3CKI A;  4PKV A;  1C7K A;  1RMZ A;  4PKS A;  2D1N A;  3LUN A;  1YQY A;  2J0T A;  2OXW A;  3LKA A;  2X3A A;  3LGP A;  1GXD A;  3TVC A;  3MA2 A;  4ZR5 A;  1XUD A;  1Y0V A;  2OW2 A;  1GE5 A;  3GBO A;  4H30 A;  2JT6 A;  1PWW A;  1CGF A;  1YOU A;  1BUD A;  1BIW A;  4I35 A;  5CUH A;  1HV5 A;  5CZM A;  1OS2 A;  2AIG P;  1ZXV A;  3LJT A;  2JSD A;  1IAG A;  2MZI A;  2ERO A;  1UMS A;  3ZVS A;  1QJJ A;  3KWV C;  3O64 A;  3TS4 A;  4JQG A;  1DMT A;  1JIW P;  3ZXH A;  4G9L A;  3ZUK A;  1JAP A;  1H71 P;  3WV1 A;  1L6J A;  2J83 A;  1JJ9 A;  3DTI A;  1BM6 A;  2OW9 A;  4AXQ A;  1GKD A;  4IJO A;  3B8Z A;  3KMC A;  5BPA A;  5JMY A;  4GF1 A;  3HBV P;  1C3I A;  2YUF A;  3ELM A;  1SU3 A;  4ILW D;  5D3C A;  1XAX A;  4L6T A;  3KHI A;  4EFS A;  4FU4 A;  4H2E A;  3DPE A;  3TT4 A;  5I0L A;  3DTE A;  2A8H A;  1YCM A;  1OMJ A;  3HYG A;  2DW1 A;  1SLN A;  3LK8 A;  1USN A;  1Q3A A;  2USN A;  4JPA A;  1R55 A;  2WOA A;  1FLS A;  1JAQ A;  1AYK A;  1UEA A;  4Q1L A;  3AYK A;  4AIG A;  3LJZ A;  3OHO A;  2X3B A;  3USN A;  2O3E A;  1DTH A;  3LQB A;  1CAQ A;  4H3X A;  3F19 A;  5D1S A;  3NX7 A;  3KEJ A;  1PWP A;  1SMP A;  1S4B P;  2TCL A;  3L0V A;  3LIL A;  1R1I A;  2CLT A;  2E3X A;  3I7G A;  4GWN A;  3UVC A;  3N2V A;  4H49 A;  1J7N A;  3OHL A;  2OW1 A;  2XS4 A;  3F18 A;  2MZE A;  4PKQ A;  3VTG A;  1CIZ A;  1A86 A;  1QIC A;  3F17 A;  1G12 A;  2SRT A;  3HDB A;  1SLM A;  3AIG A;  5I3M A;  1UTZ A;  2MLR A;  1HY7 A;  1BQQ M;  3HY9 A;  1K7Q A;  2OXZ A;  5B5P A;  3EDG A;  3TSK A;  1K7I A;  2W14 A;  2W0D A;  4L19 A;  2JIH A;  1CQR A;  4L7A A;  5H8X A;  4HMA A;  1BKC A;  1UMT A;  3E8R A;  4JP4 A;  2W13 A;  3K7N A;  1GO8 P;  2FV9 A;  2DDY A;  1JAO A;  1MNC A;  1IAD A;  1CK7 A;  1Y8J A;  3K7L A;  1TVI A;  1JK3 A;  4JA1 A;  5I43 A;  4QKZ A;  2OI0 A;  5I12 A;  4GR8 A;  1KUG A;  4GQL A;  3P24 A;  2JNP A;  1SRP A;  2YIG A;  3HB2 P;  1D8M A;  1K7G A;  3V96 B;  3VI1 A;  1I73 A;  1JIZ A;  2W12 A;  3DTK A;  4CTH A;  3EDZ A;  5LAB A;  1IAC A;  3EDI A;  1GE6 A;  2KRJ A;  1BSW A;  2ERP A;  1B3D A;  3DWB A;  1BKC I;  1QUA A;  3N2U A;  1Z3J A;  1BQO A;  2RJQ A;  1XFW A;  4GUY A;  3LEA A;  1CXV A;  3AYU A;  4IN9 A;  4HX3 A;  1OO9 A;  1ZS0 A;  3KRY A;  2POJ A;  3HY7 A;  3KEK A;  2DW2 A;  1JKY A;  4FXY P;  3DPF A;  2RJP A;  3WV3 A;  1KUF A;  2L0R A;  1JH1 A;  5D1T A;  1JAN A;  2Z2D A;  1OM7 A;  3BA0 A;  1UTT A;  1FBL A;  4XCT A;  1ND1 A;  4DV8 A;  1D7X A;  1KAP P;  4H84 A;  3RTT A;  2OW0 A;  3LIR A;  1GO7 P;  1XFZ A;  4PKW A;  4R3V A;  830C A;  1IAB A;  4A7B A;  1QIA A;  1ZP5 A;  1QIB A;  3LE9 A;  3SHI A;  1PWQ A;  1XM5 A;  3LJG A;  4J4M A;  3F15 A;  3U1R A;  2QPJ A;  1ATL A;  5D7W A;  1G4K A;  4WZV A;  2WO8 A;  1OS9 A;  1O0T A;  3DSL A;  3EDH A;  1A85 A;  1G05 A;  1WNI A;  3L0T A;  2V4B A;  2HU6 A;  1ZXC A;  2OY4 A;  3LQ0 A;  4IUW A;  1D8F A;  1XFY A;  1KUI A;  3B92 A;  1HTD A;  1ZVX A;  4H82 A;  3LMC A;  1MMR A; 
#chains in the Genus database with same CATH homology
 1XUC A;  2Y6D A;  1IAE A;  3Q2H A;  3LIK A;  2N8R A;  2E2D A;  1R54 A;  4PKU A;  3EHY A;  1AKL A;  4XM6 A;  1MMP A;  2DDF A;  1EAK A;  2DW0 A;  3HDA P;  2I47 A;  4DD8 A;  1D5J A;  4DPE A;  1I76 A;  1G9K A;  3EHX A;  2OY2 A;  2OVX A;  2MLS A;  4L63 A;  1XFX A;  5L7F A;  4AYK A;  4ON1 A;  1EB6 A;  2WO9 A;  1Y93 A;  4GR3 A;  4WKI A;  4AUO A;  5D2B A;  4XBH A;  1CGE A;  5BOT A;  5BOY A;  3EWJ A;  3DNG A;  1BUV M;  4PKR A;  1AF0 A;  1RM8 A;  1O0Q A;  2AYK A;  2ERQ A;  5D1U A;  2MZH A;  3O2X A;  4G0D A;  1AST A;  1GE7 A;  1IAA A;  4H1Q A;  1OM8 A;  1XFV A;  2CKI A;  1ZTQ A;  1SAT A;  5L79 A;  3HBU P;  4A3W A;  4JIJ A;  5B5O A;  1PWU A;  3I7I A;  1G49 A;  1GKC A;  1R1J A;  2YB9 A;  2OXU A;  2X3C A;  4WKE A;  2Y6C A;  4XM8 A;  3KME A;  1BKC E;  1ROS A;  3KEC A;  1EUB A;  3G42 A;  1QJI A;  1MMB A;  2X7M A;  1PWV A;  1XUR A;  2JT5 A;  1HOV A;  1KUH A;  4WF6 A;  4GWM A;  3P1V A;  4XM7 A;  966C A;  5I4O A;  1YP1 A;  2K9C A;  3DL1 A;  1XFU A;  1CGL A;  3F1A A;  4PKT A;  4FVL A;  2FV5 A;  2PJT A;  2W15 A;  1I1I P;  3LUM A;  4FXQ A;  4H76 A;  1FM1 A;  1OM6 A;  1HFC A;  1MMQ A;  2O36 A;  1B8Y A;  3Q2G A;  1HFS A;  3B2Z A;  3RTS A;  456C A;  1KBC A;  4DF9 A;  3WV2 A;  2OVZ A;  4WK7 A;  2K2G A;  3G5C A;  1C8T A;  3F16 A;  4I03 A;  5CXA A;  1R1H A;  2D1O A;  5I2Z A;  2OZR A;  1KUK A;  4GR0 A;  1BZS A;  2XS3 A;  3CKI A;  4PKV A;  1C7K A;  1RMZ A;  4PKS A;  2D1N A;  3LUN A;  1YQY A;  2J0T A;  2OXW A;  3LKA A;  2X3A A;  3LGP A;  1GXD A;  3TVC A;  3MA2 A;  4ZR5 A;  1XUD A;  1Y0V A;  2OW2 A;  1GE5 A;  3GBO A;  4H30 A;  2JT6 A;  1PWW A;  1CGF A;  1YOU A;  1BUD A;  1BIW A;  4I35 A;  5CUH A;  1HV5 A;  5CZM A;  1OS2 A;  2AIG P;  1ZXV A;  3LJT A;  2JSD A;  1IAG A;  2MZI A;  2ERO A;  1UMS A;  3ZVS A;  1QJJ A;  3KWV C;  3O64 A;  3TS4 A;  4JQG A;  1DMT A;  1JIW P;  3ZXH A;  4G9L A;  3ZUK A;  1JAP A;  1H71 P;  3WV1 A;  1L6J A;  2J83 A;  1JJ9 A;  3DTI A;  1BM6 A;  2OW9 A;  4AXQ A;  1GKD A;  4IJO A;  3B8Z A;  3KMC A;  5BPA A;  5JMY A;  4GF1 A;  3HBV P;  1C3I A;  2YUF A;  3ELM A;  1SU3 A;  4ILW D;  5D3C A;  4L6T A;  4EFS A;  3KHI A;  4FU4 A;  4H2E A;  3DPE A;  3TT4 A;  5I0L A;  3DTE A;  2A8H A;  1YCM A;  1OMJ A;  3HYG A;  2DW1 A;  1SLN A;  3LK8 A;  1USN A;  1Q3A A;  2USN A;  4JPA A;  1R55 A;  2WOA A;  1FLS A;  1JAQ A;  1AYK A;  1UEA A;  4Q1L A;  3AYK A;  4AIG A;  3LJZ A;  3OHO A;  2X3B A;  3USN A;  2O3E A;  1DTH A;  3LQB A;  1CAQ A;  4H3X A;  3F19 A;  5D1S A;  3NX7 A;  3KEJ A;  1PWP A;  1SMP A;  1S4B P;  2TCL A;  3L0V A;  3LIL A;  1R1I A;  2CLT A;  2E3X A;  3I7G A;  4GWN A;  3UVC A;  3N2V A;  4H49 A;  1J7N A;  3OHL A;  2OW1 A;  2XS4 A;  3F18 A;  2MZE A;  4PKQ A;  3VTG A;  1CIZ A;  1A86 A;  1QIC A;  3F17 A;  1G12 A;  2SRT A;  3HDB A;  1SLM A;  3AIG A;  5I3M A;  1UTZ A;  2MLR A;  1HY7 A;  1BQQ M;  3HY9 A;  1K7Q A;  2OXZ A;  5B5P A;  3EDG A;  3TSK A;  1K7I A;  2W14 A;  2W0D A;  4L19 A;  2JIH A;  1CQR A;  4L7A A;  5H8X A;  4HMA A;  1BKC A;  1UMT A;  3E8R A;  4JP4 A;  2W13 A;  3K7N A;  1GO8 P;  2FV9 A;  2DDY A;  1JAO A;  1MNC A;  1IAD A;  1CK7 A;  1Y8J A;  3K7L A;  1JK3 A;  4JA1 A;  5I43 A;  4QKZ A;  2OI0 A;  5I12 A;  4GR8 A;  1KUG A;  4GQL A;  3P24 A;  2JNP A;  1SRP A;  2YIG A;  3HB2 P;  1D8M A;  1K7G A;  3V96 B;  3VI1 A;  1I73 A;  1JIZ A;  2W12 A;  3DTK A;  4CTH A;  3EDZ A;  5LAB A;  1IAC A;  3EDI A;  1GE6 A;  2KRJ A;  1BSW A;  2ERP A;  1B3D A;  3DWB A;  1BKC I;  1QUA A;  3N2U A;  1Z3J A;  1BQO A;  2RJQ A;  1XFW A;  4GUY A;  3LEA A;  1CXV A;  3AYU A;  4IN9 A;  4HX3 A;  1OO9 A;  1ZS0 A;  3KRY A;  2POJ A;  3HY7 A;  3KEK A;  2DW2 A;  1JKY A;  4FXY P;  3DPF A;  2RJP A;  3WV3 A;  1KUF A;  2L0R A;  1JH1 A;  5D1T A;  1JAN A;  2Z2D A;  1OM7 A;  3BA0 A;  1UTT A;  1FBL A;  4XCT A;  1ND1 A;  4DV8 A;  1D7X A;  1KAP P;  4H84 A;  3RTT A;  2OW0 A;  3LIR A;  1GO7 P;  1XFZ A;  4PKW A;  4R3V A;  830C A;  1IAB A;  4A7B A;  1QIA A;  1ZP5 A;  1QIB A;  3LE9 A;  3SHI A;  1PWQ A;  3LJG A;  4J4M A;  3F15 A;  3U1R A;  2QPJ A;  1ATL A;  5D7W A;  1G4K A;  4WZV A;  2WO8 A;  1OS9 A;  1O0T A;  3DSL A;  3EDH A;  1A85 A;  1G05 A;  1WNI A;  3L0T A;  2V4B A;  2HU6 A;  1ZXC A;  2OY4 A;  3LQ0 A;  4IUW A;  1D8F A;  1XFY A;  1KUI A;  3B92 A;  1HTD A;  1ZVX A;  4H82 A;  3LMC A;  1MMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...