2HU6A

Crystal structure of human mmp-12 in complex with acetohydroxamic acid and a bicyclic inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Synthesis of bicyclic molecular scaffolds (BTAa): an investigation towards new selective MMP-12 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2hu6A00
1IABA 3F17A 1ZTQA 2Y6DA 1GE7A 2AIGP 1ZP5A 1FM1A 1XFUA 1JANA 1Y0VA 1RMZA 3RTSA 1HFSA 1ZXVA 2OI0A 2W12A 1KUFA 1JH1A 4H76A 2E3XA 1CAQA 2D1OA 2WO8A 1IAGA 5CXAA 3I7IA 1OM6A 1SRPA 1PWUA 2O3EA 4FXYP 4H2EA 1ASTA 1K7QA 2A8HA 3DWBA 1Q3AA 1IAEA 3LUMA 1HV5A 3B8ZA 2RJQA 3G42A 1C7KA 5D3CA 2X7MA 1G9KA 1RM8A 1Y8JA 4IJOA 1JAOA 2JNPA 3DPEA 3HB2P 2AYKA 2WOAA 2K2GA 4WKIA 3P24A 2CKIA 4PKTA 1QIBA 3U1RA 3AYKA 2OXUA 3CKIA 3F16A 3WV1A 1PWVA 1XFVA 3V96B 5B5OA 1HOVA 1GKDA 5D1UA 1CGFA 1QIAA 1XFWA 5I2ZA 3EHXA 3KEJA 4GQLA 4JQGA 4H49A 1YCMA 4PKWA 3VI1A 1G12A 3L0TA 3ZUKA 3LJTA 4DV8A 2OY2A 1QJIA 1USNA 2DDFA 2OXWA 1OO9A 3LQ0A 5I4OA 2YIGA 1A86A 4JIJA 1AF0A 1QJJA 4DF9A 1YOUA 3HBUP 3Q2GA 2Y6CA 4ZR5A 1GO8P 1XFYA 3N2UA 1IADA 2W13A 1CQRA 1FBLA 5CZMA 1HY7A 2HU6A 4L19A 1JJ9A 1UMSA 2JT5A 1PWPA 3EDHA 2K9CA 4XBHA 1HTDA 1D5JA 1UEAA 2TCLA 3KEKA 4G9LA 4JA1A 1I76A 2E2DA 3VTGA 1CIZA 1BM6A 4I35A 2MLSA 3HBVP 3UVCA 1XURA 1I1IP 1CXVA 4GF1A 3HYGA 4XM7A 3LGPA 1XFZA 3LKAA 1QICA 3LIKA 1S4BP 1UTZA 2XS3A 1CGEA 1OM7A 2L0RA 1G49A 1ZVXA 2EROA 4IUWA 4PKSA 1C8TA 5BOYA 1KUKA 3B2ZA 2OW1A 1H71P 1SLNA 3HDAP 1AKLA 4JPAA 4PKVA 1SU3A 4AYKA 2OXZA 3OHOA 1DMTA 5D1TA 1CGLA 2KRJA 3LILA 1J7NA 2FV9A 3K7LA 1O0TA 2ERQA 1L6JA 2YB9A 3G5CA 4PKRA 1UTTA 1EB6A 3LJZA 1D7XA 1OS9A 1JAQA 2MLRA 4GWNA 2X3BA 1BQOA 3LUNA 4H30A 2X3CA 3F19A 4GR8A 5CUHA 3USNA 2OW2A 1AYKA 3WV3A 1JIWP 3N2VA 1MMPA 1MNCA 1EUBA 1JIZA 2CLTA 3MA2A 3RTTA 3KWVC 4I03A 1BIWA 2FV5A 4A3WA 1YQYA 2N8RA 1GE5A 2DW0A 1OM8A 1EAKA 3TT4A 1A85A 1CK7A 3AYUA 2J83A 1PWQA 5B5PA 1KAPP 2V4BA 3WV2A 1XUDA 3F1AA 4QKZA 4WK7A 1KUIA 2OW9A 1R1IA 3TSKA 1BZSA 2RJPA 4IN9A 2O36A 1R54A 2I47A 3KECA 4J4MA 1JK3A 456CA 3P1VA 5L79A 4HX3A 2X3AA 3LJGA 1C3IA 3LQBA 2DDYA 4H3XA 3F18A 3TVCA 4CTHA 4FXQA 5I43A 1KUGA 1GO7P 1IACA 2JIHA 3NX7A 4ON1A 2MZIA 1BSWA 3L0VA 3ELMA 2ERPA 1SLMA 1R1JA 1JAPA 3E8RA 2USNA 1HFCA 5BPAA 3GBOA 2DW2A 2W0DA 1YP1A 1ZS0A 3Q2HA 5D2BA 5I0LA 1IAAA 3HY7A 966CA 3TS4A 3OHLA 1Y93A 5LABA 2QPJA 1I73A 2SRTA 1MMBA 3HDBA 1K7IA 3LMCA 5H8XA 2MZEA 5D7WA 2OVXA 2OZRA 1KUHA 3LE9A 1QUAA 2MZHA 4XM6A 1OMJA 4H1QA 1BQQM 1BKCI 4XCTA 4EFSA 2W15A 3LEAA 2OW0A 1UMTA 4ILWD 1G05A 2Z2DA 5I3MA 3SHIA 3B92A 3KMEA 1MMQA 1GE6A 1XFXA 4H84A 4PKUA 5BOTA 4AUOA 1BKCE 1ND1A 3BA0A 4JP4A 1BKCA 4GWMA 4WKEA 4XM8A 1SATA 2DW1A 3EWJA 3ZVSA 1K7GA 3KHIA 3EDGA 1PWWA 1XUCA 4AXQA 5I12A 3HY9A 1R55A 3DL1A 2OY4A 2W14A 1MMRA 1ATLA 2JT6A 2POJA 1WNIA 4GUYA 4H82A 4GR3A 1ZXCA 4AIGA 4Q1LA 4R3VA 4HMAA 1BUVM 1KBCA 4WF6A 2WO9A 2OVZA 3ZXHA 4L63A 1G4KA 1B8YA 1GKCA 1D8FA 4PKQA 1ROSA 1D8MA 1R1HA 1O0QA 4DD8A 1OS2A 1DTHA 1Z3JA 3O64A 5JMYA 2XS4A 3EDIA 5D1SA 4A7BA 4DPEA 1B3DA 1BUDA 3DNGA 3AIGA 1JKYA 3O2XA 3LK8A 5L7FA 3DSLA 3I7GA 3K7NA 3DPFA 4FVLA 1SMPA 830CA 4G0DA 4GR0A 4L6TA 4WZVA 4FU4A 3LIRA 3KRYA 3EHYA 3F15A 3EDZA 1FLSA 2J0TA 2D1NA 1GXDA 2JSDA 3KMCA 2PJTA
chains in the Genus database with same CATH superfamily
1IABA 3F17A 1ZTQA 2Y6DA 1GE7A 2AIGP 1ZP5A 1FM1A 1XFUA 1JANA 1Y0VA 3DTIA 1RMZA 3RTSA 1HFSA 1ZXVA 2OI0A 2W12A 1KUFA 1JH1A 4H76A 2E3XA 1CAQA 2D1OA 2WO8A 1IAGA 5CXAA 3I7IA 1OM6A 1SRPA 1PWUA 2O3EA 4FXYP 4H2EA 1ASTA 1K7QA 1XAXA 2A8HA 3DWBA 1Q3AA 1IAEA 3LUMA 1HV5A 3B8ZA 2RJQA 3G42A 1C7KA 5D3CA 2X7MA 1G9KA 1RM8A 1Y8JA 4IJOA 1JAOA 2JNPA 3DPEA 3HB2P 2AYKA 2WOAA 2K2GA 4WKIA 3P24A 2CKIA 4PKTA 1QIBA 3U1RA 3AYKA 2OXUA 3CKIA 3F16A 1OZ9A 3WV1A 1PWVA 2YUFA 1XFVA 3V96B 5B5OA 1HOVA 1GKDA 5D1UA 1CGFA 1QIAA 1XFWA 5I2ZA 3EHXA 3KEJA 4GQLA 4JQGA 4H49A 1YCMA 4PKWA 3VI1A 1G12A 3L0TA 3ZUKA 3LJTA 4DV8A 2OY2A 1QJIA 1USNA 2DDFA 2OXWA 1OO9A 3LQ0A 5I4OA 2YIGA 1A86A 4JIJA 1AF0A 1QJJA 4DF9A 1YOUA 3HBUP 3Q2GA 2Y6CA 4ZR5A 1GO8P 1XFYA 3N2UA 1IADA 2W13A 1CQRA 1FBLA 5CZMA 1HY7A 2HU6A 4L19A 1JJ9A 1UMSA 2JT5A 1PWPA 3EDHA 2K9CA 4XBHA 1HTDA 1D5JA 1UEAA 2TCLA 3KEKA 4G9LA 4JA1A 1I76A 2E2DA 3VTGA 1CIZA 1BM6A 4I35A 2MLSA 3HBVP 3UVCA 1XURA 1I1IP 1CXVA 4GF1A 3HYGA 4XM7A 3LGPA 1XFZA 3LKAA 1QICA 3LIKA 1S4BP 1UTZA 2XS3A 1CGEA 1OM7A 2L0RA 1G49A 1ZVXA 2EROA 4IUWA 4PKSA 1C8TA 5BOYA 1KUKA 3B2ZA 2OW1A 1H71P 1SLNA 3HDAP 1AKLA 4JPAA 4PKVA 1SU3A 4AYKA 2OXZA 3OHOA 1DMTA 5D1TA 1CGLA 2KRJA 3LILA 1J7NA 2FV9A 3K7LA 1O0TA 2ERQA 1L6JA 2YB9A 3G5CA 4PKRA 1UTTA 1EB6A 3LJZA 1D7XA 1OS9A 1JAQA 2MLRA 4GWNA 2X3BA 1BQOA 3LUNA 4H30A 2X3CA 3F19A 4GR8A 3DTKA 5CUHA 3USNA 2OW2A 1AYKA 3WV3A 1JIWP 3N2VA 1MMPA 1MNCA 1EUBA 1JIZA 2CLTA 3MA2A 3RTTA 3KWVC 4I03A 1BIWA 2FV5A 4A3WA 1YQYA 2N8RA 1GE5A 2DW0A 1OM8A 1EAKA 3TT4A 1A85A 1CK7A 3AYUA 2J83A 1PWQA 5B5PA 1KAPP 2V4BA 3WV2A 1XUDA 3F1AA 1TVIA 4QKZA 4WK7A 1KUIA 2OW9A 1R1IA 3TSKA 1BZSA 2RJPA 4IN9A 2O36A 1R54A 2I47A 3KECA 4J4MA 1JK3A 456CA 3P1VA 5L79A 4HX3A 2X3AA 3LJGA 1C3IA 3LQBA 2DDYA 4H3XA 3F18A 3TVCA 4CTHA 4FXQA 5I43A 1KUGA 1GO7P 1IACA 2JIHA 3NX7A 4ON1A 2MZIA 1BSWA 3L0VA 3ELMA 2ERPA 1SLMA 1R1JA 1JAPA 3E8RA 2USNA 1HFCA 5BPAA 3GBOA 2DW2A 2W0DA 1YP1A 1ZS0A 3Q2HA 5D2BA 5I0LA 1IAAA 3HY7A 966CA 3TS4A 3OHLA 1Y93A 5LABA 2QPJA 1I73A 2SRTA 1MMBA 3HDBA 1K7IA 3LMCA 5H8XA 2MZEA 5D7WA 2OVXA 2OZRA 1KUHA 3LE9A 1QUAA 2MZHA 4XM6A 1OMJA 4H1QA 1BQQM 1BKCI 4XCTA 4EFSA 2W15A 3LEAA 2OW0A 1UMTA 4ILWD 1G05A 2Z2DA 5I3MA 3SHIA 3B92A 3KMEA 1MMQA 1GE6A 1XFXA 4H84A 4PKUA 5BOTA 4AUOA 1BKCE 1ND1A 3BA0A 4JP4A 1BKCA 4GWMA 4WKEA 4XM8A 1SATA 2DW1A 3EWJA 3ZVSA 1K7GA 3KHIA 3EDGA 1PWWA 1XUCA 4AXQA 5I12A 3HY9A 1R55A 3DL1A 2OY4A 4L7AA 2W14A 1MMRA 1ATLA 2JT6A 2POJA 1WNIA 4GUYA 4H82A 4GR3A 1ZXCA 4AIGA 4Q1LA 4R3VA 4HMAA 1BUVM 1KBCA 4WF6A 2WO9A 2OVZA 3ZXHA 4L63A 1G4KA 1B8YA 1GKCA 1D8FA 4PKQA 1ROSA 1D8MA 1R1HA 1O0QA 4DD8A 1OS2A 1DTHA 1Z3JA 3O64A 5JMYA 2XS4A 3EDIA 5D1SA 4A7BA 4DPEA 1B3DA 1BUDA 3DNGA 3AIGA 1JKYA 3O2XA 3LK8A 5L7FA 3DSLA 3I7GA 3K7NA 3DPFA 4FVLA 1SMPA 830CA 4G0DA 4GR0A 1XM5A 4L6TA 4WZVA 4FU4A 3LIRA 3KRYA 3EHYA 3F15A 3EDZA 1FLSA 2J0TA 2D1NA 1GXDA 2JSDA 3DTEA 3KMCA 2PJTA
chains in the Genus database with same CATH topology
1IABA 3F17A 1ZTQA 2Y6DA 1GE7A 2AIGP 1ZP5A 1FM1A 1XFUA 1JANA 1Y0VA 3DTIA 1RMZA 3RTSA 1HFSA 1ZXVA 2OI0A 2W12A 1KUFA 1JH1A 4H76A 2E3XA 1CAQA 2D1OA 2WO8A 1IAGA 5CXAA 3I7IA 1OM6A 1SRPA 1PWUA 2O3EA 4FXYP 4H2EA 1ASTA 1K7QA 2A8HA 3DWBA 1Q3AA 1IAEA 3LUMA 1HV5A 3B8ZA 2RJQA 3G42A 1C7KA 5D3CA 2X7MA 1G9KA 1RM8A 1Y8JA 4IJOA 1JAOA 2JNPA 3DPEA 3HB2P 2AYKA 2WOAA 2K2GA 4WKIA 3P24A 2CKIA 4PKTA 1QIBA 3U1RA 3AYKA 2OXUA 3CKIA 3F16A 3WV1A 1PWVA 2YUFA 1XFVA 3V96B 5B5OA 1HOVA 1GKDA 5D1UA 1CGFA 1QIAA 1XFWA 5I2ZA 3EHXA 3KEJA 4GQLA 4JQGA 4H49A 1YCMA 4PKWA 3VI1A 1G12A 3L0TA 3ZUKA 3LJTA 4DV8A 2OY2A 1QJIA 1USNA 2DDFA 2OXWA 1OO9A 3LQ0A 5I4OA 2YIGA 1A86A 4JIJA 1AF0A 1QJJA 4DF9A 1YOUA 3HBUP 3Q2GA 2Y6CA 4ZR5A 1GO8P 1XFYA 3N2UA 1IADA 2W13A 1CQRA 1FBLA 5CZMA 1HY7A 2HU6A 4L19A 1JJ9A 1UMSA 2JT5A 1PWPA 3EDHA 2K9CA 4XBHA 1HTDA 1D5JA 1UEAA 2TCLA 3KEKA 4G9LA 4JA1A 1I76A 2E2DA 3VTGA 1CIZA 1BM6A 4I35A 2MLSA 3HBVP 3UVCA 1XURA 1I1IP 1CXVA 4GF1A 3HYGA 4XM7A 3LGPA 1XFZA 3LKAA 1QICA 3LIKA 1S4BP 1UTZA 2XS3A 1CGEA 1OM7A 2L0RA 1G49A 1ZVXA 2EROA 4IUWA 4PKSA 1C8TA 5BOYA 1KUKA 3B2ZA 2OW1A 1H71P 1SLNA 3HDAP 1AKLA 4JPAA 4PKVA 1SU3A 4AYKA 2OXZA 3OHOA 1DMTA 5D1TA 1CGLA 2KRJA 3LILA 1J7NA 2FV9A 3K7LA 1O0TA 2ERQA 1L6JA 2YB9A 3G5CA 4PKRA 1UTTA 1EB6A 3LJZA 1D7XA 1OS9A 1JAQA 2MLRA 4GWNA 2X3BA 1BQOA 3LUNA 4H30A 2X3CA 3F19A 4GR8A 3DTKA 5CUHA 3USNA 2OW2A 1AYKA 3WV3A 1JIWP 3N2VA 1MMPA 1MNCA 1EUBA 1JIZA 2CLTA 3MA2A 3RTTA 3KWVC 4I03A 1BIWA 2FV5A 4A3WA 1YQYA 2N8RA 1GE5A 2DW0A 1OM8A 1EAKA 3TT4A 1A85A 1CK7A 3AYUA 2J83A 1PWQA 5B5PA 1KAPP 2V4BA 3WV2A 1XUDA 3F1AA 4QKZA 4WK7A 1KUIA 2OW9A 1R1IA 3TSKA 1BZSA 2RJPA 4IN9A 2O36A 1R54A 2I47A 3KECA 4J4MA 1JK3A 456CA 3P1VA 5L79A 4HX3A 2X3AA 3LJGA 1C3IA 3LQBA 2DDYA 4H3XA 3F18A 3TVCA 4CTHA 4FXQA 5I43A 1KUGA 1GO7P 1IACA 2JIHA 3NX7A 4ON1A 2MZIA 1BSWA 3L0VA 3ELMA 2ERPA 1SLMA 1R1JA 1JAPA 3E8RA 2USNA 1HFCA 5BPAA 3GBOA 2DW2A 2W0DA 1YP1A 1ZS0A 3Q2HA 5D2BA 5I0LA 1IAAA 3HY7A 966CA 3TS4A 3OHLA 1Y93A 5LABA 2QPJA 1I73A 2SRTA 1MMBA 3HDBA 1K7IA 3LMCA 5H8XA 2MZEA 5D7WA 2OVXA 2OZRA 1KUHA 3LE9A 1QUAA 2MZHA 4XM6A 1OMJA 4H1QA 1BQQM 1BKCI 4XCTA 4EFSA 2W15A 3LEAA 2OW0A 1UMTA 4ILWD 1G05A 2Z2DA 5I3MA 3SHIA 3B92A 3KMEA 1MMQA 1GE6A 1XFXA 4H84A 4PKUA 5BOTA 4AUOA 1BKCE 1ND1A 3BA0A 4JP4A 1BKCA 4GWMA 4WKEA 4XM8A 1SATA 2DW1A 3EWJA 3ZVSA 1K7GA 3KHIA 3EDGA 1PWWA 1XUCA 4AXQA 5I12A 3HY9A 1R55A 3DL1A 2OY4A 4L7AA 2W14A 1MMRA 1ATLA 2JT6A 2POJA 1WNIA 4GUYA 4H82A 4GR3A 1ZXCA 4AIGA 4Q1LA 4R3VA 4HMAA 1BUVM 1KBCA 4WF6A 2WO9A 2OVZA 3ZXHA 4L63A 1G4KA 1B8YA 1GKCA 1D8FA 4PKQA 1ROSA 1D8MA 1R1HA 1O0QA 4DD8A 1OS2A 1DTHA 1Z3JA 3O64A 5JMYA 2XS4A 3EDIA 5D1SA 4A7BA 4DPEA 1B3DA 1BUDA 3DNGA 3AIGA 1JKYA 3O2XA 3LK8A 5L7FA 3DSLA 3I7GA 3K7NA 3DPFA 4FVLA 1SMPA 830CA 4G0DA 4GR0A 4L6TA 4WZVA 4FU4A 3LIRA 3KRYA 3EHYA 3F15A 3EDZA 1FLSA 2J0TA 2D1NA 1GXDA 2JSDA 3DTEA 3KMCA 2PJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAB A;  3F17 A;  1ZTQ A;  2Y6D A;  1GE7 A;  2AIG P;  1ZP5 A;  1FM1 A;  1XFU A;  1JAN A;  1Y0V A;  1RMZ A;  3RTS A;  1HFS A;  1ZXV A;  2OI0 A;  2W12 A;  1KUF A;  1JH1 A;  4H76 A;  2E3X A;  1CAQ A;  2D1O A;  2WO8 A;  1IAG A;  5CXA A;  3I7I A;  1OM6 A;  1SRP A;  1PWU A;  2O3E A;  4FXY P;  4H2E A;  1AST A;  1K7Q A;  2A8H A;  3DWB A;  1Q3A A;  1IAE A;  3LUM A;  1HV5 A;  3B8Z A;  2RJQ A;  3G42 A;  1C7K A;  5D3C A;  2X7M A;  1G9K A;  1RM8 A;  1Y8J A;  4IJO A;  1JAO A;  2JNP A;  3DPE A;  3HB2 P;  2AYK A;  2WOA A;  2K2G A;  4WKI A;  3P24 A;  2CKI A;  4PKT A;  1QIB A;  3U1R A;  3AYK A;  2OXU A;  3CKI A;  3F16 A;  3WV1 A;  1PWV A;  1XFV A;  3V96 B;  5B5O A;  1HOV A;  1GKD A;  5D1U A;  1CGF A;  1QIA A;  1XFW A;  5I2Z A;  3EHX A;  3KEJ A;  4GQL A;  4JQG A;  4H49 A;  1YCM A;  4PKW A;  3VI1 A;  1G12 A;  3L0T A;  3ZUK A;  3LJT A;  4DV8 A;  2OY2 A;  1QJI A;  1USN A;  2DDF A;  2OXW A;  1OO9 A;  3LQ0 A;  5I4O A;  2YIG A;  1A86 A;  4JIJ A;  1AF0 A;  1QJJ A;  4DF9 A;  1YOU A;  3HBU P;  3Q2G A;  2Y6C A;  4ZR5 A;  1GO8 P;  1XFY A;  3N2U A;  1IAD A;  2W13 A;  1CQR A;  1FBL A;  5CZM A;  1HY7 A;  2HU6 A;  4L19 A;  1JJ9 A;  1UMS A;  2JT5 A;  1PWP A;  3EDH A;  2K9C A;  4XBH A;  1HTD A;  1D5J A;  1UEA A;  2TCL A;  3KEK A;  4G9L A;  4JA1 A;  1I76 A;  2E2D A;  3VTG A;  1CIZ A;  1BM6 A;  4I35 A;  2MLS A;  3HBV P;  3UVC A;  1XUR A;  1I1I P;  1CXV A;  4GF1 A;  3HYG A;  4XM7 A;  3LGP A;  1XFZ A;  3LKA A;  1QIC A;  3LIK A;  1S4B P;  1UTZ A;  2XS3 A;  1CGE A;  1OM7 A;  2L0R A;  1G49 A;  1ZVX A;  2ERO A;  4IUW A;  4PKS A;  1C8T A;  5BOY A;  1KUK A;  3B2Z A;  2OW1 A;  1H71 P;  1SLN A;  3HDA P;  1AKL A;  4JPA A;  4PKV A;  1SU3 A;  4AYK A;  2OXZ A;  3OHO A;  1DMT A;  5D1T A;  1CGL A;  2KRJ A;  3LIL A;  1J7N A;  2FV9 A;  3K7L A;  1O0T A;  2ERQ A;  1L6J A;  2YB9 A;  3G5C A;  4PKR A;  1UTT A;  1EB6 A;  3LJZ A;  1D7X A;  1OS9 A;  1JAQ A;  2MLR A;  4GWN A;  2X3B A;  1BQO A;  3LUN A;  4H30 A;  2X3C A;  3F19 A;  4GR8 A;  5CUH A;  3USN A;  2OW2 A;  1AYK A;  3WV3 A;  1JIW P;  3N2V A;  1MMP A;  1MNC A;  1EUB A;  1JIZ A;  2CLT A;  3MA2 A;  3RTT A;  3KWV C;  4I03 A;  1BIW A;  2FV5 A;  4A3W A;  1YQY A;  2N8R A;  1GE5 A;  2DW0 A;  1OM8 A;  1EAK A;  3TT4 A;  1A85 A;  1CK7 A;  3AYU A;  2J83 A;  1PWQ A;  5B5P A;  1KAP P;  2V4B A;  3WV2 A;  1XUD A;  3F1A A;  4QKZ A;  4WK7 A;  1KUI A;  2OW9 A;  1R1I A;  3TSK A;  1BZS A;  2RJP A;  4IN9 A;  2O36 A;  1R54 A;  2I47 A;  3KEC A;  4J4M A;  1JK3 A;  456C A;  3P1V A;  5L79 A;  4HX3 A;  2X3A A;  3LJG A;  1C3I A;  3LQB A;  2DDY A;  4H3X A;  3F18 A;  3TVC A;  4CTH A;  4FXQ A;  5I43 A;  1KUG A;  1GO7 P;  1IAC A;  2JIH A;  3NX7 A;  4ON1 A;  2MZI A;  1BSW A;  3L0V A;  3ELM A;  2ERP A;  1SLM A;  1R1J A;  1JAP A;  3E8R A;  2USN A;  1HFC A;  5BPA A;  3GBO A;  2DW2 A;  2W0D A;  1YP1 A;  1ZS0 A;  3Q2H A;  5D2B A;  5I0L A;  1IAA A;  3HY7 A;  966C A;  3TS4 A;  3OHL A;  1Y93 A;  5LAB A;  2QPJ A;  1I73 A;  2SRT A;  1MMB A;  3HDB A;  1K7I A;  3LMC A;  5H8X A;  2MZE A;  5D7W A;  2OVX A;  2OZR A;  1KUH A;  3LE9 A;  1QUA A;  2MZH A;  4XM6 A;  1OMJ A;  4H1Q A;  1BQQ M;  1BKC I;  4XCT A;  4EFS A;  2W15 A;  3LEA A;  2OW0 A;  1UMT A;  4ILW D;  1G05 A;  2Z2D A;  5I3M A;  3SHI A;  3B92 A;  3KME A;  1MMQ A;  1GE6 A;  1XFX A;  4H84 A;  4PKU A;  5BOT A;  4AUO A;  1BKC E;  1ND1 A;  3BA0 A;  4JP4 A;  1BKC A;  4GWM A;  4WKE A;  4XM8 A;  1SAT A;  2DW1 A;  3EWJ A;  3ZVS A;  1K7G A;  3KHI A;  3EDG A;  1PWW A;  1XUC A;  4AXQ A;  5I12 A;  3HY9 A;  1R55 A;  3DL1 A;  2OY4 A;  2W14 A;  1MMR A;  1ATL A;  2JT6 A;  2POJ A;  1WNI A;  4GUY A;  4H82 A;  4GR3 A;  1ZXC A;  4AIG A;  4Q1L A;  4R3V A;  4HMA A;  1BUV M;  1KBC A;  4WF6 A;  2WO9 A;  2OVZ A;  3ZXH A;  4L63 A;  1G4K A;  1B8Y A;  1GKC A;  1D8F A;  4PKQ A;  1ROS A;  1D8M A;  1R1H A;  1O0Q A;  4DD8 A;  1OS2 A;  1DTH A;  1Z3J A;  3O64 A;  5JMY A;  2XS4 A;  3EDI A;  5D1S A;  4A7B A;  4DPE A;  1B3D A;  1BUD A;  3DNG A;  3AIG A;  1JKY A;  3O2X A;  3LK8 A;  5L7F A;  3DSL A;  3I7G A;  3K7N A;  3DPF A;  4FVL A;  1SMP A;  830C A;  4G0D A;  4GR0 A;  4L6T A;  4WZV A;  4FU4 A;  3LIR A;  3KRY A;  3EHY A;  3F15 A;  3EDZ A;  1FLS A;  2J0T A;  2D1N A;  1GXD A;  2JSD A;  3KMC A;  2PJT A; 
#chains in the Genus database with same CATH topology
 1IAB A;  3F17 A;  1ZTQ A;  2Y6D A;  1GE7 A;  2AIG P;  1ZP5 A;  1FM1 A;  1XFU A;  1JAN A;  1Y0V A;  3DTI A;  1RMZ A;  3RTS A;  1HFS A;  1ZXV A;  2OI0 A;  2W12 A;  1KUF A;  1JH1 A;  4H76 A;  2E3X A;  1CAQ A;  2D1O A;  2WO8 A;  1IAG A;  5CXA A;  3I7I A;  1OM6 A;  1SRP A;  1PWU A;  2O3E A;  4FXY P;  4H2E A;  1AST A;  1K7Q A;  1XAX A;  2A8H A;  3DWB A;  1Q3A A;  1IAE A;  3LUM A;  1HV5 A;  3B8Z A;  2RJQ A;  3G42 A;  1C7K A;  5D3C A;  2X7M A;  1G9K A;  1RM8 A;  1Y8J A;  4IJO A;  1JAO A;  2JNP A;  3DPE A;  3HB2 P;  2AYK A;  2WOA A;  2K2G A;  4WKI A;  3P24 A;  2CKI A;  4PKT A;  1QIB A;  3U1R A;  3AYK A;  2OXU A;  3CKI A;  3F16 A;  1OZ9 A;  3WV1 A;  1PWV A;  2YUF A;  1XFV A;  3V96 B;  5B5O A;  1HOV A;  1GKD A;  5D1U A;  1CGF A;  1QIA A;  1XFW A;  5I2Z A;  3EHX A;  3KEJ A;  4GQL A;  4JQG A;  4H49 A;  1YCM A;  4PKW A;  3VI1 A;  1G12 A;  3L0T A;  3ZUK A;  3LJT A;  4DV8 A;  2OY2 A;  1QJI A;  1USN A;  2DDF A;  2OXW A;  1OO9 A;  3LQ0 A;  5I4O A;  2YIG A;  1A86 A;  4JIJ A;  1AF0 A;  1QJJ A;  4DF9 A;  1YOU A;  3HBU P;  3Q2G A;  2Y6C A;  4ZR5 A;  1GO8 P;  1XFY A;  3N2U A;  1IAD A;  2W13 A;  1CQR A;  1FBL A;  5CZM A;  1HY7 A;  2HU6 A;  4L19 A;  1JJ9 A;  1UMS A;  2JT5 A;  1PWP A;  3EDH A;  2K9C A;  4XBH A;  1HTD A;  1D5J A;  1UEA A;  2TCL A;  3KEK A;  4G9L A;  4JA1 A;  1I76 A;  2E2D A;  3VTG A;  1CIZ A;  1BM6 A;  4I35 A;  2MLS A;  3HBV P;  3UVC A;  1XUR A;  1I1I P;  1CXV A;  4GF1 A;  3HYG A;  4XM7 A;  3LGP A;  1XFZ A;  3LKA A;  1QIC A;  3LIK A;  1S4B P;  1UTZ A;  2XS3 A;  1CGE A;  1OM7 A;  2L0R A;  1G49 A;  1ZVX A;  2ERO A;  4IUW A;  4PKS A;  1C8T A;  5BOY A;  1KUK A;  3B2Z A;  2OW1 A;  1H71 P;  1SLN A;  3HDA P;  1AKL A;  4JPA A;  4PKV A;  1SU3 A;  4AYK A;  2OXZ A;  3OHO A;  1DMT A;  5D1T A;  1CGL A;  2KRJ A;  3LIL A;  1J7N A;  2FV9 A;  3K7L A;  1O0T A;  2ERQ A;  1L6J A;  2YB9 A;  3G5C A;  4PKR A;  1UTT A;  1EB6 A;  3LJZ A;  1D7X A;  1OS9 A;  1JAQ A;  2MLR A;  4GWN A;  2X3B A;  1BQO A;  3LUN A;  4H30 A;  2X3C A;  3F19 A;  4GR8 A;  3DTK A;  5CUH A;  3USN A;  2OW2 A;  1AYK A;  3WV3 A;  1JIW P;  3N2V A;  1MMP A;  1MNC A;  1EUB A;  1JIZ A;  2CLT A;  3MA2 A;  3RTT A;  3KWV C;  4I03 A;  1BIW A;  2FV5 A;  4A3W A;  1YQY A;  2N8R A;  1GE5 A;  2DW0 A;  1OM8 A;  1EAK A;  3TT4 A;  1A85 A;  1CK7 A;  3AYU A;  2J83 A;  1PWQ A;  5B5P A;  1KAP P;  2V4B A;  3WV2 A;  1XUD A;  3F1A A;  1TVI A;  4QKZ A;  4WK7 A;  1KUI A;  2OW9 A;  1R1I A;  3TSK A;  1BZS A;  2RJP A;  4IN9 A;  2O36 A;  1R54 A;  2I47 A;  3KEC A;  4J4M A;  1JK3 A;  456C A;  3P1V A;  5L79 A;  4HX3 A;  2X3A A;  3LJG A;  1C3I A;  3LQB A;  2DDY A;  4H3X A;  3F18 A;  3TVC A;  4CTH A;  4FXQ A;  5I43 A;  1KUG A;  1GO7 P;  1IAC A;  2JIH A;  3NX7 A;  4ON1 A;  2MZI A;  1BSW A;  3L0V A;  3ELM A;  2ERP A;  1SLM A;  1R1J A;  1JAP A;  3E8R A;  2USN A;  1HFC A;  5BPA A;  3GBO A;  2DW2 A;  2W0D A;  1YP1 A;  1ZS0 A;  3Q2H A;  5D2B A;  5I0L A;  1IAA A;  3HY7 A;  966C A;  3TS4 A;  3OHL A;  1Y93 A;  5LAB A;  2QPJ A;  1I73 A;  2SRT A;  1MMB A;  3HDB A;  1K7I A;  3LMC A;  5H8X A;  2MZE A;  5D7W A;  2OVX A;  2OZR A;  1KUH A;  3LE9 A;  1QUA A;  2MZH A;  4XM6 A;  1OMJ A;  4H1Q A;  1BQQ M;  1BKC I;  4XCT A;  4EFS A;  2W15 A;  3LEA A;  2OW0 A;  1UMT A;  4ILW D;  1G05 A;  2Z2D A;  5I3M A;  3SHI A;  3B92 A;  3KME A;  1MMQ A;  1GE6 A;  1XFX A;  4H84 A;  4PKU A;  5BOT A;  4AUO A;  1BKC E;  1ND1 A;  3BA0 A;  4JP4 A;  1BKC A;  4GWM A;  4WKE A;  4XM8 A;  1SAT A;  2DW1 A;  3EWJ A;  3ZVS A;  1K7G A;  3KHI A;  3EDG A;  1PWW A;  1XUC A;  4AXQ A;  5I12 A;  3HY9 A;  1R55 A;  3DL1 A;  2OY4 A;  4L7A A;  2W14 A;  1MMR A;  1ATL A;  2JT6 A;  2POJ A;  1WNI A;  4GUY A;  4H82 A;  4GR3 A;  1ZXC A;  4AIG A;  4Q1L A;  4R3V A;  4HMA A;  1BUV M;  1KBC A;  4WF6 A;  2WO9 A;  2OVZ A;  3ZXH A;  4L63 A;  1G4K A;  1B8Y A;  1GKC A;  1D8F A;  4PKQ A;  1ROS A;  1D8M A;  1R1H A;  1O0Q A;  4DD8 A;  1OS2 A;  1DTH A;  1Z3J A;  3O64 A;  5JMY A;  2XS4 A;  3EDI A;  5D1S A;  4A7B A;  4DPE A;  1B3D A;  1BUD A;  3DNG A;  3AIG A;  1JKY A;  3O2X A;  3LK8 A;  5L7F A;  3DSL A;  3I7G A;  3K7N A;  3DPF A;  4FVL A;  1SMP A;  830C A;  4G0D A;  4GR0 A;  1XM5 A;  4L6T A;  4WZV A;  4FU4 A;  3LIR A;  3KRY A;  3EHY A;  3F15 A;  3EDZ A;  1FLS A;  2J0T A;  2D1N A;  1GXD A;  2JSD A;  3DTE A;  3KMC A;  2PJT A; 
#chains in the Genus database with same CATH homology
 1IAB A;  3F17 A;  1ZTQ A;  2Y6D A;  1GE7 A;  2AIG P;  1ZP5 A;  1FM1 A;  1XFU A;  1JAN A;  1Y0V A;  3DTI A;  1RMZ A;  3RTS A;  1HFS A;  1ZXV A;  2OI0 A;  2W12 A;  1KUF A;  1JH1 A;  4H76 A;  2E3X A;  1CAQ A;  2D1O A;  2WO8 A;  1IAG A;  5CXA A;  3I7I A;  1OM6 A;  1SRP A;  1PWU A;  2O3E A;  4FXY P;  4H2E A;  1AST A;  1K7Q A;  2A8H A;  3DWB A;  1Q3A A;  1IAE A;  3LUM A;  1HV5 A;  3B8Z A;  2RJQ A;  3G42 A;  1C7K A;  5D3C A;  2X7M A;  1G9K A;  1RM8 A;  1Y8J A;  4IJO A;  1JAO A;  2JNP A;  3DPE A;  3HB2 P;  2AYK A;  2WOA A;  2K2G A;  4WKI A;  3P24 A;  2CKI A;  4PKT A;  1QIB A;  3U1R A;  3AYK A;  2OXU A;  3CKI A;  3F16 A;  3WV1 A;  1PWV A;  2YUF A;  1XFV A;  3V96 B;  5B5O A;  1HOV A;  1GKD A;  5D1U A;  1CGF A;  1QIA A;  1XFW A;  5I2Z A;  3EHX A;  3KEJ A;  4GQL A;  4JQG A;  4H49 A;  1YCM A;  4PKW A;  3VI1 A;  1G12 A;  3L0T A;  3ZUK A;  3LJT A;  4DV8 A;  2OY2 A;  1QJI A;  1USN A;  2DDF A;  2OXW A;  1OO9 A;  3LQ0 A;  5I4O A;  2YIG A;  1A86 A;  4JIJ A;  1AF0 A;  1QJJ A;  4DF9 A;  1YOU A;  3HBU P;  3Q2G A;  2Y6C A;  4ZR5 A;  1GO8 P;  1XFY A;  3N2U A;  1IAD A;  2W13 A;  1CQR A;  1FBL A;  5CZM A;  1HY7 A;  2HU6 A;  4L19 A;  1JJ9 A;  1UMS A;  2JT5 A;  1PWP A;  3EDH A;  2K9C A;  4XBH A;  1HTD A;  1D5J A;  1UEA A;  2TCL A;  3KEK A;  4G9L A;  4JA1 A;  1I76 A;  2E2D A;  3VTG A;  1CIZ A;  1BM6 A;  4I35 A;  2MLS A;  3HBV P;  3UVC A;  1XUR A;  1I1I P;  1CXV A;  4GF1 A;  3HYG A;  4XM7 A;  3LGP A;  1XFZ A;  3LKA A;  1QIC A;  3LIK A;  1S4B P;  1UTZ A;  2XS3 A;  1CGE A;  1OM7 A;  2L0R A;  1G49 A;  1ZVX A;  2ERO A;  4IUW A;  4PKS A;  1C8T A;  5BOY A;  1KUK A;  3B2Z A;  2OW1 A;  1H71 P;  1SLN A;  3HDA P;  1AKL A;  4JPA A;  4PKV A;  1SU3 A;  4AYK A;  2OXZ A;  3OHO A;  1DMT A;  5D1T A;  1CGL A;  2KRJ A;  3LIL A;  1J7N A;  2FV9 A;  3K7L A;  1O0T A;  2ERQ A;  1L6J A;  2YB9 A;  3G5C A;  4PKR A;  1UTT A;  1EB6 A;  3LJZ A;  1D7X A;  1OS9 A;  1JAQ A;  2MLR A;  4GWN A;  2X3B A;  1BQO A;  3LUN A;  4H30 A;  2X3C A;  3F19 A;  4GR8 A;  3DTK A;  5CUH A;  3USN A;  2OW2 A;  1AYK A;  3WV3 A;  1JIW P;  3N2V A;  1MMP A;  1MNC A;  1EUB A;  1JIZ A;  2CLT A;  3MA2 A;  3RTT A;  3KWV C;  4I03 A;  1BIW A;  2FV5 A;  4A3W A;  1YQY A;  2N8R A;  1GE5 A;  2DW0 A;  1OM8 A;  1EAK A;  3TT4 A;  1A85 A;  1CK7 A;  3AYU A;  2J83 A;  1PWQ A;  5B5P A;  1KAP P;  2V4B A;  3WV2 A;  1XUD A;  3F1A A;  4QKZ A;  4WK7 A;  1KUI A;  2OW9 A;  1R1I A;  3TSK A;  1BZS A;  2RJP A;  4IN9 A;  2O36 A;  1R54 A;  2I47 A;  3KEC A;  4J4M A;  1JK3 A;  456C A;  3P1V A;  5L79 A;  4HX3 A;  2X3A A;  3LJG A;  1C3I A;  3LQB A;  2DDY A;  4H3X A;  3F18 A;  3TVC A;  4CTH A;  4FXQ A;  5I43 A;  1KUG A;  1GO7 P;  1IAC A;  2JIH A;  3NX7 A;  4ON1 A;  2MZI A;  1BSW A;  3L0V A;  3ELM A;  2ERP A;  1SLM A;  1R1J A;  1JAP A;  3E8R A;  2USN A;  1HFC A;  5BPA A;  3GBO A;  2DW2 A;  2W0D A;  1YP1 A;  1ZS0 A;  3Q2H A;  5D2B A;  5I0L A;  1IAA A;  3HY7 A;  966C A;  3TS4 A;  3OHL A;  1Y93 A;  5LAB A;  2QPJ A;  1I73 A;  2SRT A;  1MMB A;  3HDB A;  1K7I A;  3LMC A;  5H8X A;  2MZE A;  5D7W A;  2OVX A;  2OZR A;  1KUH A;  3LE9 A;  1QUA A;  2MZH A;  4XM6 A;  1OMJ A;  4H1Q A;  1BQQ M;  1BKC I;  4XCT A;  4EFS A;  2W15 A;  3LEA A;  2OW0 A;  1UMT A;  4ILW D;  1G05 A;  2Z2D A;  5I3M A;  3SHI A;  3B92 A;  3KME A;  1MMQ A;  1GE6 A;  1XFX A;  4H84 A;  4PKU A;  5BOT A;  4AUO A;  1BKC E;  1ND1 A;  3BA0 A;  4JP4 A;  1BKC A;  4GWM A;  4WKE A;  4XM8 A;  1SAT A;  2DW1 A;  3EWJ A;  3ZVS A;  1K7G A;  3KHI A;  3EDG A;  1PWW A;  1XUC A;  4AXQ A;  5I12 A;  3HY9 A;  1R55 A;  3DL1 A;  2OY4 A;  4L7A A;  2W14 A;  1MMR A;  1ATL A;  2JT6 A;  2POJ A;  1WNI A;  4GUY A;  4H82 A;  4GR3 A;  1ZXC A;  4AIG A;  4Q1L A;  4R3V A;  4HMA A;  1BUV M;  1KBC A;  4WF6 A;  2WO9 A;  2OVZ A;  3ZXH A;  4L63 A;  1G4K A;  1B8Y A;  1GKC A;  1D8F A;  4PKQ A;  1ROS A;  1D8M A;  1R1H A;  1O0Q A;  4DD8 A;  1OS2 A;  1DTH A;  1Z3J A;  3O64 A;  5JMY A;  2XS4 A;  3EDI A;  5D1S A;  4A7B A;  4DPE A;  1B3D A;  1BUD A;  3DNG A;  3AIG A;  1JKY A;  3O2X A;  3LK8 A;  5L7F A;  3DSL A;  3I7G A;  3K7N A;  3DPF A;  4FVL A;  1SMP A;  830C A;  4G0D A;  4GR0 A;  4L6T A;  4WZV A;  4FU4 A;  3LIR A;  3KRY A;  3EHY A;  3F15 A;  3EDZ A;  1FLS A;  2J0T A;  2D1N A;  1GXD A;  2JSD A;  3DTE A;  3KMC A;  2PJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...