2HU6A

Crystal structure of human mmp-12 in complex with acetohydroxamic acid and a bicyclic inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Synthesis of bicyclic molecular scaffolds (BTAa): an investigation towards new selective MMP-12 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2hu6A00
3F16A 4H2EA 4Q1LA 1K7GA 3AIGA 1MNCA 2POJA 1XFXA 3DSLA 5BOYA 1BQQM 2RJQA 4G0DA 4FVLA 2OY4A 4H82A 5CXAA 3ZXHA 3EDHA 1HY7A 3K7NA 3ELMA 3F17A 1SATA 1A86A 1OO9A 3EWJA 1IADA 1SMPA 2SRTA 3KECA 2J83A 1JAOA 1ZP5A 2DW0A 1JIWP 3EHYA 1CGFA 3P24A 3KRYA 5D1UA 2PJTA 3B92A 2MLSA 2OXZA 3I7GA 3ZVSA 2XS3A 3HDAP 1GE7A 3LQ0A 1GKCA 5D1TA 1QIAA 5B5PA 1XUDA 1RMZA 1J7NA 3OHLA 3WV1A 2OW1A 2WOAA 3WV2A 3CKIA 4DPEA 4ILWD 1BUVM 4FXQA 4DD8A 1HOVA 3EHXA 3WV3A 4GR0A 3BA0A 3LJZA 1ND1A 4FXYP 1SRPA 1GKDA 1MMQA 1YCMA 4G9LA 5BOTA 3KMEA 3TVCA 3F1AA 2JNPA 4GR8A 1XFZA 1JAQA 4PKVA 1PWWA 2W14A 1BIWA 5D1SA 1GE6A 4WK7A 2X7MA 2W13A 5H8XA 1CK7A 2OXUA 1OM6A 4AIGA 1JJ9A 1JK3A 5I3MA 1MMRA 2I47A 3LIRA 4H1QA 2TCLA 1EUBA 4FU4A 5LABA 3V96B 4GWNA 4WKIA 3MA2A 3HY9A 1OM7A 1CGEA 1XUCA 1G05A 1ZXVA 3LILA 1QJIA 3E8RA 2JT5A 3TS4A 3EDZA 1QICA 4WZVA 3LK8A 3VTGA 5D7WA 4PKQA 5JMYA 2WO8A 3N2UA 2KRJA 2MZIA 1FBLA 1YQYA 1Q3AA 2HU6A 1UTZA 3Q2GA 3N2VA 2EROA 1G12A 4H84A 2AYKA 1ZTQA 4PKSA 2OY2A 1EB6A 1YP1A 3LIKA 3KEKA 1A85A 3DNGA 2A8HA 1JAPA 1Y8JA 4XBHA 1R1IA 2O3EA 1AKLA 1R54A 4XCTA 3UVCA 1HFCA 4ZR5A 3DL1A 2E2DA 3DWBA 2OI0A 1XFVA 1JIZA 2N8RA 4AXQA 2ERPA 2DW2A 2DDYA 4JA1A 1BKCA 1R55A 5I0LA 1C7KA 2V4BA 4IJOA 2CLTA 1OM8A 1KAPP 1ZXCA 3LQBA 4PKWA 3K7LA 4I03A 3KWVC 1BUDA 1USNA 4PKUA 4HX3A 2WO9A 3L0VA 4GQLA 4GWMA 2Y6CA 2K9CA 3U1RA 1QJJA 4H76A 2K2GA 1ZVXA 1I76A 4L19A 2W0DA 2D1OA 1I73A 1D7XA 5BPAA 1EAKA 2DW1A 1CXVA 2OVZA 1SLNA 1PWQA 3EDGA 4EFSA 1S4BP 1KUHA 3KMCA 3P1VA 4XM6A 2MZHA 1BQOA 4H3XA 1O0QA 3HY7A 1CIZA 2OZRA 1SLMA 3RTTA 1PWVA 1G9KA 1D8MA 1H71P 2OW9A 4GUYA 1UMTA 2Y6DA 1D5JA 4R3VA 3AYUA 1G4KA 1XFWA 3B2ZA 5I2ZA 2FV9A 1OS9A 2JT6A 1GO7P 1C3IA 4GR3A 1HTDA 3L0TA 1PWUA 1K7IA 5L79A 1IACA 3OHOA 2X3AA 3KEJA 3KHIA 3AYKA 4A3WA 3HBVP 4PKTA 5CZMA 1GE5A 3EDIA 4WF6A 5I43A 1DTHA 1DMTA 1QUAA 2ERQA 2YIGA 3LJTA 1GXDA 4GF1A 3NX7A 1ATLA 4JIJA 4JPAA 5I4OA 2Z2DA 4IN9A 2D1NA 3HBUP 5B5OA 1BSWA 2X3BA 1R1JA 2USNA 1XURA 1KUIA 2OW0A 1ROSA 4A7BA 1AF0A 4XM7A 3F15A 1QIBA 1JANA 4DF9A 3RTSA 3LE9A 1HV5A 3HB2P 2OXWA 1JH1A 1I1IP 1FM1A 1OMJA 5CUHA 1WNIA 2W12A 1UEAA 4ON1A 1IABA 1R1HA 2L0RA 1IAGA 3LUMA 1BM6A 5I12A 3HYGA 1HFSA 456CA 2OVXA 1KUKA 3LGPA 2JSDA 3B8ZA 1KUFA 2X3CA 1ZS0A 1AYKA 4AUOA 1CQRA 5L7FA 1UTTA 1CGLA 3LMCA 1KBCA 4QKZA 3F19A 1B3DA 1YOUA 1MMPA 2AIGP 4JP4A 4IUWA 2YB9A 1XFUA 4PKRA 2XS4A 3TT4A 4L63A 4AYKA 3HDBA 1D8FA 3GBOA 1SU3A 3VI1A 1O0TA 3G5CA 2MLRA 1BKCE 4J4MA 3LEAA 4I35A 4XM8A 1KUGA 1BKCI 4CTHA 1PWPA 1MMBA 3SHIA 3F18A 966CA 3O64A 1K7QA 2O36A 4DV8A 1IAAA 830CA 4H49A 1XFYA 3DPEA 5D3CA 2W15A 3USNA 3TSKA 1Y0VA 1B8YA 3LUNA 1OS2A 1G49A 4H30A 5D2BA 2CKIA 4JQGA 1FLSA 1RM8A 3I7IA 1CAQA 1L6JA 1UMSA 2DDFA 1GO8P 1JKYA 2RJPA 3Q2HA 4HMAA 2MZEA 2FV5A 2JIHA 4L6TA 3O2XA 1BZSA 2OW2A 2QPJA 3LJGA 4WKEA 3DPFA 1C8TA 3G42A 3ZUKA 1ASTA 2E3XA 1Y93A 3LKAA 2J0TA 1Z3JA 1IAEA
chains in the Genus database with same CATH superfamily
3F16A 4H2EA 4Q1LA 1K7GA 3AIGA 1MNCA 2POJA 1XFXA 3DSLA 5BOYA 1BQQM 2RJQA 4G0DA 4FVLA 2OY4A 4H82A 5CXAA 3ZXHA 3EDHA 1HY7A 3K7NA 3ELMA 3F17A 1SATA 1A86A 1OO9A 3EWJA 1IADA 1SMPA 2SRTA 3KECA 2J83A 1JAOA 1ZP5A 2DW0A 1JIWP 3EHYA 1CGFA 3P24A 3KRYA 5D1UA 2PJTA 3B92A 2MLSA 2OXZA 3I7GA 3ZVSA 2XS3A 3HDAP 1GE7A 3LQ0A 1GKCA 5D1TA 1QIAA 5B5PA 1XUDA 1RMZA 1J7NA 3OHLA 3WV1A 2OW1A 2WOAA 3WV2A 3CKIA 4DPEA 4ILWD 1BUVM 4FXQA 4DD8A 1HOVA 3EHXA 3WV3A 4GR0A 3BA0A 3LJZA 1ND1A 4FXYP 1SRPA 1GKDA 1MMQA 1YCMA 4G9LA 5BOTA 3KMEA 3TVCA 3F1AA 2JNPA 4GR8A 1XFZA 1JAQA 4PKVA 1PWWA 2W14A 1BIWA 5D1SA 1GE6A 4WK7A 2X7MA 2W13A 5H8XA 1CK7A 2OXUA 1OM6A 4AIGA 1JJ9A 1JK3A 5I3MA 1MMRA 2I47A 3LIRA 4H1QA 2TCLA 1EUBA 4FU4A 5LABA 3V96B 4GWNA 4WKIA 3MA2A 3HY9A 1OM7A 1CGEA 1XUCA 1G05A 1ZXVA 3LILA 1QJIA 3E8RA 2JT5A 3TS4A 3EDZA 1QICA 4WZVA 3LK8A 3DTIA 3VTGA 5D7WA 4PKQA 5JMYA 2WO8A 3N2UA 2KRJA 2MZIA 1FBLA 1YQYA 1Q3AA 2HU6A 1UTZA 3Q2GA 3N2VA 2EROA 1G12A 4H84A 2AYKA 1ZTQA 4PKSA 2OY2A 1OZ9A 1EB6A 1YP1A 3LIKA 3KEKA 1A85A 3DNGA 2A8HA 1JAPA 1Y8JA 4XBHA 1R1IA 2O3EA 1AKLA 1R54A 4XCTA 3UVCA 1HFCA 4ZR5A 3DL1A 2E2DA 3DWBA 2OI0A 1XFVA 1JIZA 2N8RA 4AXQA 2ERPA 2DW2A 2DDYA 4JA1A 1BKCA 1R55A 5I0LA 1C7KA 2V4BA 4IJOA 2CLTA 1OM8A 1KAPP 1ZXCA 3LQBA 4PKWA 3K7LA 4I03A 3KWVC 1BUDA 1USNA 4PKUA 4HX3A 2WO9A 3L0VA 4GQLA 4GWMA 2Y6CA 2K9CA 3U1RA 1QJJA 4H76A 2K2GA 1ZVXA 1I76A 4L19A 2W0DA 4L7AA 2D1OA 1I73A 1D7XA 5BPAA 1EAKA 2DW1A 1CXVA 2OVZA 1SLNA 1PWQA 3EDGA 3DTEA 1S4BP 4EFSA 1KUHA 3KMCA 3P1VA 4XM6A 2MZHA 1BQOA 4H3XA 1O0QA 3HY7A 1CIZA 2OZRA 1SLMA 3RTTA 1PWVA 1G9KA 1D8MA 1H71P 2OW9A 4GUYA 1UMTA 2Y6DA 1D5JA 4R3VA 3AYUA 1G4KA 1XFWA 3B2ZA 5I2ZA 2FV9A 1OS9A 2JT6A 1GO7P 1C3IA 4GR3A 1HTDA 3L0TA 1PWUA 1K7IA 5L79A 1IACA 3OHOA 2X3AA 3KEJA 3KHIA 3AYKA 4A3WA 3HBVP 4PKTA 5CZMA 1GE5A 3EDIA 4WF6A 5I43A 1DTHA 1DMTA 1QUAA 2ERQA 2YIGA 3LJTA 1GXDA 4GF1A 3NX7A 1ATLA 4JIJA 4JPAA 5I4OA 2Z2DA 2YUFA 4IN9A 2D1NA 3HBUP 5B5OA 1BSWA 2X3BA 1R1JA 2USNA 1XURA 1KUIA 2OW0A 1ROSA 4A7BA 1AF0A 4XM7A 3F15A 1QIBA 1JANA 4DF9A 3RTSA 3LE9A 1HV5A 3HB2P 2OXWA 1JH1A 1I1IP 1FM1A 1OMJA 5CUHA 1WNIA 2W12A 1UEAA 4ON1A 1IABA 1R1HA 2L0RA 1IAGA 3LUMA 1BM6A 5I12A 1XAXA 3HYGA 1HFSA 456CA 2OVXA 1KUKA 3LGPA 2JSDA 3B8ZA 1KUFA 2X3CA 1ZS0A 1AYKA 4AUOA 1CQRA 1TVIA 5L7FA 1UTTA 1CGLA 3LMCA 1KBCA 4QKZA 1XM5A 3F19A 1B3DA 1YOUA 1MMPA 2AIGP 4JP4A 4IUWA 2YB9A 1XFUA 4PKRA 2XS4A 3TT4A 4L63A 4AYKA 3HDBA 1D8FA 3GBOA 1SU3A 3VI1A 1O0TA 3G5CA 2MLRA 1BKCE 4J4MA 3LEAA 4I35A 4XM8A 1KUGA 1BKCI 4CTHA 1PWPA 1MMBA 3SHIA 3F18A 966CA 3O64A 1K7QA 2O36A 4DV8A 1IAAA 830CA 4H49A 1XFYA 3DPEA 5D3CA 2W15A 3USNA 3TSKA 1Y0VA 1B8YA 3LUNA 1OS2A 1G49A 4H30A 5D2BA 2CKIA 4JQGA 1FLSA 1RM8A 3I7IA 1CAQA 1L6JA 1UMSA 2DDFA 1GO8P 1JKYA 2RJPA 3Q2HA 4HMAA 2MZEA 3DTKA 2FV5A 2JIHA 4L6TA 3O2XA 1BZSA 2OW2A 2QPJA 3LJGA 4WKEA 3DPFA 1C8TA 3G42A 3ZUKA 1ASTA 2E3XA 1Y93A 3LKAA 2J0TA 1Z3JA 1IAEA
chains in the Genus database with same CATH topology
3F16A 4H2EA 4Q1LA 1K7GA 3AIGA 1MNCA 2POJA 1XFXA 3DSLA 5BOYA 1BQQM 2RJQA 4G0DA 4FVLA 2OY4A 4H82A 5CXAA 3ZXHA 3EDHA 1HY7A 3K7NA 3ELMA 3F17A 1SATA 1A86A 1OO9A 3EWJA 1IADA 1SMPA 2SRTA 3KECA 2J83A 1JAOA 1ZP5A 2DW0A 1JIWP 3EHYA 1CGFA 3P24A 3KRYA 5D1UA 2PJTA 3B92A 2MLSA 2OXZA 3I7GA 3ZVSA 2XS3A 3HDAP 1GE7A 3LQ0A 1GKCA 5D1TA 1QIAA 5B5PA 1XUDA 1RMZA 1J7NA 3OHLA 3WV1A 2OW1A 2WOAA 3WV2A 3CKIA 4DPEA 4ILWD 1BUVM 4FXQA 4DD8A 1HOVA 3EHXA 3WV3A 4GR0A 3BA0A 3LJZA 1ND1A 4FXYP 1SRPA 1GKDA 1MMQA 1YCMA 4G9LA 5BOTA 3KMEA 3TVCA 3F1AA 2JNPA 4GR8A 1XFZA 1JAQA 4PKVA 1PWWA 2W14A 1BIWA 5D1SA 1GE6A 4WK7A 2X7MA 2W13A 5H8XA 1CK7A 2OXUA 1OM6A 4AIGA 1JJ9A 1JK3A 5I3MA 1MMRA 2I47A 3LIRA 4H1QA 2TCLA 1EUBA 4FU4A 5LABA 3V96B 4GWNA 4WKIA 3MA2A 3HY9A 1OM7A 1CGEA 1XUCA 1G05A 1ZXVA 3LILA 1QJIA 3E8RA 2JT5A 3TS4A 3EDZA 1QICA 4WZVA 3LK8A 3DTIA 3VTGA 5D7WA 4PKQA 5JMYA 2WO8A 3N2UA 2KRJA 2MZIA 1FBLA 1YQYA 1Q3AA 2HU6A 1UTZA 3Q2GA 3N2VA 2EROA 1G12A 4H84A 2AYKA 1ZTQA 4PKSA 2OY2A 1EB6A 1YP1A 3LIKA 3KEKA 1A85A 3DNGA 2A8HA 1JAPA 1Y8JA 4XBHA 1R1IA 2O3EA 1AKLA 1R54A 4XCTA 3UVCA 1HFCA 4ZR5A 3DL1A 2E2DA 3DWBA 2OI0A 1XFVA 1JIZA 2N8RA 4AXQA 2ERPA 2DW2A 2DDYA 4JA1A 1BKCA 1R55A 5I0LA 1C7KA 2V4BA 4IJOA 2CLTA 1OM8A 1KAPP 1ZXCA 3LQBA 4PKWA 3K7LA 4I03A 3KWVC 1BUDA 1USNA 4PKUA 4HX3A 2WO9A 3L0VA 4GQLA 4GWMA 2Y6CA 2K9CA 3U1RA 1QJJA 4H76A 2K2GA 1ZVXA 1I76A 4L19A 2W0DA 4L7AA 2D1OA 1I73A 1D7XA 5BPAA 1EAKA 2DW1A 1CXVA 2OVZA 1SLNA 1PWQA 3EDGA 3DTEA 1S4BP 4EFSA 1KUHA 3KMCA 3P1VA 4XM6A 2MZHA 1BQOA 4H3XA 1O0QA 3HY7A 1CIZA 2OZRA 1SLMA 3RTTA 1PWVA 1G9KA 1D8MA 1H71P 2OW9A 4GUYA 1UMTA 2Y6DA 1D5JA 4R3VA 3AYUA 1G4KA 1XFWA 3B2ZA 5I2ZA 2FV9A 1OS9A 2JT6A 1GO7P 1C3IA 4GR3A 1HTDA 3L0TA 1PWUA 1K7IA 5L79A 1IACA 3OHOA 2X3AA 3KEJA 3KHIA 3AYKA 4A3WA 3HBVP 4PKTA 5CZMA 1GE5A 3EDIA 4WF6A 5I43A 1DTHA 1DMTA 1QUAA 2ERQA 2YIGA 3LJTA 1GXDA 4GF1A 3NX7A 1ATLA 4JIJA 4JPAA 5I4OA 2Z2DA 2YUFA 4IN9A 2D1NA 3HBUP 5B5OA 1BSWA 2X3BA 1R1JA 2USNA 1XURA 1KUIA 2OW0A 1ROSA 4A7BA 1AF0A 4XM7A 3F15A 1QIBA 1JANA 4DF9A 3RTSA 3LE9A 1HV5A 3HB2P 2OXWA 1JH1A 1I1IP 1FM1A 1OMJA 5CUHA 1WNIA 2W12A 1UEAA 4ON1A 1IABA 1R1HA 2L0RA 1IAGA 3LUMA 1BM6A 5I12A 3HYGA 1HFSA 456CA 2OVXA 1KUKA 3LGPA 2JSDA 3B8ZA 1KUFA 2X3CA 1ZS0A 1AYKA 4AUOA 1CQRA 5L7FA 1UTTA 1CGLA 3LMCA 1KBCA 4QKZA 3F19A 1B3DA 1YOUA 1MMPA 2AIGP 4JP4A 4IUWA 2YB9A 1XFUA 4PKRA 2XS4A 3TT4A 4L63A 4AYKA 3HDBA 1D8FA 3GBOA 1SU3A 3VI1A 1O0TA 3G5CA 2MLRA 1BKCE 4J4MA 3LEAA 4I35A 4XM8A 1KUGA 1BKCI 4CTHA 1PWPA 1MMBA 3SHIA 3F18A 966CA 3O64A 1K7QA 2O36A 4DV8A 1IAAA 830CA 4H49A 1XFYA 3DPEA 5D3CA 2W15A 3USNA 3TSKA 1Y0VA 1B8YA 3LUNA 1OS2A 1G49A 4H30A 5D2BA 2CKIA 4JQGA 1FLSA 1RM8A 3I7IA 1CAQA 1L6JA 1UMSA 2DDFA 1GO8P 1JKYA 2RJPA 3Q2HA 4HMAA 2MZEA 3DTKA 2FV5A 2JIHA 4L6TA 3O2XA 1BZSA 2OW2A 2QPJA 3LJGA 4WKEA 3DPFA 1C8TA 3G42A 3ZUKA 1ASTA 2E3XA 1Y93A 3LKAA 2J0TA 1Z3JA 1IAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F16 A;  4H2E A;  4Q1L A;  1K7G A;  3AIG A;  1MNC A;  2POJ A;  1XFX A;  3DSL A;  5BOY A;  1BQQ M;  2RJQ A;  4G0D A;  4FVL A;  2OY4 A;  4H82 A;  5CXA A;  3ZXH A;  3EDH A;  1HY7 A;  3K7N A;  3ELM A;  3F17 A;  1SAT A;  1A86 A;  1OO9 A;  3EWJ A;  1IAD A;  1SMP A;  2SRT A;  3KEC A;  2J83 A;  1JAO A;  1ZP5 A;  2DW0 A;  1JIW P;  3EHY A;  1CGF A;  3P24 A;  3KRY A;  5D1U A;  2PJT A;  3B92 A;  2MLS A;  2OXZ A;  3I7G A;  3ZVS A;  2XS3 A;  3HDA P;  1GE7 A;  3LQ0 A;  1GKC A;  5D1T A;  1QIA A;  5B5P A;  1XUD A;  1RMZ A;  1J7N A;  3OHL A;  3WV1 A;  2OW1 A;  2WOA A;  3WV2 A;  3CKI A;  4DPE A;  4ILW D;  1BUV M;  4FXQ A;  4DD8 A;  1HOV A;  3EHX A;  3WV3 A;  4GR0 A;  3BA0 A;  3LJZ A;  1ND1 A;  4FXY P;  1SRP A;  1GKD A;  1MMQ A;  1YCM A;  4G9L A;  5BOT A;  3KME A;  3TVC A;  3F1A A;  2JNP A;  4GR8 A;  1XFZ A;  1JAQ A;  4PKV A;  1PWW A;  2W14 A;  1BIW A;  5D1S A;  1GE6 A;  4WK7 A;  2X7M A;  2W13 A;  5H8X A;  1CK7 A;  2OXU A;  1OM6 A;  4AIG A;  1JJ9 A;  1JK3 A;  5I3M A;  1MMR A;  2I47 A;  3LIR A;  4H1Q A;  2TCL A;  1EUB A;  4FU4 A;  5LAB A;  3V96 B;  4GWN A;  4WKI A;  3MA2 A;  3HY9 A;  1OM7 A;  1CGE A;  1XUC A;  1G05 A;  1ZXV A;  3LIL A;  1QJI A;  3E8R A;  2JT5 A;  3TS4 A;  3EDZ A;  1QIC A;  4WZV A;  3LK8 A;  3VTG A;  5D7W A;  4PKQ A;  5JMY A;  2WO8 A;  3N2U A;  2KRJ A;  2MZI A;  1FBL A;  1YQY A;  1Q3A A;  2HU6 A;  1UTZ A;  3Q2G A;  3N2V A;  2ERO A;  1G12 A;  4H84 A;  2AYK A;  1ZTQ A;  4PKS A;  2OY2 A;  1EB6 A;  1YP1 A;  3LIK A;  3KEK A;  1A85 A;  3DNG A;  2A8H A;  1JAP A;  1Y8J A;  4XBH A;  1R1I A;  2O3E A;  1AKL A;  1R54 A;  4XCT A;  3UVC A;  1HFC A;  4ZR5 A;  3DL1 A;  2E2D A;  3DWB A;  2OI0 A;  1XFV A;  1JIZ A;  2N8R A;  4AXQ A;  2ERP A;  2DW2 A;  2DDY A;  4JA1 A;  1BKC A;  1R55 A;  5I0L A;  1C7K A;  2V4B A;  4IJO A;  2CLT A;  1OM8 A;  1KAP P;  1ZXC A;  3LQB A;  4PKW A;  3K7L A;  4I03 A;  3KWV C;  1BUD A;  1USN A;  4PKU A;  4HX3 A;  2WO9 A;  3L0V A;  4GQL A;  4GWM A;  2Y6C A;  2K9C A;  3U1R A;  1QJJ A;  4H76 A;  2K2G A;  1ZVX A;  1I76 A;  4L19 A;  2W0D A;  2D1O A;  1I73 A;  1D7X A;  5BPA A;  1EAK A;  2DW1 A;  1CXV A;  2OVZ A;  1SLN A;  1PWQ A;  3EDG A;  4EFS A;  1S4B P;  1KUH A;  3KMC A;  3P1V A;  4XM6 A;  2MZH A;  1BQO A;  4H3X A;  1O0Q A;  3HY7 A;  1CIZ A;  2OZR A;  1SLM A;  3RTT A;  1PWV A;  1G9K A;  1D8M A;  1H71 P;  2OW9 A;  4GUY A;  1UMT A;  2Y6D A;  1D5J A;  4R3V A;  3AYU A;  1G4K A;  1XFW A;  3B2Z A;  5I2Z A;  2FV9 A;  1OS9 A;  2JT6 A;  1GO7 P;  1C3I A;  4GR3 A;  1HTD A;  3L0T A;  1PWU A;  1K7I A;  5L79 A;  1IAC A;  3OHO A;  2X3A A;  3KEJ A;  3KHI A;  3AYK A;  4A3W A;  3HBV P;  4PKT A;  5CZM A;  1GE5 A;  3EDI A;  4WF6 A;  5I43 A;  1DTH A;  1DMT A;  1QUA A;  2ERQ A;  2YIG A;  3LJT A;  1GXD A;  4GF1 A;  3NX7 A;  1ATL A;  4JIJ A;  4JPA A;  5I4O A;  2Z2D A;  4IN9 A;  2D1N A;  3HBU P;  5B5O A;  1BSW A;  2X3B A;  1R1J A;  2USN A;  1XUR A;  1KUI A;  2OW0 A;  1ROS A;  4A7B A;  1AF0 A;  4XM7 A;  3F15 A;  1QIB A;  1JAN A;  4DF9 A;  3RTS A;  3LE9 A;  1HV5 A;  3HB2 P;  2OXW A;  1JH1 A;  1I1I P;  1FM1 A;  1OMJ A;  5CUH A;  1WNI A;  2W12 A;  1UEA A;  4ON1 A;  1IAB A;  1R1H A;  2L0R A;  1IAG A;  3LUM A;  1BM6 A;  5I12 A;  3HYG A;  1HFS A;  456C A;  2OVX A;  1KUK A;  3LGP A;  2JSD A;  3B8Z A;  1KUF A;  2X3C A;  1ZS0 A;  1AYK A;  4AUO A;  1CQR A;  5L7F A;  1UTT A;  1CGL A;  3LMC A;  1KBC A;  4QKZ A;  3F19 A;  1B3D A;  1YOU A;  1MMP A;  2AIG P;  4JP4 A;  4IUW A;  2YB9 A;  1XFU A;  4PKR A;  2XS4 A;  3TT4 A;  4L63 A;  4AYK A;  3HDB A;  1D8F A;  3GBO A;  1SU3 A;  3VI1 A;  1O0T A;  3G5C A;  2MLR A;  1BKC E;  4J4M A;  3LEA A;  4I35 A;  4XM8 A;  1KUG A;  1BKC I;  4CTH A;  1PWP A;  1MMB A;  3SHI A;  3F18 A;  966C A;  3O64 A;  1K7Q A;  2O36 A;  4DV8 A;  1IAA A;  830C A;  4H49 A;  1XFY A;  3DPE A;  5D3C A;  2W15 A;  3USN A;  3TSK A;  1Y0V A;  1B8Y A;  3LUN A;  1OS2 A;  1G49 A;  4H30 A;  5D2B A;  2CKI A;  4JQG A;  1FLS A;  1RM8 A;  3I7I A;  1CAQ A;  1L6J A;  1UMS A;  2DDF A;  1GO8 P;  1JKY A;  2RJP A;  3Q2H A;  4HMA A;  2MZE A;  2FV5 A;  2JIH A;  4L6T A;  3O2X A;  1BZS A;  2OW2 A;  2QPJ A;  3LJG A;  4WKE A;  3DPF A;  1C8T A;  3G42 A;  3ZUK A;  1AST A;  2E3X A;  1Y93 A;  3LKA A;  2J0T A;  1Z3J A;  1IAE A; 
#chains in the Genus database with same CATH topology
 3F16 A;  4H2E A;  4Q1L A;  1K7G A;  3AIG A;  1MNC A;  2POJ A;  1XFX A;  3DSL A;  5BOY A;  1BQQ M;  2RJQ A;  4G0D A;  4FVL A;  2OY4 A;  4H82 A;  5CXA A;  3ZXH A;  3EDH A;  1HY7 A;  3K7N A;  3ELM A;  3F17 A;  1SAT A;  1A86 A;  1OO9 A;  3EWJ A;  1IAD A;  1SMP A;  2SRT A;  3KEC A;  2J83 A;  1JAO A;  1ZP5 A;  2DW0 A;  1JIW P;  3EHY A;  1CGF A;  3P24 A;  3KRY A;  5D1U A;  2PJT A;  3B92 A;  2MLS A;  2OXZ A;  3I7G A;  3ZVS A;  2XS3 A;  3HDA P;  1GE7 A;  3LQ0 A;  1GKC A;  5D1T A;  1QIA A;  5B5P A;  1XUD A;  1RMZ A;  1J7N A;  3OHL A;  3WV1 A;  2OW1 A;  2WOA A;  3WV2 A;  3CKI A;  4DPE A;  4ILW D;  1BUV M;  4FXQ A;  4DD8 A;  1HOV A;  3EHX A;  3WV3 A;  4GR0 A;  3BA0 A;  3LJZ A;  1ND1 A;  4FXY P;  1SRP A;  1GKD A;  1MMQ A;  1YCM A;  4G9L A;  5BOT A;  3KME A;  3TVC A;  3F1A A;  2JNP A;  4GR8 A;  1XFZ A;  1JAQ A;  4PKV A;  1PWW A;  2W14 A;  1BIW A;  5D1S A;  1GE6 A;  4WK7 A;  2X7M A;  2W13 A;  5H8X A;  1CK7 A;  2OXU A;  1OM6 A;  4AIG A;  1JJ9 A;  1JK3 A;  5I3M A;  1MMR A;  2I47 A;  3LIR A;  4H1Q A;  2TCL A;  1EUB A;  4FU4 A;  5LAB A;  3V96 B;  4GWN A;  4WKI A;  3MA2 A;  3HY9 A;  1OM7 A;  1CGE A;  1XUC A;  1G05 A;  1ZXV A;  3LIL A;  1QJI A;  3E8R A;  2JT5 A;  3TS4 A;  3EDZ A;  1QIC A;  4WZV A;  3LK8 A;  3DTI A;  3VTG A;  5D7W A;  4PKQ A;  5JMY A;  2WO8 A;  3N2U A;  2KRJ A;  2MZI A;  1FBL A;  1YQY A;  1Q3A A;  2HU6 A;  1UTZ A;  3Q2G A;  3N2V A;  2ERO A;  1G12 A;  4H84 A;  2AYK A;  1ZTQ A;  4PKS A;  2OY2 A;  1OZ9 A;  1EB6 A;  1YP1 A;  3LIK A;  3KEK A;  1A85 A;  3DNG A;  2A8H A;  1JAP A;  1Y8J A;  4XBH A;  1R1I A;  2O3E A;  1AKL A;  1R54 A;  4XCT A;  3UVC A;  1HFC A;  4ZR5 A;  3DL1 A;  2E2D A;  3DWB A;  2OI0 A;  1XFV A;  1JIZ A;  2N8R A;  4AXQ A;  2ERP A;  2DW2 A;  2DDY A;  4JA1 A;  1BKC A;  1R55 A;  5I0L A;  1C7K A;  2V4B A;  4IJO A;  2CLT A;  1OM8 A;  1KAP P;  1ZXC A;  3LQB A;  4PKW A;  3K7L A;  4I03 A;  3KWV C;  1BUD A;  1USN A;  4PKU A;  4HX3 A;  2WO9 A;  3L0V A;  4GQL A;  4GWM A;  2Y6C A;  2K9C A;  3U1R A;  1QJJ A;  4H76 A;  2K2G A;  1ZVX A;  1I76 A;  4L19 A;  2W0D A;  4L7A A;  2D1O A;  1I73 A;  1D7X A;  5BPA A;  1EAK A;  2DW1 A;  1CXV A;  2OVZ A;  1SLN A;  1PWQ A;  3EDG A;  3DTE A;  1S4B P;  4EFS A;  1KUH A;  3KMC A;  3P1V A;  4XM6 A;  2MZH A;  1BQO A;  4H3X A;  1O0Q A;  3HY7 A;  1CIZ A;  2OZR A;  1SLM A;  3RTT A;  1PWV A;  1G9K A;  1D8M A;  1H71 P;  2OW9 A;  4GUY A;  1UMT A;  2Y6D A;  1D5J A;  4R3V A;  3AYU A;  1G4K A;  1XFW A;  3B2Z A;  5I2Z A;  2FV9 A;  1OS9 A;  2JT6 A;  1GO7 P;  1C3I A;  4GR3 A;  1HTD A;  3L0T A;  1PWU A;  1K7I A;  5L79 A;  1IAC A;  3OHO A;  2X3A A;  3KEJ A;  3KHI A;  3AYK A;  4A3W A;  3HBV P;  4PKT A;  5CZM A;  1GE5 A;  3EDI A;  4WF6 A;  5I43 A;  1DTH A;  1DMT A;  1QUA A;  2ERQ A;  2YIG A;  3LJT A;  1GXD A;  4GF1 A;  3NX7 A;  1ATL A;  4JIJ A;  4JPA A;  5I4O A;  2Z2D A;  2YUF A;  4IN9 A;  2D1N A;  3HBU P;  5B5O A;  1BSW A;  2X3B A;  1R1J A;  2USN A;  1XUR A;  1KUI A;  2OW0 A;  1ROS A;  4A7B A;  1AF0 A;  4XM7 A;  3F15 A;  1QIB A;  1JAN A;  4DF9 A;  3RTS A;  3LE9 A;  1HV5 A;  3HB2 P;  2OXW A;  1JH1 A;  1I1I P;  1FM1 A;  1OMJ A;  5CUH A;  1WNI A;  2W12 A;  1UEA A;  4ON1 A;  1IAB A;  1R1H A;  2L0R A;  1IAG A;  3LUM A;  1BM6 A;  5I12 A;  1XAX A;  3HYG A;  1HFS A;  456C A;  2OVX A;  1KUK A;  3LGP A;  2JSD A;  3B8Z A;  1KUF A;  2X3C A;  1ZS0 A;  1AYK A;  4AUO A;  1CQR A;  1TVI A;  5L7F A;  1UTT A;  1CGL A;  3LMC A;  1KBC A;  4QKZ A;  1XM5 A;  3F19 A;  1B3D A;  1YOU A;  1MMP A;  2AIG P;  4JP4 A;  4IUW A;  2YB9 A;  1XFU A;  4PKR A;  2XS4 A;  3TT4 A;  4L63 A;  4AYK A;  3HDB A;  1D8F A;  3GBO A;  1SU3 A;  3VI1 A;  1O0T A;  3G5C A;  2MLR A;  1BKC E;  4J4M A;  3LEA A;  4I35 A;  4XM8 A;  1KUG A;  1BKC I;  4CTH A;  1PWP A;  1MMB A;  3SHI A;  3F18 A;  966C A;  3O64 A;  1K7Q A;  2O36 A;  4DV8 A;  1IAA A;  830C A;  4H49 A;  1XFY A;  3DPE A;  5D3C A;  2W15 A;  3USN A;  3TSK A;  1Y0V A;  1B8Y A;  3LUN A;  1OS2 A;  1G49 A;  4H30 A;  5D2B A;  2CKI A;  4JQG A;  1FLS A;  1RM8 A;  3I7I A;  1CAQ A;  1L6J A;  1UMS A;  2DDF A;  1GO8 P;  1JKY A;  2RJP A;  3Q2H A;  4HMA A;  2MZE A;  3DTK A;  2FV5 A;  2JIH A;  4L6T A;  3O2X A;  1BZS A;  2OW2 A;  2QPJ A;  3LJG A;  4WKE A;  3DPF A;  1C8T A;  3G42 A;  3ZUK A;  1AST A;  2E3X A;  1Y93 A;  3LKA A;  2J0T A;  1Z3J A;  1IAE A; 
#chains in the Genus database with same CATH homology
 3F16 A;  4H2E A;  4Q1L A;  1K7G A;  3AIG A;  1MNC A;  2POJ A;  1XFX A;  3DSL A;  5BOY A;  1BQQ M;  2RJQ A;  4G0D A;  4FVL A;  2OY4 A;  4H82 A;  5CXA A;  3ZXH A;  3EDH A;  1HY7 A;  3K7N A;  3ELM A;  3F17 A;  1SAT A;  1A86 A;  1OO9 A;  3EWJ A;  1IAD A;  1SMP A;  2SRT A;  3KEC A;  2J83 A;  1JAO A;  1ZP5 A;  2DW0 A;  1JIW P;  3EHY A;  1CGF A;  3P24 A;  3KRY A;  5D1U A;  2PJT A;  3B92 A;  2MLS A;  2OXZ A;  3I7G A;  3ZVS A;  2XS3 A;  3HDA P;  1GE7 A;  3LQ0 A;  1GKC A;  5D1T A;  1QIA A;  5B5P A;  1XUD A;  1RMZ A;  1J7N A;  3OHL A;  3WV1 A;  2OW1 A;  2WOA A;  3WV2 A;  3CKI A;  4DPE A;  4ILW D;  1BUV M;  4FXQ A;  4DD8 A;  1HOV A;  3EHX A;  3WV3 A;  4GR0 A;  3BA0 A;  3LJZ A;  1ND1 A;  4FXY P;  1SRP A;  1GKD A;  1MMQ A;  1YCM A;  4G9L A;  5BOT A;  3KME A;  3TVC A;  3F1A A;  2JNP A;  4GR8 A;  1XFZ A;  1JAQ A;  4PKV A;  1PWW A;  2W14 A;  1BIW A;  5D1S A;  1GE6 A;  4WK7 A;  2X7M A;  2W13 A;  5H8X A;  1CK7 A;  2OXU A;  1OM6 A;  4AIG A;  1JJ9 A;  1JK3 A;  5I3M A;  1MMR A;  2I47 A;  3LIR A;  4H1Q A;  2TCL A;  1EUB A;  4FU4 A;  5LAB A;  3V96 B;  4GWN A;  4WKI A;  3MA2 A;  3HY9 A;  1OM7 A;  1CGE A;  1XUC A;  1G05 A;  1ZXV A;  3LIL A;  1QJI A;  3E8R A;  2JT5 A;  3TS4 A;  3EDZ A;  1QIC A;  4WZV A;  3LK8 A;  3DTI A;  3VTG A;  5D7W A;  4PKQ A;  5JMY A;  2WO8 A;  3N2U A;  2KRJ A;  2MZI A;  1FBL A;  1YQY A;  1Q3A A;  2HU6 A;  1UTZ A;  3Q2G A;  3N2V A;  2ERO A;  1G12 A;  4H84 A;  2AYK A;  1ZTQ A;  4PKS A;  2OY2 A;  1EB6 A;  1YP1 A;  3LIK A;  3KEK A;  1A85 A;  3DNG A;  2A8H A;  1JAP A;  1Y8J A;  4XBH A;  1R1I A;  2O3E A;  1AKL A;  1R54 A;  4XCT A;  3UVC A;  1HFC A;  4ZR5 A;  3DL1 A;  2E2D A;  3DWB A;  2OI0 A;  1XFV A;  1JIZ A;  2N8R A;  4AXQ A;  2ERP A;  2DW2 A;  2DDY A;  4JA1 A;  1BKC A;  1R55 A;  5I0L A;  1C7K A;  2V4B A;  4IJO A;  2CLT A;  1OM8 A;  1KAP P;  1ZXC A;  3LQB A;  4PKW A;  3K7L A;  4I03 A;  3KWV C;  1BUD A;  1USN A;  4PKU A;  4HX3 A;  2WO9 A;  3L0V A;  4GQL A;  4GWM A;  2Y6C A;  2K9C A;  3U1R A;  1QJJ A;  4H76 A;  2K2G A;  1ZVX A;  1I76 A;  4L19 A;  2W0D A;  4L7A A;  2D1O A;  1I73 A;  1D7X A;  5BPA A;  1EAK A;  2DW1 A;  1CXV A;  2OVZ A;  1SLN A;  1PWQ A;  3EDG A;  3DTE A;  1S4B P;  4EFS A;  1KUH A;  3KMC A;  3P1V A;  4XM6 A;  2MZH A;  1BQO A;  4H3X A;  1O0Q A;  3HY7 A;  1CIZ A;  2OZR A;  1SLM A;  3RTT A;  1PWV A;  1G9K A;  1D8M A;  1H71 P;  2OW9 A;  4GUY A;  1UMT A;  2Y6D A;  1D5J A;  4R3V A;  3AYU A;  1G4K A;  1XFW A;  3B2Z A;  5I2Z A;  2FV9 A;  1OS9 A;  2JT6 A;  1GO7 P;  1C3I A;  4GR3 A;  1HTD A;  3L0T A;  1PWU A;  1K7I A;  5L79 A;  1IAC A;  3OHO A;  2X3A A;  3KEJ A;  3KHI A;  3AYK A;  4A3W A;  3HBV P;  4PKT A;  5CZM A;  1GE5 A;  3EDI A;  4WF6 A;  5I43 A;  1DTH A;  1DMT A;  1QUA A;  2ERQ A;  2YIG A;  3LJT A;  1GXD A;  4GF1 A;  3NX7 A;  1ATL A;  4JIJ A;  4JPA A;  5I4O A;  2Z2D A;  2YUF A;  4IN9 A;  2D1N A;  3HBU P;  5B5O A;  1BSW A;  2X3B A;  1R1J A;  2USN A;  1XUR A;  1KUI A;  2OW0 A;  1ROS A;  4A7B A;  1AF0 A;  4XM7 A;  3F15 A;  1QIB A;  1JAN A;  4DF9 A;  3RTS A;  3LE9 A;  1HV5 A;  3HB2 P;  2OXW A;  1JH1 A;  1I1I P;  1FM1 A;  1OMJ A;  5CUH A;  1WNI A;  2W12 A;  1UEA A;  4ON1 A;  1IAB A;  1R1H A;  2L0R A;  1IAG A;  3LUM A;  1BM6 A;  5I12 A;  3HYG A;  1HFS A;  456C A;  2OVX A;  1KUK A;  3LGP A;  2JSD A;  3B8Z A;  1KUF A;  2X3C A;  1ZS0 A;  1AYK A;  4AUO A;  1CQR A;  5L7F A;  1UTT A;  1CGL A;  3LMC A;  1KBC A;  4QKZ A;  3F19 A;  1B3D A;  1YOU A;  1MMP A;  2AIG P;  4JP4 A;  4IUW A;  2YB9 A;  1XFU A;  4PKR A;  2XS4 A;  3TT4 A;  4L63 A;  4AYK A;  3HDB A;  1D8F A;  3GBO A;  1SU3 A;  3VI1 A;  1O0T A;  3G5C A;  2MLR A;  1BKC E;  4J4M A;  3LEA A;  4I35 A;  4XM8 A;  1KUG A;  1BKC I;  4CTH A;  1PWP A;  1MMB A;  3SHI A;  3F18 A;  966C A;  3O64 A;  1K7Q A;  2O36 A;  4DV8 A;  1IAA A;  830C A;  4H49 A;  1XFY A;  3DPE A;  5D3C A;  2W15 A;  3USN A;  3TSK A;  1Y0V A;  1B8Y A;  3LUN A;  1OS2 A;  1G49 A;  4H30 A;  5D2B A;  2CKI A;  4JQG A;  1FLS A;  1RM8 A;  3I7I A;  1CAQ A;  1L6J A;  1UMS A;  2DDF A;  1GO8 P;  1JKY A;  2RJP A;  3Q2H A;  4HMA A;  2MZE A;  3DTK A;  2FV5 A;  2JIH A;  4L6T A;  3O2X A;  1BZS A;  2OW2 A;  2QPJ A;  3LJG A;  4WKE A;  3DPF A;  1C8T A;  3G42 A;  3ZUK A;  1AST A;  2E3X A;  1Y93 A;  3LKA A;  2J0T A;  1Z3J A;  1IAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...