1BQOA

Discovery of potent, achiral matrix metalloproteinase inhibitors
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
169
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metalloprotease
molecule keywords STROMELYSIN-1
publication title Discovery of potent, achiral matrix metalloproteinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bqoA00
1AF0A 2OXZA 4H2EA 1XUDA 1BKCA 1BZSA 2Z2DA 3KMCA 4CTHA 3EHYA 4H76A 3F18A 2W15A 2D1OA 3HDBA 4PKVA 3HY9A 3LQBA 5CUHA 1J7NA 3G42A 4L63A 4ON1A 2X3BA 2ERPA 4FXQA 3ZUKA 1HFSA 2K9CA 1K7QA 3CKIA 3EDGA 2DDYA 3SHIA 1MMRA 2E2DA 2I47A 456CA 1G9KA 2WO8A 1KAPP 1R54A 5CZMA 1KUFA 4AIGA 4IN9A 1OS9A 1XFVA 3RTTA 1XURA 2CLTA 3EHXA 2AYKA 4GQLA 3LUNA 1BQOA 1A86A 2D1NA 5D1SA 1Y8JA 4WK7A 1CAQA 3KWVC 5D3CA 3KHIA 2FV5A 1Y0VA 1YCMA 1PWWA 3VTGA 1QJJA 1XFZA 1MMPA 3L0VA 5LABA 1G05A 2YIGA 1PWVA 4PKRA 1GKCA 3DNGA 2O3EA 1B3DA 1QUAA 1XFXA 4J4MA 2OI0A 5L7FA 4GR0A 3EDZA 5I3MA 4HMAA 1CGFA 3Q2GA 1ZP5A 5I12A 1A85A 1JJ9A 1ZS0A 3NX7A 4DF9A 3UVCA 3LMCA 1ZXVA 1R55A 5I4OA 2EROA 1YQYA 5D1UA 1CIZA 1BSWA 1R1HA 3E8RA 3TT4A 1I1IP 2O36A 2JT6A 4GR3A 3MA2A 1D8MA 1YP1A 1BQQM 4L6TA 2W14A 3KRYA 2OXUA 1GO8P 1KBCA 1BUDA 3B8ZA 1EB6A 4FU4A 1C7KA 3KMEA 1JH1A 3KEKA 966CA 1GE5A 3LK8A 2WO9A 4R3VA 1JIWP 1C3IA 5JMYA 1ZTQA 2OW2A 3EDHA 3U1RA 1Q3AA 3O2XA 1CQRA 2W0DA 2USNA 5B5OA 2XS4A 3LGPA 4JPAA 2PJTA 3LJZA 5H8XA 2Y6CA 3P24A 1PWUA 1EAKA 1XUCA 4DV8A 2AIGP 2J0TA 2TCLA 5D1TA 2RJPA 5BOYA 1O0TA 1UTTA 3KECA 4L19A 1OO9A 2OVXA 4AXQA 1CXVA 1GKDA 1K7IA 2J83A 1SATA 4G0DA 4WKIA 2W12A 1L6JA 3K7NA 3RTSA 3LEAA 5L79A 1O0QA 3N2UA 1JANA 1JAQA 1JAOA 3ZVSA 4PKQA 3LIRA 1GXDA 4IJOA 3K7LA 4JQGA 2RJQA 1RM8A 4G9LA 4PKSA 3OHOA 4H49A 1JAPA 3TS4A 4WF6A 1ASTA 1I76A 2E3XA 2OVZA 3HY7A 2A8HA 4JIJA 1IAGA 3I7IA 1HV5A 2X3AA 2OZRA 2L0RA 1QIAA 3F19A 4DPEA 3EDIA 1OS2A 4IUWA 4A3WA 2OW1A 1ZXCA 4GR8A 4QKZA 3LJTA 3DWBA 2HU6A 3DPFA 4I03A 2CKIA 4EFSA 4H82A 2MZIA 4JP4A 1B8YA 3HB2P 1SU3A 1FM1A 2JT5A 1OMJA 2DW0A 3WV1A 1H71P 1DMTA 1I73A 4GWNA 3AYKA 5BPAA 1JKYA 2DW1A 1QIBA 1PWQA 5I43A 1RMZA 1UMTA 4JA1A 4WZVA 1D8FA 4H84A 2MZHA 1IADA 1JK3A 3TSKA 1SLNA 3V96B 3AIGA 1OM7A 1UEAA 1HFCA 2MLRA 1USNA 1BM6A 1HOVA 1IABA 4ZR5A 1KUHA 3LIKA 4HX3A 2V4BA 3WV2A 3F17A 4H3XA 1BIWA 830CA 1ND1A 2ERQA 3EWJA 4FXYP 2QPJA 2OY2A 3LQ0A 3BA0A 1SLMA 2MZEA 2OXWA 1YOUA 1BUVM 4PKTA 1HTDA 1GE6A 1MMQA 2K2GA 1K7GA 1FBLA 3LE9A 3HBUP 1QICA 3DPEA 2DDFA 3B2ZA 5B5PA 3AYUA 3N2VA 4ILWD 1PWPA 1ROSA 1SMPA 3USNA 1C8TA 3HBVP 2W13A 1D7XA 4H30A 1KUKA 3ELMA 1UTZA 3LILA 4XCTA 4XM7A 4XM6A 2JIHA 5I2ZA 1G4KA 3WV3A 1IAAA 1SRPA 2DW2A 1QJIA 1HY7A 5D2BA 1Y93A 3Q2HA 4FVLA 1MMBA 3F15A 3LKAA 3O64A 3LJGA 2KRJA 1UMSA 1XFWA 5D7WA 3KEJA 1R1IA 3HYGA 2X3CA 1Z3JA 1WNIA 3OHLA 1GE7A 4Q1LA 1OM6A 4I35A 2OY4A 1AYKA 2SRTA 5CXAA 3TVCA 4AYKA 1FLSA 2JSDA 2OW9A 4H1QA 3DL1A 2MLSA 4GUYA 1BKCI 2WOAA 2N8RA 1CGLA 2YB9A 4DD8A 3B92A 4AUOA 1EUBA 5BOTA 1XFUA 4WKEA 3I7GA 4A7BA 2JNPA 3GBOA 1IAEA 1G49A 2OW0A 1CK7A 1G12A 4GWMA 4PKWA 4XBHA 2XS3A 2Y6DA 2POJA 1KUGA 1IACA 1ZVXA 1DTHA 3VI1A 4GF1A 1R1JA 3HDAP 1ATLA 1MNCA 3LUMA 5I0LA 3G5CA 1GO7P 1S4BP 3ZXHA 1XFYA 1OM8A 3L0TA 1BKCE 4PKUA 1AKLA 2X7MA 3F16A 2FV9A 1CGEA 3P1VA 1D5JA 1KUIA 1JIZA 3DSLA 3F1AA 4XM8A
chains in the Genus database with same CATH superfamily
1AF0A 2OXZA 4H2EA 1XUDA 1BKCA 1BZSA 2Z2DA 3KMCA 4CTHA 3EHYA 4H76A 3F18A 2W15A 2D1OA 3HDBA 4PKVA 3HY9A 3LQBA 5CUHA 1J7NA 3G42A 4L63A 4ON1A 2X3BA 2ERPA 4FXQA 3ZUKA 1HFSA 2K9CA 1K7QA 3CKIA 3EDGA 2DDYA 3SHIA 1MMRA 2E2DA 2I47A 456CA 1G9KA 2WO8A 1KAPP 1R54A 5CZMA 1KUFA 4AIGA 4IN9A 1OS9A 1XFVA 3RTTA 1XURA 2CLTA 3EHXA 2AYKA 4GQLA 3LUNA 1BQOA 1A86A 2D1NA 5D1SA 1Y8JA 4WK7A 1CAQA 3KWVC 5D3CA 3KHIA 2FV5A 1Y0VA 1YCMA 1PWWA 3VTGA 1QJJA 1XFZA 1MMPA 3L0VA 5LABA 1G05A 2YIGA 1PWVA 4PKRA 1GKCA 3DNGA 2O3EA 1B3DA 1QUAA 1XFXA 4J4MA 2OI0A 5L7FA 4GR0A 3EDZA 5I3MA 4HMAA 1CGFA 3Q2GA 1ZP5A 5I12A 1A85A 1JJ9A 1ZS0A 3NX7A 4DF9A 3UVCA 3LMCA 1ZXVA 1R55A 5I4OA 2EROA 1YQYA 5D1UA 1CIZA 1BSWA 1R1HA 3E8RA 3TT4A 1I1IP 2O36A 2JT6A 4GR3A 3MA2A 1D8MA 1YP1A 1BQQM 4L6TA 2W14A 3KRYA 2OXUA 1GO8P 1KBCA 1OZ9A 1BUDA 3B8ZA 1EB6A 4FU4A 1C7KA 3KMEA 1JH1A 3KEKA 966CA 1GE5A 3LK8A 2WO9A 4R3VA 1JIWP 1C3IA 5JMYA 1ZTQA 2OW2A 3EDHA 3U1RA 1Q3AA 3O2XA 1CQRA 2W0DA 2USNA 5B5OA 2XS4A 3LGPA 4JPAA 2PJTA 3LJZA 5H8XA 2Y6CA 3P24A 1PWUA 1EAKA 1XUCA 4DV8A 2AIGP 3DTKA 2J0TA 2TCLA 5D1TA 2RJPA 5BOYA 1O0TA 1UTTA 3KECA 4L19A 1OO9A 2OVXA 4AXQA 1CXVA 1GKDA 1K7IA 2J83A 1SATA 4G0DA 4WKIA 2W12A 1L6JA 3K7NA 3RTSA 3LEAA 5L79A 1O0QA 3N2UA 1JANA 1JAQA 1JAOA 3ZVSA 4PKQA 3LIRA 1GXDA 4IJOA 3K7LA 4JQGA 2RJQA 1RM8A 4G9LA 4PKSA 3OHOA 4H49A 1JAPA 3TS4A 4WF6A 2YUFA 1ASTA 1I76A 2E3XA 2OVZA 3HY7A 2A8HA 4JIJA 1IAGA 3I7IA 1HV5A 2X3AA 2OZRA 2L0RA 1QIAA 3F19A 4DPEA 3EDIA 1OS2A 4IUWA 4A3WA 2OW1A 1ZXCA 4GR8A 4QKZA 3LJTA 3DWBA 2HU6A 3DPFA 4I03A 2CKIA 4EFSA 4H82A 2MZIA 4JP4A 1B8YA 3HB2P 1SU3A 1FM1A 2JT5A 1OMJA 2DW0A 3WV1A 1H71P 1DMTA 1I73A 4GWNA 3AYKA 5BPAA 1JKYA 2DW1A 1QIBA 1PWQA 5I43A 1RMZA 1UMTA 4JA1A 4WZVA 1D8FA 4H84A 2MZHA 3DTEA 1IADA 1JK3A 3TSKA 1SLNA 3V96B 3AIGA 1OM7A 1UEAA 1HFCA 2MLRA 1USNA 1BM6A 1HOVA 1IABA 4ZR5A 1KUHA 3LIKA 4HX3A 2V4BA 3WV2A 3F17A 3DTIA 4H3XA 1BIWA 830CA 1ND1A 2ERQA 3EWJA 4FXYP 2QPJA 2OY2A 3LQ0A 3BA0A 1SLMA 2MZEA 2OXWA 1YOUA 1BUVM 4PKTA 1HTDA 1GE6A 1MMQA 2K2GA 1K7GA 1FBLA 3LE9A 3HBUP 1QICA 3DPEA 2DDFA 3B2ZA 5B5PA 3AYUA 3N2VA 4ILWD 1PWPA 1ROSA 1SMPA 3USNA 1C8TA 3HBVP 2W13A 1D7XA 4H30A 1KUKA 3ELMA 1UTZA 3LILA 1TVIA 4XCTA 4XM7A 4XM6A 2JIHA 5I2ZA 1G4KA 3WV3A 1IAAA 1SRPA 2DW2A 1QJIA 1HY7A 5D2BA 1Y93A 3Q2HA 4FVLA 1MMBA 3F15A 3LKAA 4L7AA 3O64A 3LJGA 2KRJA 1UMSA 1XFWA 5D7WA 3KEJA 1R1IA 3HYGA 2X3CA 1Z3JA 1WNIA 3OHLA 1GE7A 4Q1LA 1OM6A 4I35A 2OY4A 1AYKA 2SRTA 5CXAA 3TVCA 4AYKA 1FLSA 2JSDA 2OW9A 4H1QA 3DL1A 2MLSA 4GUYA 1BKCI 2WOAA 2N8RA 1CGLA 2YB9A 4DD8A 3B92A 4AUOA 1XM5A 1EUBA 1XAXA 5BOTA 1XFUA 4WKEA 3I7GA 4A7BA 2JNPA 3GBOA 1IAEA 1G49A 2OW0A 1CK7A 1G12A 4GWMA 4PKWA 4XBHA 2XS3A 2Y6DA 2POJA 1KUGA 1IACA 1ZVXA 1DTHA 3VI1A 4GF1A 1R1JA 3HDAP 1ATLA 1MNCA 3LUMA 5I0LA 3G5CA 1GO7P 1S4BP 3ZXHA 1XFYA 1OM8A 3L0TA 1BKCE 4PKUA 1AKLA 2X7MA 3F16A 2FV9A 1CGEA 3P1VA 1D5JA 1KUIA 1JIZA 3DSLA 3F1AA 4XM8A
chains in the Genus database with same CATH topology
1AF0A 2OXZA 4H2EA 1XUDA 1BKCA 1BZSA 2Z2DA 3KMCA 4CTHA 3EHYA 4H76A 3F18A 2W15A 2D1OA 3HDBA 4PKVA 3HY9A 3LQBA 5CUHA 1J7NA 3G42A 4L63A 4ON1A 2X3BA 2ERPA 4FXQA 3ZUKA 1HFSA 2K9CA 1K7QA 3CKIA 3EDGA 2DDYA 3SHIA 1MMRA 2E2DA 2I47A 456CA 1G9KA 2WO8A 1KAPP 1R54A 5CZMA 1KUFA 4AIGA 4IN9A 1OS9A 1XFVA 3RTTA 1XURA 2CLTA 3EHXA 2AYKA 4GQLA 3LUNA 1BQOA 1A86A 2D1NA 5D1SA 1Y8JA 4WK7A 1CAQA 3KWVC 5D3CA 3KHIA 2FV5A 1Y0VA 1YCMA 1PWWA 3VTGA 1QJJA 1XFZA 1MMPA 3L0VA 5LABA 1G05A 2YIGA 1PWVA 4PKRA 1GKCA 3DNGA 2O3EA 1B3DA 1QUAA 1XFXA 4J4MA 2OI0A 5L7FA 4GR0A 3EDZA 5I3MA 4HMAA 1CGFA 3Q2GA 1ZP5A 5I12A 1A85A 1JJ9A 1ZS0A 3NX7A 4DF9A 3UVCA 3LMCA 1ZXVA 1R55A 5I4OA 2EROA 1YQYA 5D1UA 1CIZA 1BSWA 1R1HA 3E8RA 3TT4A 1I1IP 2O36A 2JT6A 4GR3A 3MA2A 1D8MA 1YP1A 1BQQM 4L6TA 2W14A 3KRYA 2OXUA 1GO8P 1KBCA 1BUDA 3B8ZA 1EB6A 4FU4A 1C7KA 3KMEA 1JH1A 3KEKA 966CA 1GE5A 3LK8A 2WO9A 4R3VA 1JIWP 1C3IA 5JMYA 1ZTQA 2OW2A 3EDHA 3U1RA 1Q3AA 3O2XA 1CQRA 2W0DA 2USNA 5B5OA 2XS4A 3LGPA 4JPAA 2PJTA 3LJZA 5H8XA 2Y6CA 3P24A 1PWUA 1EAKA 1XUCA 4DV8A 2AIGP 3DTKA 2J0TA 2TCLA 5D1TA 2RJPA 5BOYA 1O0TA 1UTTA 3KECA 4L19A 1OO9A 2OVXA 4AXQA 1CXVA 1GKDA 1K7IA 2J83A 1SATA 4G0DA 4WKIA 2W12A 1L6JA 3K7NA 3RTSA 3LEAA 5L79A 1O0QA 3N2UA 1JANA 1JAQA 1JAOA 3ZVSA 4PKQA 3LIRA 1GXDA 4IJOA 3K7LA 4JQGA 2RJQA 1RM8A 4G9LA 4PKSA 3OHOA 4H49A 1JAPA 3TS4A 4WF6A 2YUFA 1ASTA 1I76A 2E3XA 2OVZA 3HY7A 2A8HA 4JIJA 1IAGA 3I7IA 1HV5A 2X3AA 2OZRA 2L0RA 1QIAA 3F19A 4DPEA 3EDIA 1OS2A 4IUWA 4A3WA 2OW1A 1ZXCA 4GR8A 4QKZA 3LJTA 3DWBA 2HU6A 3DPFA 4I03A 2CKIA 4EFSA 4H82A 2MZIA 4JP4A 1B8YA 3HB2P 1SU3A 1FM1A 2JT5A 1OMJA 2DW0A 3WV1A 1H71P 1DMTA 1I73A 4GWNA 3AYKA 5BPAA 1JKYA 2DW1A 1QIBA 1PWQA 5I43A 1RMZA 1UMTA 4JA1A 4WZVA 1D8FA 4H84A 2MZHA 3DTEA 1IADA 1JK3A 3TSKA 1SLNA 3V96B 3AIGA 1OM7A 1UEAA 1HFCA 2MLRA 1USNA 1BM6A 1HOVA 1IABA 4ZR5A 1KUHA 3LIKA 4HX3A 2V4BA 3WV2A 3F17A 3DTIA 4H3XA 1BIWA 830CA 1ND1A 2ERQA 3EWJA 4FXYP 2QPJA 2OY2A 3LQ0A 3BA0A 1SLMA 2MZEA 2OXWA 1YOUA 1BUVM 4PKTA 1HTDA 1GE6A 1MMQA 2K2GA 1K7GA 1FBLA 3LE9A 3HBUP 1QICA 3DPEA 2DDFA 3B2ZA 5B5PA 3AYUA 3N2VA 4ILWD 1PWPA 1ROSA 1SMPA 3USNA 1C8TA 3HBVP 2W13A 1D7XA 4H30A 1KUKA 3ELMA 1UTZA 3LILA 4XCTA 4XM7A 4XM6A 2JIHA 5I2ZA 1G4KA 3WV3A 1IAAA 1SRPA 2DW2A 1QJIA 1HY7A 5D2BA 1Y93A 3Q2HA 4FVLA 1MMBA 3F15A 3LKAA 4L7AA 3O64A 3LJGA 2KRJA 1UMSA 1XFWA 5D7WA 3KEJA 1R1IA 3HYGA 2X3CA 1Z3JA 1WNIA 3OHLA 1GE7A 4Q1LA 1OM6A 4I35A 2OY4A 1AYKA 2SRTA 5CXAA 3TVCA 4AYKA 1FLSA 2JSDA 2OW9A 4H1QA 3DL1A 2MLSA 4GUYA 1BKCI 2WOAA 2N8RA 1CGLA 2YB9A 4DD8A 3B92A 4AUOA 1EUBA 5BOTA 1XFUA 4WKEA 3I7GA 4A7BA 2JNPA 3GBOA 1IAEA 1G49A 2OW0A 1CK7A 1G12A 4GWMA 4PKWA 4XBHA 2XS3A 2Y6DA 2POJA 1KUGA 1IACA 1ZVXA 1DTHA 3VI1A 4GF1A 1R1JA 3HDAP 1ATLA 1MNCA 3LUMA 5I0LA 3G5CA 1GO7P 1S4BP 3ZXHA 1XFYA 1OM8A 3L0TA 1BKCE 4PKUA 1AKLA 2X7MA 3F16A 2FV9A 1CGEA 3P1VA 1D5JA 1KUIA 1JIZA 3DSLA 3F1AA 4XM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AF0 A;  2OXZ A;  4H2E A;  1XUD A;  1BKC A;  1BZS A;  2Z2D A;  3KMC A;  4CTH A;  3EHY A;  4H76 A;  3F18 A;  2W15 A;  2D1O A;  3HDB A;  4PKV A;  3HY9 A;  3LQB A;  5CUH A;  1J7N A;  3G42 A;  4L63 A;  4ON1 A;  2X3B A;  2ERP A;  4FXQ A;  3ZUK A;  1HFS A;  2K9C A;  1K7Q A;  3CKI A;  3EDG A;  2DDY A;  3SHI A;  1MMR A;  2E2D A;  2I47 A;  456C A;  1G9K A;  2WO8 A;  1KAP P;  1R54 A;  5CZM A;  1KUF A;  4AIG A;  4IN9 A;  1OS9 A;  1XFV A;  3RTT A;  1XUR A;  2CLT A;  3EHX A;  2AYK A;  4GQL A;  3LUN A;  1BQO A;  1A86 A;  2D1N A;  5D1S A;  1Y8J A;  4WK7 A;  1CAQ A;  3KWV C;  5D3C A;  3KHI A;  2FV5 A;  1Y0V A;  1YCM A;  1PWW A;  3VTG A;  1QJJ A;  1XFZ A;  1MMP A;  3L0V A;  5LAB A;  1G05 A;  2YIG A;  1PWV A;  4PKR A;  1GKC A;  3DNG A;  2O3E A;  1B3D A;  1QUA A;  1XFX A;  4J4M A;  2OI0 A;  5L7F A;  4GR0 A;  3EDZ A;  5I3M A;  4HMA A;  1CGF A;  3Q2G A;  1ZP5 A;  5I12 A;  1A85 A;  1JJ9 A;  1ZS0 A;  3NX7 A;  4DF9 A;  3UVC A;  3LMC A;  1ZXV A;  1R55 A;  5I4O A;  2ERO A;  1YQY A;  5D1U A;  1CIZ A;  1BSW A;  1R1H A;  3E8R A;  3TT4 A;  1I1I P;  2O36 A;  2JT6 A;  4GR3 A;  3MA2 A;  1D8M A;  1YP1 A;  1BQQ M;  4L6T A;  2W14 A;  3KRY A;  2OXU A;  1GO8 P;  1KBC A;  1BUD A;  3B8Z A;  1EB6 A;  4FU4 A;  1C7K A;  3KME A;  1JH1 A;  3KEK A;  966C A;  1GE5 A;  3LK8 A;  2WO9 A;  4R3V A;  1JIW P;  1C3I A;  5JMY A;  1ZTQ A;  2OW2 A;  3EDH A;  3U1R A;  1Q3A A;  3O2X A;  1CQR A;  2W0D A;  2USN A;  5B5O A;  2XS4 A;  3LGP A;  4JPA A;  2PJT A;  3LJZ A;  5H8X A;  2Y6C A;  3P24 A;  1PWU A;  1EAK A;  1XUC A;  4DV8 A;  2AIG P;  2J0T A;  2TCL A;  5D1T A;  2RJP A;  5BOY A;  1O0T A;  1UTT A;  3KEC A;  4L19 A;  1OO9 A;  2OVX A;  4AXQ A;  1CXV A;  1GKD A;  1K7I A;  2J83 A;  1SAT A;  4G0D A;  4WKI A;  2W12 A;  1L6J A;  3K7N A;  3RTS A;  3LEA A;  5L79 A;  1O0Q A;  3N2U A;  1JAN A;  1JAQ A;  1JAO A;  3ZVS A;  4PKQ A;  3LIR A;  1GXD A;  4IJO A;  3K7L A;  4JQG A;  2RJQ A;  1RM8 A;  4G9L A;  4PKS A;  3OHO A;  4H49 A;  1JAP A;  3TS4 A;  4WF6 A;  1AST A;  1I76 A;  2E3X A;  2OVZ A;  3HY7 A;  2A8H A;  4JIJ A;  1IAG A;  3I7I A;  1HV5 A;  2X3A A;  2OZR A;  2L0R A;  1QIA A;  3F19 A;  4DPE A;  3EDI A;  1OS2 A;  4IUW A;  4A3W A;  2OW1 A;  1ZXC A;  4GR8 A;  4QKZ A;  3LJT A;  3DWB A;  2HU6 A;  3DPF A;  4I03 A;  2CKI A;  4EFS A;  4H82 A;  2MZI A;  4JP4 A;  1B8Y A;  3HB2 P;  1SU3 A;  1FM1 A;  2JT5 A;  1OMJ A;  2DW0 A;  3WV1 A;  1H71 P;  1DMT A;  1I73 A;  4GWN A;  3AYK A;  5BPA A;  1JKY A;  2DW1 A;  1QIB A;  1PWQ A;  5I43 A;  1RMZ A;  1UMT A;  4JA1 A;  4WZV A;  1D8F A;  4H84 A;  2MZH A;  1IAD A;  1JK3 A;  3TSK A;  1SLN A;  3V96 B;  3AIG A;  1OM7 A;  1UEA A;  1HFC A;  2MLR A;  1USN A;  1BM6 A;  1HOV A;  1IAB A;  4ZR5 A;  1KUH A;  3LIK A;  4HX3 A;  2V4B A;  3WV2 A;  3F17 A;  4H3X A;  1BIW A;  830C A;  1ND1 A;  2ERQ A;  3EWJ A;  4FXY P;  2QPJ A;  2OY2 A;  3LQ0 A;  3BA0 A;  1SLM A;  2MZE A;  2OXW A;  1YOU A;  1BUV M;  4PKT A;  1HTD A;  1GE6 A;  1MMQ A;  2K2G A;  1K7G A;  1FBL A;  3LE9 A;  3HBU P;  1QIC A;  3DPE A;  2DDF A;  3B2Z A;  5B5P A;  3AYU A;  3N2V A;  4ILW D;  1PWP A;  1ROS A;  1SMP A;  3USN A;  1C8T A;  3HBV P;  2W13 A;  1D7X A;  4H30 A;  1KUK A;  3ELM A;  1UTZ A;  3LIL A;  4XCT A;  4XM7 A;  4XM6 A;  2JIH A;  5I2Z A;  1G4K A;  3WV3 A;  1IAA A;  1SRP A;  2DW2 A;  1QJI A;  1HY7 A;  5D2B A;  1Y93 A;  3Q2H A;  4FVL A;  1MMB A;  3F15 A;  3LKA A;  3O64 A;  3LJG A;  2KRJ A;  1UMS A;  1XFW A;  5D7W A;  3KEJ A;  1R1I A;  3HYG A;  2X3C A;  1Z3J A;  1WNI A;  3OHL A;  1GE7 A;  4Q1L A;  1OM6 A;  4I35 A;  2OY4 A;  1AYK A;  2SRT A;  5CXA A;  3TVC A;  4AYK A;  1FLS A;  2JSD A;  2OW9 A;  4H1Q A;  3DL1 A;  2MLS A;  4GUY A;  1BKC I;  2WOA A;  2N8R A;  1CGL A;  2YB9 A;  4DD8 A;  3B92 A;  4AUO A;  1EUB A;  5BOT A;  1XFU A;  4WKE A;  3I7G A;  4A7B A;  2JNP A;  3GBO A;  1IAE A;  1G49 A;  2OW0 A;  1CK7 A;  1G12 A;  4GWM A;  4PKW A;  4XBH A;  2XS3 A;  2Y6D A;  2POJ A;  1KUG A;  1IAC A;  1ZVX A;  1DTH A;  3VI1 A;  4GF1 A;  1R1J A;  3HDA P;  1ATL A;  1MNC A;  3LUM A;  5I0L A;  3G5C A;  1GO7 P;  1S4B P;  3ZXH A;  1XFY A;  1OM8 A;  3L0T A;  1BKC E;  4PKU A;  1AKL A;  2X7M A;  3F16 A;  2FV9 A;  1CGE A;  3P1V A;  1D5J A;  1KUI A;  1JIZ A;  3DSL A;  3F1A A;  4XM8 A; 
#chains in the Genus database with same CATH topology
 1AF0 A;  2OXZ A;  4H2E A;  1XUD A;  1BKC A;  1BZS A;  2Z2D A;  3KMC A;  4CTH A;  3EHY A;  4H76 A;  3F18 A;  2W15 A;  2D1O A;  3HDB A;  4PKV A;  3HY9 A;  3LQB A;  5CUH A;  1J7N A;  3G42 A;  4L63 A;  4ON1 A;  2X3B A;  2ERP A;  4FXQ A;  3ZUK A;  1HFS A;  2K9C A;  1K7Q A;  3CKI A;  3EDG A;  2DDY A;  3SHI A;  1MMR A;  2E2D A;  2I47 A;  456C A;  1G9K A;  2WO8 A;  1KAP P;  1R54 A;  5CZM A;  1KUF A;  4AIG A;  4IN9 A;  1OS9 A;  1XFV A;  3RTT A;  1XUR A;  2CLT A;  3EHX A;  2AYK A;  4GQL A;  3LUN A;  1BQO A;  1A86 A;  2D1N A;  5D1S A;  1Y8J A;  4WK7 A;  1CAQ A;  3KWV C;  5D3C A;  3KHI A;  2FV5 A;  1Y0V A;  1YCM A;  1PWW A;  3VTG A;  1QJJ A;  1XFZ A;  1MMP A;  3L0V A;  5LAB A;  1G05 A;  2YIG A;  1PWV A;  4PKR A;  1GKC A;  3DNG A;  2O3E A;  1B3D A;  1QUA A;  1XFX A;  4J4M A;  2OI0 A;  5L7F A;  4GR0 A;  3EDZ A;  5I3M A;  4HMA A;  1CGF A;  3Q2G A;  1ZP5 A;  5I12 A;  1A85 A;  1JJ9 A;  1ZS0 A;  3NX7 A;  4DF9 A;  3UVC A;  3LMC A;  1ZXV A;  1R55 A;  5I4O A;  2ERO A;  1YQY A;  5D1U A;  1CIZ A;  1BSW A;  1R1H A;  3E8R A;  3TT4 A;  1I1I P;  2O36 A;  2JT6 A;  4GR3 A;  3MA2 A;  1D8M A;  1YP1 A;  1BQQ M;  4L6T A;  2W14 A;  3KRY A;  2OXU A;  1GO8 P;  1KBC A;  1OZ9 A;  1BUD A;  3B8Z A;  1EB6 A;  4FU4 A;  1C7K A;  3KME A;  1JH1 A;  3KEK A;  966C A;  1GE5 A;  3LK8 A;  2WO9 A;  4R3V A;  1JIW P;  1C3I A;  5JMY A;  1ZTQ A;  2OW2 A;  3EDH A;  3U1R A;  1Q3A A;  3O2X A;  1CQR A;  2W0D A;  2USN A;  5B5O A;  2XS4 A;  3LGP A;  4JPA A;  2PJT A;  3LJZ A;  5H8X A;  2Y6C A;  3P24 A;  1PWU A;  1EAK A;  1XUC A;  4DV8 A;  2AIG P;  3DTK A;  2J0T A;  2TCL A;  5D1T A;  2RJP A;  5BOY A;  1O0T A;  1UTT A;  3KEC A;  4L19 A;  1OO9 A;  2OVX A;  4AXQ A;  1CXV A;  1GKD A;  1K7I A;  2J83 A;  1SAT A;  4G0D A;  4WKI A;  2W12 A;  1L6J A;  3K7N A;  3RTS A;  3LEA A;  5L79 A;  1O0Q A;  3N2U A;  1JAN A;  1JAQ A;  1JAO A;  3ZVS A;  4PKQ A;  3LIR A;  1GXD A;  4IJO A;  3K7L A;  4JQG A;  2RJQ A;  1RM8 A;  4G9L A;  4PKS A;  3OHO A;  4H49 A;  1JAP A;  3TS4 A;  4WF6 A;  2YUF A;  1AST A;  1I76 A;  2E3X A;  2OVZ A;  3HY7 A;  2A8H A;  4JIJ A;  1IAG A;  3I7I A;  1HV5 A;  2X3A A;  2OZR A;  2L0R A;  1QIA A;  3F19 A;  4DPE A;  3EDI A;  1OS2 A;  4IUW A;  4A3W A;  2OW1 A;  1ZXC A;  4GR8 A;  4QKZ A;  3LJT A;  3DWB A;  2HU6 A;  3DPF A;  4I03 A;  2CKI A;  4EFS A;  4H82 A;  2MZI A;  4JP4 A;  1B8Y A;  3HB2 P;  1SU3 A;  1FM1 A;  2JT5 A;  1OMJ A;  2DW0 A;  3WV1 A;  1H71 P;  1DMT A;  1I73 A;  4GWN A;  3AYK A;  5BPA A;  1JKY A;  2DW1 A;  1QIB A;  1PWQ A;  5I43 A;  1RMZ A;  1UMT A;  4JA1 A;  4WZV A;  1D8F A;  4H84 A;  2MZH A;  3DTE A;  1IAD A;  1JK3 A;  3TSK A;  1SLN A;  3V96 B;  3AIG A;  1OM7 A;  1UEA A;  1HFC A;  2MLR A;  1USN A;  1BM6 A;  1HOV A;  1IAB A;  4ZR5 A;  1KUH A;  3LIK A;  4HX3 A;  2V4B A;  3WV2 A;  3F17 A;  3DTI A;  4H3X A;  1BIW A;  830C A;  1ND1 A;  2ERQ A;  3EWJ A;  4FXY P;  2QPJ A;  2OY2 A;  3LQ0 A;  3BA0 A;  1SLM A;  2MZE A;  2OXW A;  1YOU A;  1BUV M;  4PKT A;  1HTD A;  1GE6 A;  1MMQ A;  2K2G A;  1K7G A;  1FBL A;  3LE9 A;  3HBU P;  1QIC A;  3DPE A;  2DDF A;  3B2Z A;  5B5P A;  3AYU A;  3N2V A;  4ILW D;  1PWP A;  1ROS A;  1SMP A;  3USN A;  1C8T A;  3HBV P;  2W13 A;  1D7X A;  4H30 A;  1KUK A;  3ELM A;  1UTZ A;  3LIL A;  1TVI A;  4XCT A;  4XM7 A;  4XM6 A;  2JIH A;  5I2Z A;  1G4K A;  3WV3 A;  1IAA A;  1SRP A;  2DW2 A;  1QJI A;  1HY7 A;  5D2B A;  1Y93 A;  3Q2H A;  4FVL A;  1MMB A;  3F15 A;  3LKA A;  4L7A A;  3O64 A;  3LJG A;  2KRJ A;  1UMS A;  1XFW A;  5D7W A;  3KEJ A;  1R1I A;  3HYG A;  2X3C A;  1Z3J A;  1WNI A;  3OHL A;  1GE7 A;  4Q1L A;  1OM6 A;  4I35 A;  2OY4 A;  1AYK A;  2SRT A;  5CXA A;  3TVC A;  4AYK A;  1FLS A;  2JSD A;  2OW9 A;  4H1Q A;  3DL1 A;  2MLS A;  4GUY A;  1BKC I;  2WOA A;  2N8R A;  1CGL A;  2YB9 A;  4DD8 A;  3B92 A;  4AUO A;  1XM5 A;  1EUB A;  1XAX A;  5BOT A;  1XFU A;  4WKE A;  3I7G A;  4A7B A;  2JNP A;  3GBO A;  1IAE A;  1G49 A;  2OW0 A;  1CK7 A;  1G12 A;  4GWM A;  4PKW A;  4XBH A;  2XS3 A;  2Y6D A;  2POJ A;  1KUG A;  1IAC A;  1ZVX A;  1DTH A;  3VI1 A;  4GF1 A;  1R1J A;  3HDA P;  1ATL A;  1MNC A;  3LUM A;  5I0L A;  3G5C A;  1GO7 P;  1S4B P;  3ZXH A;  1XFY A;  1OM8 A;  3L0T A;  1BKC E;  4PKU A;  1AKL A;  2X7M A;  3F16 A;  2FV9 A;  1CGE A;  3P1V A;  1D5J A;  1KUI A;  1JIZ A;  3DSL A;  3F1A A;  4XM8 A; 
#chains in the Genus database with same CATH homology
 1AF0 A;  2OXZ A;  4H2E A;  1XUD A;  1BKC A;  1BZS A;  2Z2D A;  3KMC A;  4CTH A;  3EHY A;  4H76 A;  3F18 A;  2W15 A;  2D1O A;  3HDB A;  4PKV A;  3HY9 A;  3LQB A;  5CUH A;  1J7N A;  3G42 A;  4L63 A;  4ON1 A;  2X3B A;  2ERP A;  4FXQ A;  3ZUK A;  1HFS A;  2K9C A;  1K7Q A;  3CKI A;  3EDG A;  2DDY A;  3SHI A;  1MMR A;  2E2D A;  2I47 A;  456C A;  1G9K A;  2WO8 A;  1KAP P;  1R54 A;  5CZM A;  1KUF A;  4AIG A;  4IN9 A;  1OS9 A;  1XFV A;  3RTT A;  1XUR A;  2CLT A;  3EHX A;  2AYK A;  4GQL A;  3LUN A;  1BQO A;  1A86 A;  2D1N A;  5D1S A;  1Y8J A;  4WK7 A;  1CAQ A;  3KWV C;  5D3C A;  3KHI A;  2FV5 A;  1Y0V A;  1YCM A;  1PWW A;  3VTG A;  1QJJ A;  1XFZ A;  1MMP A;  3L0V A;  5LAB A;  1G05 A;  2YIG A;  1PWV A;  4PKR A;  1GKC A;  3DNG A;  2O3E A;  1B3D A;  1QUA A;  1XFX A;  4J4M A;  2OI0 A;  5L7F A;  4GR0 A;  3EDZ A;  5I3M A;  4HMA A;  1CGF A;  3Q2G A;  1ZP5 A;  5I12 A;  1A85 A;  1JJ9 A;  1ZS0 A;  3NX7 A;  4DF9 A;  3UVC A;  3LMC A;  1ZXV A;  1R55 A;  5I4O A;  2ERO A;  1YQY A;  5D1U A;  1CIZ A;  1BSW A;  1R1H A;  3E8R A;  3TT4 A;  1I1I P;  2O36 A;  2JT6 A;  4GR3 A;  3MA2 A;  1D8M A;  1YP1 A;  1BQQ M;  4L6T A;  2W14 A;  3KRY A;  2OXU A;  1GO8 P;  1KBC A;  1BUD A;  3B8Z A;  1EB6 A;  4FU4 A;  1C7K A;  3KME A;  1JH1 A;  3KEK A;  966C A;  1GE5 A;  3LK8 A;  2WO9 A;  4R3V A;  1JIW P;  1C3I A;  5JMY A;  1ZTQ A;  2OW2 A;  3EDH A;  3U1R A;  1Q3A A;  3O2X A;  1CQR A;  2W0D A;  2USN A;  5B5O A;  2XS4 A;  3LGP A;  4JPA A;  2PJT A;  3LJZ A;  5H8X A;  2Y6C A;  3P24 A;  1PWU A;  1EAK A;  1XUC A;  4DV8 A;  2AIG P;  3DTK A;  2J0T A;  2TCL A;  5D1T A;  2RJP A;  5BOY A;  1O0T A;  1UTT A;  3KEC A;  4L19 A;  1OO9 A;  2OVX A;  4AXQ A;  1CXV A;  1GKD A;  1K7I A;  2J83 A;  1SAT A;  4G0D A;  4WKI A;  2W12 A;  1L6J A;  3K7N A;  3RTS A;  3LEA A;  5L79 A;  1O0Q A;  3N2U A;  1JAN A;  1JAQ A;  1JAO A;  3ZVS A;  4PKQ A;  3LIR A;  1GXD A;  4IJO A;  3K7L A;  4JQG A;  2RJQ A;  1RM8 A;  4G9L A;  4PKS A;  3OHO A;  4H49 A;  1JAP A;  3TS4 A;  4WF6 A;  2YUF A;  1AST A;  1I76 A;  2E3X A;  2OVZ A;  3HY7 A;  2A8H A;  4JIJ A;  1IAG A;  3I7I A;  1HV5 A;  2X3A A;  2OZR A;  2L0R A;  1QIA A;  3F19 A;  4DPE A;  3EDI A;  1OS2 A;  4IUW A;  4A3W A;  2OW1 A;  1ZXC A;  4GR8 A;  4QKZ A;  3LJT A;  3DWB A;  2HU6 A;  3DPF A;  4I03 A;  2CKI A;  4EFS A;  4H82 A;  2MZI A;  4JP4 A;  1B8Y A;  3HB2 P;  1SU3 A;  1FM1 A;  2JT5 A;  1OMJ A;  2DW0 A;  3WV1 A;  1H71 P;  1DMT A;  1I73 A;  4GWN A;  3AYK A;  5BPA A;  1JKY A;  2DW1 A;  1QIB A;  1PWQ A;  5I43 A;  1RMZ A;  1UMT A;  4JA1 A;  4WZV A;  1D8F A;  4H84 A;  2MZH A;  3DTE A;  1IAD A;  1JK3 A;  3TSK A;  1SLN A;  3V96 B;  3AIG A;  1OM7 A;  1UEA A;  1HFC A;  2MLR A;  1USN A;  1BM6 A;  1HOV A;  1IAB A;  4ZR5 A;  1KUH A;  3LIK A;  4HX3 A;  2V4B A;  3WV2 A;  3F17 A;  3DTI A;  4H3X A;  1BIW A;  830C A;  1ND1 A;  2ERQ A;  3EWJ A;  4FXY P;  2QPJ A;  2OY2 A;  3LQ0 A;  3BA0 A;  1SLM A;  2MZE A;  2OXW A;  1YOU A;  1BUV M;  4PKT A;  1HTD A;  1GE6 A;  1MMQ A;  2K2G A;  1K7G A;  1FBL A;  3LE9 A;  3HBU P;  1QIC A;  3DPE A;  2DDF A;  3B2Z A;  5B5P A;  3AYU A;  3N2V A;  4ILW D;  1PWP A;  1ROS A;  1SMP A;  3USN A;  1C8T A;  3HBV P;  2W13 A;  1D7X A;  4H30 A;  1KUK A;  3ELM A;  1UTZ A;  3LIL A;  4XCT A;  4XM7 A;  4XM6 A;  2JIH A;  5I2Z A;  1G4K A;  3WV3 A;  1IAA A;  1SRP A;  2DW2 A;  1QJI A;  1HY7 A;  5D2B A;  1Y93 A;  3Q2H A;  4FVL A;  1MMB A;  3F15 A;  3LKA A;  4L7A A;  3O64 A;  3LJG A;  2KRJ A;  1UMS A;  1XFW A;  5D7W A;  3KEJ A;  1R1I A;  3HYG A;  2X3C A;  1Z3J A;  1WNI A;  3OHL A;  1GE7 A;  4Q1L A;  1OM6 A;  4I35 A;  2OY4 A;  1AYK A;  2SRT A;  5CXA A;  3TVC A;  4AYK A;  1FLS A;  2JSD A;  2OW9 A;  4H1Q A;  3DL1 A;  2MLS A;  4GUY A;  1BKC I;  2WOA A;  2N8R A;  1CGL A;  2YB9 A;  4DD8 A;  3B92 A;  4AUO A;  1EUB A;  5BOT A;  1XFU A;  4WKE A;  3I7G A;  4A7B A;  2JNP A;  3GBO A;  1IAE A;  1G49 A;  2OW0 A;  1CK7 A;  1G12 A;  4GWM A;  4PKW A;  4XBH A;  2XS3 A;  2Y6D A;  2POJ A;  1KUG A;  1IAC A;  1ZVX A;  1DTH A;  3VI1 A;  4GF1 A;  1R1J A;  3HDA P;  1ATL A;  1MNC A;  3LUM A;  5I0L A;  3G5C A;  1GO7 P;  1S4B P;  3ZXH A;  1XFY A;  1OM8 A;  3L0T A;  1BKC E;  4PKU A;  1AKL A;  2X7M A;  3F16 A;  2FV9 A;  1CGE A;  3P1V A;  1D5J A;  1KUI A;  1JIZ A;  3DSL A;  3F1A A;  4XM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...