2OY2A

Human mmp-8 in complex with peptide iag
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
PKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil collagenase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 157
sequence length 157
chains with identical sequence F
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oy2A00
1XFVA 1O0QA 1OS2A 1XUCA 1GO8P 4PKRA 4G9LA 2POJA 4PKWA 1SLNA 4H1QA 1D8MA 3G5CA 3DWBA 5I12A 2ERPA 1CGEA 4WF6A 1XURA 2W0DA 3L0VA 3EDZA 2FV9A 1H71P 2OVZA 3K7LA 1UTZA 4PKUA 3DPFA 1HTDA 3KWVC 4L19A 1YP1A 1OM7A 1OM6A 3I7GA 2OI0A 4XM6A 2OY2A 1BKCE 1BSWA 3LUMA 4GWMA 1PWUA 4CTHA 4I03A 4GF1A 2X3AA 1R54A 1R1IA 2E2DA 1K7GA 5BPAA 3RTTA 2DW2A 1XFZA 3TT4A 3HBVP 2K9CA 5I4OA 3P24A 1K7QA 1I1IP 1QJIA 2RJQA 2OXWA 3VTGA 1CQRA 5D1TA 2E3XA 4PKVA 3F17A 1JJ9A 4A7BA 3USNA 3O2XA 3F1AA 5D7WA 4GR8A 4XBHA 3KHIA 1OM8A 1KUFA 3DSLA 1JIZA 2OZRA 1JANA 4JIJA 1G9KA 2W14A 5I2ZA 2OXUA 5B5OA 2ERQA 1S4BP 4GQLA 1I76A 1BQQM 5L7FA 1JH1A 1YQYA 2N8RA 3OHOA 4FXYP 1ROSA 2O36A 3ZUKA 4H49A 5CXAA 1IAEA 1JIWP 1IAAA 3WV3A 3HBUP 1AYKA 3V96B 1ND1A 1BM6A 2L0RA 1MMQA 1DMTA 1JKYA 1A85A 1JAQA 1L6JA 5BOTA 2AYKA 1C8TA 4H84A 4J4MA 3LMCA 3ELMA 1KUIA 1RMZA 2OW1A 3EDGA 5D1SA 3OHLA 1B3DA 4DF9A 2WOAA 1ATLA 4AYKA 2HU6A 3U1RA 3KMEA 3Q2HA 1PWPA 2OY4A 4WKEA 3DL1A 2MLSA 1HY7A 3CKIA 5BOYA 2CLTA 4XM8A 2MZHA 5JMYA 3KMCA 1CIZA 2JNPA 1ZS0A 4R3VA 4G0DA 3TVCA 1HV5A 1K7IA 3AYKA 1ASTA 1FLSA 1Y8JA 1DTHA 4WZVA 1KUHA 4WK7A 2DW0A 2OW2A 3HY9A 1FBLA 4XCTA 2FV5A 2OW0A 2YB9A 1C3IA 3MA2A 3LQ0A 4ZR5A 2V4BA 4JPAA 3VI1A 3LE9A 3EWJA 4FVLA 1PWQA 1UMSA 3O64A 2K2GA 4GR0A 1IAGA 1CGFA 2X3BA 4GR3A 2J83A 966CA 2Y6DA 1WNIA 3F18A 2DDYA 3F19A 1GE5A 3EHXA 3HB2P 3N2VA 2MZIA 4A3WA 2WO9A 3F16A 4PKTA 4AXQA 4HX3A 3ZVSA 1QICA 1Q3AA 1PWVA 1J7NA 1XFXA 1MNCA 1Y93A 2O3EA 3LK8A 1AF0A 1R1JA 5D1UA 3I7IA 1D7XA 2RJPA 2MZEA 4H3XA 1IABA 3DPEA 3KEKA 3N2UA 5H8XA 2AIGP 1CGLA 1B8YA 2JIHA 4PKQA 5I3MA 4GUYA 3B8ZA 3HDAP 3P1VA 3WV1A 2D1NA 4FXQA 1HFSA 2CKIA 2OXZA 2QPJA 3LJZA 2YIGA 3LQBA 5D2BA 1QJJA 1ZXVA 3TSKA 5L79A 1UTTA 1G12A 2PJTA 2W12A 5B5PA 1SLMA 3B92A 1O0TA 1EB6A 2USNA 1MMPA 3HDBA 4L6TA 1EAKA 4H82A 3K7NA 1GE6A 1G05A 3F15A 3EDIA 3LKAA 2XS4A 3UVCA 4ILWD 2JSDA 1SRPA 3GBOA 1KBCA 3L0TA 3EDHA 1GO7P 3NX7A 2J0TA 1D8FA 4H30A 1OS9A 2SRTA 830CA 1Y0VA 4PKSA 2Z2DA 1YOUA 1GKCA 1RM8A 2XS3A 1OMJA 1HFCA 5CZMA 1MMBA 5I43A 5LABA 1AKLA 1BKCI 4ON1A 4HMAA 2A8HA 1SATA 2OVXA 3KECA 3Q2GA 1GXDA 3DNGA 4IJOA 4AIGA 1CAQA 1OO9A 2W13A 1G4KA 1JAOA 1D5JA 4GWNA 3EHYA 5I0LA 3B2ZA 4WKIA 1IACA 2I47A 3ZXHA 2OW9A 1XFWA 2EROA 3LGPA 4DV8A 1R55A 2TCLA 3TS4A 3AIGA 1R1HA 1FM1A 1MMRA 4JP4A 1BUVM 1BKCA 1XFUA 2Y6CA 5CUHA 3KRYA 4EFSA 456CA 5D3CA 3LEAA 1QUAA 1ZTQA 1JAPA 1BUDA 1UMTA 1A86A 1QIBA 1QIAA 1CXVA 1ZVXA 3SHIA 3WV2A 2JT5A 1YCMA 4I35A 4H2EA 2DDFA 4Q1LA 1USNA 2KRJA 2MLRA 2WO8A 1G49A 1GE7A 4XM7A 3HYGA 3BA0A 2X3CA 1XFYA 1UEAA 1KUKA 1HOVA 1BIWA 3LJGA 1Z3JA 1KAPP 1XUDA 1JK3A 3HY7A 2JT6A 1I73A 3LIRA 4L63A 3G42A 3LUNA 4JA1A 2X7MA 4IN9A 4FU4A 1CK7A 1ZXCA 3AYUA 4DD8A 4IUWA 3LIKA 3RTSA 4H76A 4JQGA 3E8RA 4QKZA 4DPEA 1BQOA 2DW1A 1ZP5A 2D1OA 1GKDA 1EUBA 2W15A 1PWWA 1C7KA 4AUOA 1SMPA 3LJTA 1SU3A 3KEJA 3LILA 1BZSA 1KUGA 1IADA
chains in the Genus database with same CATH superfamily
1XFVA 1O0QA 1OS2A 1XUCA 1GO8P 4PKRA 4G9LA 2POJA 4PKWA 1SLNA 4H1QA 1D8MA 3G5CA 3DWBA 5I12A 2ERPA 1CGEA 4WF6A 1XURA 2W0DA 3L0VA 3EDZA 2FV9A 1H71P 2OVZA 3K7LA 1UTZA 4PKUA 3DPFA 1HTDA 3KWVC 4L19A 1YP1A 1OM7A 1OM6A 3I7GA 2OI0A 4XM6A 2OY2A 1BKCE 1BSWA 3LUMA 4GWMA 1PWUA 4CTHA 4I03A 4GF1A 2X3AA 1R54A 1R1IA 2E2DA 1K7GA 5BPAA 3RTTA 2DW2A 1XFZA 3TT4A 3HBVP 3DTIA 2K9CA 5I4OA 3P24A 3DTEA 1K7QA 1I1IP 1QJIA 2RJQA 2OXWA 3VTGA 1CQRA 5D1TA 2E3XA 4PKVA 3F17A 1JJ9A 4A7BA 3USNA 3O2XA 3F1AA 5D7WA 4GR8A 4XBHA 3KHIA 1OM8A 1KUFA 3DSLA 1JIZA 2OZRA 1JANA 4JIJA 1G9KA 2W14A 5I2ZA 2OXUA 5B5OA 2ERQA 1S4BP 4GQLA 1I76A 1BQQM 5L7FA 1JH1A 1YQYA 2N8RA 3OHOA 4FXYP 1ROSA 2O36A 3ZUKA 4H49A 5CXAA 1IAEA 1JIWP 1IAAA 3WV3A 3HBUP 1AYKA 3V96B 1ND1A 1BM6A 2L0RA 1MMQA 1DMTA 1JKYA 1A85A 1JAQA 1L6JA 5BOTA 2AYKA 1C8TA 4H84A 4J4MA 3LMCA 3ELMA 1KUIA 1RMZA 2OW1A 3EDGA 5D1SA 3OHLA 1B3DA 4DF9A 2WOAA 1ATLA 4AYKA 2HU6A 3U1RA 3KMEA 3Q2HA 1PWPA 2OY4A 4WKEA 3DL1A 2MLSA 1HY7A 3CKIA 5BOYA 2CLTA 4XM8A 2MZHA 5JMYA 3KMCA 1CIZA 2JNPA 1ZS0A 4R3VA 4G0DA 3TVCA 1HV5A 1K7IA 3AYKA 1ASTA 1FLSA 1Y8JA 1DTHA 4WZVA 1KUHA 4WK7A 2DW0A 2OW2A 3HY9A 1FBLA 4XCTA 2FV5A 2OW0A 2YB9A 1C3IA 3MA2A 3LQ0A 4ZR5A 2V4BA 4JPAA 3VI1A 3LE9A 3EWJA 4FVLA 1PWQA 1UMSA 3O64A 2K2GA 4GR0A 1IAGA 1CGFA 2X3BA 4GR3A 2J83A 966CA 2Y6DA 1WNIA 3F18A 2DDYA 3F19A 1GE5A 3EHXA 3HB2P 3N2VA 2MZIA 4A3WA 2WO9A 3F16A 4PKTA 4AXQA 4HX3A 3ZVSA 1QICA 1Q3AA 1PWVA 1J7NA 1XFXA 1MNCA 1Y93A 2O3EA 3LK8A 1AF0A 1R1JA 5D1UA 3I7IA 1D7XA 2RJPA 2MZEA 4H3XA 1IABA 3DPEA 3KEKA 3N2UA 5H8XA 2AIGP 1CGLA 1B8YA 2JIHA 4PKQA 5I3MA 4GUYA 3B8ZA 3HDAP 3P1VA 3WV1A 2D1NA 4FXQA 1HFSA 2CKIA 2OXZA 2QPJA 3LJZA 2YIGA 3LQBA 5D2BA 1QJJA 1ZXVA 3TSKA 5L79A 1UTTA 1G12A 2PJTA 2W12A 5B5PA 1SLMA 3B92A 1O0TA 1EB6A 2USNA 1MMPA 3HDBA 4L6TA 1EAKA 4H82A 3K7NA 1GE6A 1G05A 3F15A 3EDIA 3LKAA 2XS4A 3UVCA 4ILWD 2JSDA 1SRPA 3GBOA 1KBCA 3L0TA 3EDHA 1GO7P 3NX7A 2J0TA 2YUFA 1D8FA 4H30A 1OS9A 2SRTA 830CA 1Y0VA 4PKSA 2Z2DA 1YOUA 1GKCA 1RM8A 2XS3A 1OMJA 1HFCA 5CZMA 1MMBA 5I43A 5LABA 1AKLA 1BKCI 4ON1A 4HMAA 2A8HA 1SATA 2OVXA 3KECA 3Q2GA 1GXDA 3DNGA 4IJOA 4AIGA 1CAQA 1OO9A 2W13A 1G4KA 1JAOA 1D5JA 4GWNA 3EHYA 5I0LA 3B2ZA 4WKIA 1IACA 2I47A 3ZXHA 2OW9A 1XFWA 2EROA 3LGPA 4DV8A 1R55A 2TCLA 3TS4A 3AIGA 1R1HA 1FM1A 1MMRA 4JP4A 1BUVM 1OZ9A 1BKCA 1XFUA 2Y6CA 5CUHA 3KRYA 3DTKA 4EFSA 456CA 5D3CA 3LEAA 1QUAA 1ZTQA 1JAPA 1BUDA 1UMTA 1A86A 1QIBA 1QIAA 1CXVA 1ZVXA 3SHIA 3WV2A 2JT5A 1YCMA 4I35A 4H2EA 2DDFA 4Q1LA 4L7AA 1USNA 2KRJA 2MLRA 2WO8A 1G49A 1GE7A 4XM7A 3HYGA 3BA0A 2X3CA 1XFYA 1UEAA 1KUKA 1HOVA 1BIWA 3LJGA 1Z3JA 1KAPP 1XUDA 1JK3A 3HY7A 2JT6A 1I73A 3LIRA 4L63A 3G42A 3LUNA 4JA1A 2X7MA 4IN9A 4FU4A 1CK7A 1ZXCA 3AYUA 4DD8A 4IUWA 3LIKA 3RTSA 4H76A 4JQGA 3E8RA 4QKZA 4DPEA 1BQOA 2DW1A 1ZP5A 2D1OA 1GKDA 1XM5A 1EUBA 2W15A 1PWWA 1TVIA 1C7KA 4AUOA 1SMPA 3LJTA 1XAXA 1SU3A 3KEJA 3LILA 1BZSA 1KUGA 1IADA
chains in the Genus database with same CATH topology
1XFVA 1O0QA 1OS2A 1XUCA 1GO8P 4PKRA 4G9LA 2POJA 4PKWA 1SLNA 4H1QA 1D8MA 3G5CA 3DWBA 5I12A 2ERPA 1CGEA 4WF6A 1XURA 2W0DA 3L0VA 3EDZA 2FV9A 1H71P 2OVZA 3K7LA 1UTZA 4PKUA 3DPFA 1HTDA 3KWVC 4L19A 1YP1A 1OM7A 1OM6A 3I7GA 2OI0A 4XM6A 2OY2A 1BKCE 1BSWA 3LUMA 4GWMA 1PWUA 4CTHA 4I03A 4GF1A 2X3AA 1R54A 1R1IA 2E2DA 1K7GA 5BPAA 3RTTA 2DW2A 1XFZA 3TT4A 3HBVP 3DTIA 2K9CA 5I4OA 3P24A 3DTEA 1K7QA 1I1IP 1QJIA 2RJQA 2OXWA 3VTGA 1CQRA 5D1TA 2E3XA 4PKVA 3F17A 1JJ9A 4A7BA 3USNA 3O2XA 3F1AA 5D7WA 4GR8A 4XBHA 3KHIA 1OM8A 1KUFA 3DSLA 1JIZA 2OZRA 1JANA 4JIJA 1G9KA 2W14A 5I2ZA 2OXUA 5B5OA 2ERQA 1S4BP 4GQLA 1I76A 1BQQM 5L7FA 1JH1A 1YQYA 2N8RA 3OHOA 4FXYP 1ROSA 2O36A 3ZUKA 4H49A 5CXAA 1IAEA 1JIWP 1IAAA 3WV3A 3HBUP 1AYKA 3V96B 1ND1A 1BM6A 2L0RA 1MMQA 1DMTA 1JKYA 1A85A 1JAQA 1L6JA 5BOTA 2AYKA 1C8TA 4H84A 4J4MA 3LMCA 3ELMA 1KUIA 1RMZA 2OW1A 3EDGA 5D1SA 3OHLA 1B3DA 4DF9A 2WOAA 1ATLA 4AYKA 2HU6A 3U1RA 3KMEA 3Q2HA 1PWPA 2OY4A 4WKEA 3DL1A 2MLSA 1HY7A 3CKIA 5BOYA 2CLTA 4XM8A 2MZHA 5JMYA 3KMCA 1CIZA 2JNPA 1ZS0A 4R3VA 4G0DA 3TVCA 1HV5A 1K7IA 3AYKA 1ASTA 1FLSA 1Y8JA 1DTHA 4WZVA 1KUHA 4WK7A 2DW0A 2OW2A 3HY9A 1FBLA 4XCTA 2FV5A 2OW0A 2YB9A 1C3IA 3MA2A 3LQ0A 4ZR5A 2V4BA 4JPAA 3VI1A 3LE9A 3EWJA 4FVLA 1PWQA 1UMSA 3O64A 2K2GA 4GR0A 1IAGA 1CGFA 2X3BA 4GR3A 2J83A 966CA 2Y6DA 1WNIA 3F18A 2DDYA 3F19A 1GE5A 3EHXA 3HB2P 3N2VA 2MZIA 4A3WA 2WO9A 3F16A 4PKTA 4AXQA 4HX3A 3ZVSA 1QICA 1Q3AA 1PWVA 1J7NA 1XFXA 1MNCA 1Y93A 2O3EA 3LK8A 1AF0A 1R1JA 5D1UA 3I7IA 1D7XA 2RJPA 2MZEA 4H3XA 1IABA 3DPEA 3KEKA 3N2UA 5H8XA 2AIGP 1CGLA 1B8YA 2JIHA 4PKQA 5I3MA 4GUYA 3B8ZA 3HDAP 3P1VA 3WV1A 2D1NA 4FXQA 1HFSA 2CKIA 2OXZA 2QPJA 3LJZA 2YIGA 3LQBA 5D2BA 1QJJA 1ZXVA 3TSKA 5L79A 1UTTA 1G12A 2PJTA 2W12A 5B5PA 1SLMA 3B92A 1O0TA 1EB6A 2USNA 1MMPA 3HDBA 4L6TA 1EAKA 4H82A 3K7NA 1GE6A 1G05A 3F15A 3EDIA 3LKAA 2XS4A 3UVCA 4ILWD 2JSDA 1SRPA 3GBOA 1KBCA 3L0TA 3EDHA 1GO7P 3NX7A 2J0TA 2YUFA 1D8FA 4H30A 1OS9A 2SRTA 830CA 1Y0VA 4PKSA 2Z2DA 1YOUA 1GKCA 1RM8A 2XS3A 1OMJA 1HFCA 5CZMA 1MMBA 5I43A 5LABA 1AKLA 1BKCI 4ON1A 4HMAA 2A8HA 1SATA 2OVXA 3KECA 3Q2GA 1GXDA 3DNGA 4IJOA 4AIGA 1CAQA 1OO9A 2W13A 1G4KA 1JAOA 1D5JA 4GWNA 3EHYA 5I0LA 3B2ZA 4WKIA 1IACA 2I47A 3ZXHA 2OW9A 1XFWA 2EROA 3LGPA 4DV8A 1R55A 2TCLA 3TS4A 3AIGA 1R1HA 1FM1A 1MMRA 4JP4A 1BUVM 1BKCA 1XFUA 2Y6CA 5CUHA 3KRYA 3DTKA 4EFSA 456CA 5D3CA 3LEAA 1QUAA 1ZTQA 1JAPA 1BUDA 1UMTA 1A86A 1QIBA 1QIAA 1CXVA 1ZVXA 3SHIA 3WV2A 2JT5A 1YCMA 4I35A 4H2EA 2DDFA 4Q1LA 4L7AA 1USNA 2KRJA 2MLRA 2WO8A 1G49A 1GE7A 4XM7A 3HYGA 3BA0A 2X3CA 1XFYA 1UEAA 1KUKA 1HOVA 1BIWA 3LJGA 1Z3JA 1KAPP 1XUDA 1JK3A 3HY7A 2JT6A 1I73A 3LIRA 4L63A 3G42A 3LUNA 4JA1A 2X7MA 4IN9A 4FU4A 1CK7A 1ZXCA 3AYUA 4DD8A 4IUWA 3LIKA 3RTSA 4H76A 4JQGA 3E8RA 4QKZA 4DPEA 1BQOA 2DW1A 1ZP5A 2D1OA 1GKDA 1EUBA 2W15A 1PWWA 1C7KA 4AUOA 1SMPA 3LJTA 1SU3A 3KEJA 3LILA 1BZSA 1KUGA 1IADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFV A;  1O0Q A;  1OS2 A;  1XUC A;  1GO8 P;  4PKR A;  4G9L A;  2POJ A;  4PKW A;  1SLN A;  4H1Q A;  1D8M A;  3G5C A;  3DWB A;  5I12 A;  2ERP A;  1CGE A;  4WF6 A;  1XUR A;  2W0D A;  3L0V A;  3EDZ A;  2FV9 A;  1H71 P;  2OVZ A;  3K7L A;  1UTZ A;  4PKU A;  3DPF A;  1HTD A;  3KWV C;  4L19 A;  1YP1 A;  1OM7 A;  1OM6 A;  3I7G A;  2OI0 A;  4XM6 A;  2OY2 A;  1BKC E;  1BSW A;  3LUM A;  4GWM A;  1PWU A;  4CTH A;  4I03 A;  4GF1 A;  2X3A A;  1R54 A;  1R1I A;  2E2D A;  1K7G A;  5BPA A;  3RTT A;  2DW2 A;  1XFZ A;  3TT4 A;  3HBV P;  2K9C A;  5I4O A;  3P24 A;  1K7Q A;  1I1I P;  1QJI A;  2RJQ A;  2OXW A;  3VTG A;  1CQR A;  5D1T A;  2E3X A;  4PKV A;  3F17 A;  1JJ9 A;  4A7B A;  3USN A;  3O2X A;  3F1A A;  5D7W A;  4GR8 A;  4XBH A;  3KHI A;  1OM8 A;  1KUF A;  3DSL A;  1JIZ A;  2OZR A;  1JAN A;  4JIJ A;  1G9K A;  2W14 A;  5I2Z A;  2OXU A;  5B5O A;  2ERQ A;  1S4B P;  4GQL A;  1I76 A;  1BQQ M;  5L7F A;  1JH1 A;  1YQY A;  2N8R A;  3OHO A;  4FXY P;  1ROS A;  2O36 A;  3ZUK A;  4H49 A;  5CXA A;  1IAE A;  1JIW P;  1IAA A;  3WV3 A;  3HBU P;  1AYK A;  3V96 B;  1ND1 A;  1BM6 A;  2L0R A;  1MMQ A;  1DMT A;  1JKY A;  1A85 A;  1JAQ A;  1L6J A;  5BOT A;  2AYK A;  1C8T A;  4H84 A;  4J4M A;  3LMC A;  3ELM A;  1KUI A;  1RMZ A;  2OW1 A;  3EDG A;  5D1S A;  3OHL A;  1B3D A;  4DF9 A;  2WOA A;  1ATL A;  4AYK A;  2HU6 A;  3U1R A;  3KME A;  3Q2H A;  1PWP A;  2OY4 A;  4WKE A;  3DL1 A;  2MLS A;  1HY7 A;  3CKI A;  5BOY A;  2CLT A;  4XM8 A;  2MZH A;  5JMY A;  3KMC A;  1CIZ A;  2JNP A;  1ZS0 A;  4R3V A;  4G0D A;  3TVC A;  1HV5 A;  1K7I A;  3AYK A;  1AST A;  1FLS A;  1Y8J A;  1DTH A;  4WZV A;  1KUH A;  4WK7 A;  2DW0 A;  2OW2 A;  3HY9 A;  1FBL A;  4XCT A;  2FV5 A;  2OW0 A;  2YB9 A;  1C3I A;  3MA2 A;  3LQ0 A;  4ZR5 A;  2V4B A;  4JPA A;  3VI1 A;  3LE9 A;  3EWJ A;  4FVL A;  1PWQ A;  1UMS A;  3O64 A;  2K2G A;  4GR0 A;  1IAG A;  1CGF A;  2X3B A;  4GR3 A;  2J83 A;  966C A;  2Y6D A;  1WNI A;  3F18 A;  2DDY A;  3F19 A;  1GE5 A;  3EHX A;  3HB2 P;  3N2V A;  2MZI A;  4A3W A;  2WO9 A;  3F16 A;  4PKT A;  4AXQ A;  4HX3 A;  3ZVS A;  1QIC A;  1Q3A A;  1PWV A;  1J7N A;  1XFX A;  1MNC A;  1Y93 A;  2O3E A;  3LK8 A;  1AF0 A;  1R1J A;  5D1U A;  3I7I A;  1D7X A;  2RJP A;  2MZE A;  4H3X A;  1IAB A;  3DPE A;  3KEK A;  3N2U A;  5H8X A;  2AIG P;  1CGL A;  1B8Y A;  2JIH A;  4PKQ A;  5I3M A;  4GUY A;  3B8Z A;  3HDA P;  3P1V A;  3WV1 A;  2D1N A;  4FXQ A;  1HFS A;  2CKI A;  2OXZ A;  2QPJ A;  3LJZ A;  2YIG A;  3LQB A;  5D2B A;  1QJJ A;  1ZXV A;  3TSK A;  5L79 A;  1UTT A;  1G12 A;  2PJT A;  2W12 A;  5B5P A;  1SLM A;  3B92 A;  1O0T A;  1EB6 A;  2USN A;  1MMP A;  3HDB A;  4L6T A;  1EAK A;  4H82 A;  3K7N A;  1GE6 A;  1G05 A;  3F15 A;  3EDI A;  3LKA A;  2XS4 A;  3UVC A;  4ILW D;  2JSD A;  1SRP A;  3GBO A;  1KBC A;  3L0T A;  3EDH A;  1GO7 P;  3NX7 A;  2J0T A;  1D8F A;  4H30 A;  1OS9 A;  2SRT A;  830C A;  1Y0V A;  4PKS A;  2Z2D A;  1YOU A;  1GKC A;  1RM8 A;  2XS3 A;  1OMJ A;  1HFC A;  5CZM A;  1MMB A;  5I43 A;  5LAB A;  1AKL A;  1BKC I;  4ON1 A;  4HMA A;  2A8H A;  1SAT A;  2OVX A;  3KEC A;  3Q2G A;  1GXD A;  3DNG A;  4IJO A;  4AIG A;  1CAQ A;  1OO9 A;  2W13 A;  1G4K A;  1JAO A;  1D5J A;  4GWN A;  3EHY A;  5I0L A;  3B2Z A;  4WKI A;  1IAC A;  2I47 A;  3ZXH A;  2OW9 A;  1XFW A;  2ERO A;  3LGP A;  4DV8 A;  1R55 A;  2TCL A;  3TS4 A;  3AIG A;  1R1H A;  1FM1 A;  1MMR A;  4JP4 A;  1BUV M;  1BKC A;  1XFU A;  2Y6C A;  5CUH A;  3KRY A;  4EFS A;  456C A;  5D3C A;  3LEA A;  1QUA A;  1ZTQ A;  1JAP A;  1BUD A;  1UMT A;  1A86 A;  1QIB A;  1QIA A;  1CXV A;  1ZVX A;  3SHI A;  3WV2 A;  2JT5 A;  1YCM A;  4I35 A;  4H2E A;  2DDF A;  4Q1L A;  1USN A;  2KRJ A;  2MLR A;  2WO8 A;  1G49 A;  1GE7 A;  4XM7 A;  3HYG A;  3BA0 A;  2X3C A;  1XFY A;  1UEA A;  1KUK A;  1HOV A;  1BIW A;  3LJG A;  1Z3J A;  1KAP P;  1XUD A;  1JK3 A;  3HY7 A;  2JT6 A;  1I73 A;  3LIR A;  4L63 A;  3G42 A;  3LUN A;  4JA1 A;  2X7M A;  4IN9 A;  4FU4 A;  1CK7 A;  1ZXC A;  3AYU A;  4DD8 A;  4IUW A;  3LIK A;  3RTS A;  4H76 A;  4JQG A;  3E8R A;  4QKZ A;  4DPE A;  1BQO A;  2DW1 A;  1ZP5 A;  2D1O A;  1GKD A;  1EUB A;  2W15 A;  1PWW A;  1C7K A;  4AUO A;  1SMP A;  3LJT A;  1SU3 A;  3KEJ A;  3LIL A;  1BZS A;  1KUG A;  1IAD A; 
#chains in the Genus database with same CATH topology
 1XFV A;  1O0Q A;  1OS2 A;  1XUC A;  1GO8 P;  4PKR A;  4G9L A;  2POJ A;  4PKW A;  1SLN A;  4H1Q A;  1D8M A;  3G5C A;  3DWB A;  5I12 A;  2ERP A;  1CGE A;  4WF6 A;  1XUR A;  2W0D A;  3L0V A;  3EDZ A;  2FV9 A;  1H71 P;  2OVZ A;  3K7L A;  1UTZ A;  4PKU A;  3DPF A;  1HTD A;  3KWV C;  4L19 A;  1YP1 A;  1OM7 A;  1OM6 A;  3I7G A;  2OI0 A;  4XM6 A;  2OY2 A;  1BKC E;  1BSW A;  3LUM A;  4GWM A;  1PWU A;  4CTH A;  4I03 A;  4GF1 A;  2X3A A;  1R54 A;  1R1I A;  2E2D A;  1K7G A;  5BPA A;  3RTT A;  2DW2 A;  1XFZ A;  3TT4 A;  3HBV P;  3DTI A;  2K9C A;  5I4O A;  3P24 A;  3DTE A;  1K7Q A;  1I1I P;  1QJI A;  2RJQ A;  2OXW A;  3VTG A;  1CQR A;  5D1T A;  2E3X A;  4PKV A;  3F17 A;  1JJ9 A;  4A7B A;  3USN A;  3O2X A;  3F1A A;  5D7W A;  4GR8 A;  4XBH A;  3KHI A;  1OM8 A;  1KUF A;  3DSL A;  1JIZ A;  2OZR A;  1JAN A;  4JIJ A;  1G9K A;  2W14 A;  5I2Z A;  2OXU A;  5B5O A;  2ERQ A;  1S4B P;  4GQL A;  1I76 A;  1BQQ M;  5L7F A;  1JH1 A;  1YQY A;  2N8R A;  3OHO A;  4FXY P;  1ROS A;  2O36 A;  3ZUK A;  4H49 A;  5CXA A;  1IAE A;  1JIW P;  1IAA A;  3WV3 A;  3HBU P;  1AYK A;  3V96 B;  1ND1 A;  1BM6 A;  2L0R A;  1MMQ A;  1DMT A;  1JKY A;  1A85 A;  1JAQ A;  1L6J A;  5BOT A;  2AYK A;  1C8T A;  4H84 A;  4J4M A;  3LMC A;  3ELM A;  1KUI A;  1RMZ A;  2OW1 A;  3EDG A;  5D1S A;  3OHL A;  1B3D A;  4DF9 A;  2WOA A;  1ATL A;  4AYK A;  2HU6 A;  3U1R A;  3KME A;  3Q2H A;  1PWP A;  2OY4 A;  4WKE A;  3DL1 A;  2MLS A;  1HY7 A;  3CKI A;  5BOY A;  2CLT A;  4XM8 A;  2MZH A;  5JMY A;  3KMC A;  1CIZ A;  2JNP A;  1ZS0 A;  4R3V A;  4G0D A;  3TVC A;  1HV5 A;  1K7I A;  3AYK A;  1AST A;  1FLS A;  1Y8J A;  1DTH A;  4WZV A;  1KUH A;  4WK7 A;  2DW0 A;  2OW2 A;  3HY9 A;  1FBL A;  4XCT A;  2FV5 A;  2OW0 A;  2YB9 A;  1C3I A;  3MA2 A;  3LQ0 A;  4ZR5 A;  2V4B A;  4JPA A;  3VI1 A;  3LE9 A;  3EWJ A;  4FVL A;  1PWQ A;  1UMS A;  3O64 A;  2K2G A;  4GR0 A;  1IAG A;  1CGF A;  2X3B A;  4GR3 A;  2J83 A;  966C A;  2Y6D A;  1WNI A;  3F18 A;  2DDY A;  3F19 A;  1GE5 A;  3EHX A;  3HB2 P;  3N2V A;  2MZI A;  4A3W A;  2WO9 A;  3F16 A;  4PKT A;  4AXQ A;  4HX3 A;  3ZVS A;  1QIC A;  1Q3A A;  1PWV A;  1J7N A;  1XFX A;  1MNC A;  1Y93 A;  2O3E A;  3LK8 A;  1AF0 A;  1R1J A;  5D1U A;  3I7I A;  1D7X A;  2RJP A;  2MZE A;  4H3X A;  1IAB A;  3DPE A;  3KEK A;  3N2U A;  5H8X A;  2AIG P;  1CGL A;  1B8Y A;  2JIH A;  4PKQ A;  5I3M A;  4GUY A;  3B8Z A;  3HDA P;  3P1V A;  3WV1 A;  2D1N A;  4FXQ A;  1HFS A;  2CKI A;  2OXZ A;  2QPJ A;  3LJZ A;  2YIG A;  3LQB A;  5D2B A;  1QJJ A;  1ZXV A;  3TSK A;  5L79 A;  1UTT A;  1G12 A;  2PJT A;  2W12 A;  5B5P A;  1SLM A;  3B92 A;  1O0T A;  1EB6 A;  2USN A;  1MMP A;  3HDB A;  4L6T A;  1EAK A;  4H82 A;  3K7N A;  1GE6 A;  1G05 A;  3F15 A;  3EDI A;  3LKA A;  2XS4 A;  3UVC A;  4ILW D;  2JSD A;  1SRP A;  3GBO A;  1KBC A;  3L0T A;  3EDH A;  1GO7 P;  3NX7 A;  2J0T A;  2YUF A;  1D8F A;  4H30 A;  1OS9 A;  2SRT A;  830C A;  1Y0V A;  4PKS A;  2Z2D A;  1YOU A;  1GKC A;  1RM8 A;  2XS3 A;  1OMJ A;  1HFC A;  5CZM A;  1MMB A;  5I43 A;  5LAB A;  1AKL A;  1BKC I;  4ON1 A;  4HMA A;  2A8H A;  1SAT A;  2OVX A;  3KEC A;  3Q2G A;  1GXD A;  3DNG A;  4IJO A;  4AIG A;  1CAQ A;  1OO9 A;  2W13 A;  1G4K A;  1JAO A;  1D5J A;  4GWN A;  3EHY A;  5I0L A;  3B2Z A;  4WKI A;  1IAC A;  2I47 A;  3ZXH A;  2OW9 A;  1XFW A;  2ERO A;  3LGP A;  4DV8 A;  1R55 A;  2TCL A;  3TS4 A;  3AIG A;  1R1H A;  1FM1 A;  1MMR A;  4JP4 A;  1BUV M;  1OZ9 A;  1BKC A;  1XFU A;  2Y6C A;  5CUH A;  3KRY A;  3DTK A;  4EFS A;  456C A;  5D3C A;  3LEA A;  1QUA A;  1ZTQ A;  1JAP A;  1BUD A;  1UMT A;  1A86 A;  1QIB A;  1QIA A;  1CXV A;  1ZVX A;  3SHI A;  3WV2 A;  2JT5 A;  1YCM A;  4I35 A;  4H2E A;  2DDF A;  4Q1L A;  4L7A A;  1USN A;  2KRJ A;  2MLR A;  2WO8 A;  1G49 A;  1GE7 A;  4XM7 A;  3HYG A;  3BA0 A;  2X3C A;  1XFY A;  1UEA A;  1KUK A;  1HOV A;  1BIW A;  3LJG A;  1Z3J A;  1KAP P;  1XUD A;  1JK3 A;  3HY7 A;  2JT6 A;  1I73 A;  3LIR A;  4L63 A;  3G42 A;  3LUN A;  4JA1 A;  2X7M A;  4IN9 A;  4FU4 A;  1CK7 A;  1ZXC A;  3AYU A;  4DD8 A;  4IUW A;  3LIK A;  3RTS A;  4H76 A;  4JQG A;  3E8R A;  4QKZ A;  4DPE A;  1BQO A;  2DW1 A;  1ZP5 A;  2D1O A;  1GKD A;  1XM5 A;  1EUB A;  2W15 A;  1PWW A;  1TVI A;  1C7K A;  4AUO A;  1SMP A;  3LJT A;  1XAX A;  1SU3 A;  3KEJ A;  3LIL A;  1BZS A;  1KUG A;  1IAD A; 
#chains in the Genus database with same CATH homology
 1XFV A;  1O0Q A;  1OS2 A;  1XUC A;  1GO8 P;  4PKR A;  4G9L A;  2POJ A;  4PKW A;  1SLN A;  4H1Q A;  1D8M A;  3G5C A;  3DWB A;  5I12 A;  2ERP A;  1CGE A;  4WF6 A;  1XUR A;  2W0D A;  3L0V A;  3EDZ A;  2FV9 A;  1H71 P;  2OVZ A;  3K7L A;  1UTZ A;  4PKU A;  3DPF A;  1HTD A;  3KWV C;  4L19 A;  1YP1 A;  1OM7 A;  1OM6 A;  3I7G A;  2OI0 A;  4XM6 A;  2OY2 A;  1BKC E;  1BSW A;  3LUM A;  4GWM A;  1PWU A;  4CTH A;  4I03 A;  4GF1 A;  2X3A A;  1R54 A;  1R1I A;  2E2D A;  1K7G A;  5BPA A;  3RTT A;  2DW2 A;  1XFZ A;  3TT4 A;  3HBV P;  3DTI A;  2K9C A;  5I4O A;  3P24 A;  3DTE A;  1K7Q A;  1I1I P;  1QJI A;  2RJQ A;  2OXW A;  3VTG A;  1CQR A;  5D1T A;  2E3X A;  4PKV A;  3F17 A;  1JJ9 A;  4A7B A;  3USN A;  3O2X A;  3F1A A;  5D7W A;  4GR8 A;  4XBH A;  3KHI A;  1OM8 A;  1KUF A;  3DSL A;  1JIZ A;  2OZR A;  1JAN A;  4JIJ A;  1G9K A;  2W14 A;  5I2Z A;  2OXU A;  5B5O A;  2ERQ A;  1S4B P;  4GQL A;  1I76 A;  1BQQ M;  5L7F A;  1JH1 A;  1YQY A;  2N8R A;  3OHO A;  4FXY P;  1ROS A;  2O36 A;  3ZUK A;  4H49 A;  5CXA A;  1IAE A;  1JIW P;  1IAA A;  3WV3 A;  3HBU P;  1AYK A;  3V96 B;  1ND1 A;  1BM6 A;  2L0R A;  1MMQ A;  1DMT A;  1JKY A;  1A85 A;  1JAQ A;  1L6J A;  5BOT A;  2AYK A;  1C8T A;  4H84 A;  4J4M A;  3LMC A;  3ELM A;  1KUI A;  1RMZ A;  2OW1 A;  3EDG A;  5D1S A;  3OHL A;  1B3D A;  4DF9 A;  2WOA A;  1ATL A;  4AYK A;  2HU6 A;  3U1R A;  3KME A;  3Q2H A;  1PWP A;  2OY4 A;  4WKE A;  3DL1 A;  2MLS A;  1HY7 A;  3CKI A;  5BOY A;  2CLT A;  4XM8 A;  2MZH A;  5JMY A;  3KMC A;  1CIZ A;  2JNP A;  1ZS0 A;  4R3V A;  4G0D A;  3TVC A;  1HV5 A;  1K7I A;  3AYK A;  1AST A;  1FLS A;  1Y8J A;  1DTH A;  4WZV A;  1KUH A;  4WK7 A;  2DW0 A;  2OW2 A;  3HY9 A;  1FBL A;  4XCT A;  2FV5 A;  2OW0 A;  2YB9 A;  1C3I A;  3MA2 A;  3LQ0 A;  4ZR5 A;  2V4B A;  4JPA A;  3VI1 A;  3LE9 A;  3EWJ A;  4FVL A;  1PWQ A;  1UMS A;  3O64 A;  2K2G A;  4GR0 A;  1IAG A;  1CGF A;  2X3B A;  4GR3 A;  2J83 A;  966C A;  2Y6D A;  1WNI A;  3F18 A;  2DDY A;  3F19 A;  1GE5 A;  3EHX A;  3HB2 P;  3N2V A;  2MZI A;  4A3W A;  2WO9 A;  3F16 A;  4PKT A;  4AXQ A;  4HX3 A;  3ZVS A;  1QIC A;  1Q3A A;  1PWV A;  1J7N A;  1XFX A;  1MNC A;  1Y93 A;  2O3E A;  3LK8 A;  1AF0 A;  1R1J A;  5D1U A;  3I7I A;  1D7X A;  2RJP A;  2MZE A;  4H3X A;  1IAB A;  3DPE A;  3KEK A;  3N2U A;  5H8X A;  2AIG P;  1CGL A;  1B8Y A;  2JIH A;  4PKQ A;  5I3M A;  4GUY A;  3B8Z A;  3HDA P;  3P1V A;  3WV1 A;  2D1N A;  4FXQ A;  1HFS A;  2CKI A;  2OXZ A;  2QPJ A;  3LJZ A;  2YIG A;  3LQB A;  5D2B A;  1QJJ A;  1ZXV A;  3TSK A;  5L79 A;  1UTT A;  1G12 A;  2PJT A;  2W12 A;  5B5P A;  1SLM A;  3B92 A;  1O0T A;  1EB6 A;  2USN A;  1MMP A;  3HDB A;  4L6T A;  1EAK A;  4H82 A;  3K7N A;  1GE6 A;  1G05 A;  3F15 A;  3EDI A;  3LKA A;  2XS4 A;  3UVC A;  4ILW D;  2JSD A;  1SRP A;  3GBO A;  1KBC A;  3L0T A;  3EDH A;  1GO7 P;  3NX7 A;  2J0T A;  2YUF A;  1D8F A;  4H30 A;  1OS9 A;  2SRT A;  830C A;  1Y0V A;  4PKS A;  2Z2D A;  1YOU A;  1GKC A;  1RM8 A;  2XS3 A;  1OMJ A;  1HFC A;  5CZM A;  1MMB A;  5I43 A;  5LAB A;  1AKL A;  1BKC I;  4ON1 A;  4HMA A;  2A8H A;  1SAT A;  2OVX A;  3KEC A;  3Q2G A;  1GXD A;  3DNG A;  4IJO A;  4AIG A;  1CAQ A;  1OO9 A;  2W13 A;  1G4K A;  1JAO A;  1D5J A;  4GWN A;  3EHY A;  5I0L A;  3B2Z A;  4WKI A;  1IAC A;  2I47 A;  3ZXH A;  2OW9 A;  1XFW A;  2ERO A;  3LGP A;  4DV8 A;  1R55 A;  2TCL A;  3TS4 A;  3AIG A;  1R1H A;  1FM1 A;  1MMR A;  4JP4 A;  1BUV M;  1BKC A;  1XFU A;  2Y6C A;  5CUH A;  3KRY A;  3DTK A;  4EFS A;  456C A;  5D3C A;  3LEA A;  1QUA A;  1ZTQ A;  1JAP A;  1BUD A;  1UMT A;  1A86 A;  1QIB A;  1QIA A;  1CXV A;  1ZVX A;  3SHI A;  3WV2 A;  2JT5 A;  1YCM A;  4I35 A;  4H2E A;  2DDF A;  4Q1L A;  4L7A A;  1USN A;  2KRJ A;  2MLR A;  2WO8 A;  1G49 A;  1GE7 A;  4XM7 A;  3HYG A;  3BA0 A;  2X3C A;  1XFY A;  1UEA A;  1KUK A;  1HOV A;  1BIW A;  3LJG A;  1Z3J A;  1KAP P;  1XUD A;  1JK3 A;  3HY7 A;  2JT6 A;  1I73 A;  3LIR A;  4L63 A;  3G42 A;  3LUN A;  4JA1 A;  2X7M A;  4IN9 A;  4FU4 A;  1CK7 A;  1ZXC A;  3AYU A;  4DD8 A;  4IUW A;  3LIK A;  3RTS A;  4H76 A;  4JQG A;  3E8R A;  4QKZ A;  4DPE A;  1BQO A;  2DW1 A;  1ZP5 A;  2D1O A;  1GKD A;  1EUB A;  2W15 A;  1PWW A;  1C7K A;  4AUO A;  1SMP A;  3LJT A;  1SU3 A;  3KEJ A;  3LIL A;  1BZS A;  1KUG A;  1IAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...