2Y6DA

The discovery of mmp7 inhibitors exploiting a novel selectivity trigger
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
159
Chain Sequence
GYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYFKLSQDDIKGIQKLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRILYSIN
publication title The Discovery of Mmp7 Inhibitors Exploiting a Novel Selectivity Trigger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 159
sequence length 166
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2y6dA00
1BIWA 1BQOA 2FV9A 3LQBA 1DTHA 2OY4A 1PWVA 3I7GA 1BZSA 1Y8JA 4WZVA 1HTDA 4GQLA 5CXAA 5D1TA 3LUMA 1JK3A 1H71P 2DDYA 2FV5A 3B92A 1PWQA 1BKCE 1K7QA 4WK7A 1CIZA 1I73A 1MMRA 4FXYP 2OXWA 1ROSA 1O0QA 1MMQA 1EB6A 1PWWA 2OVXA 3LJGA 4GWNA 2OVZA 3LQ0A 1HV5A 1IAAA 3VI1A 1G9KA 2I47A 2W13A 4ON1A 2OXUA 2WOAA 1OS9A 4XM7A 1HY7A 4PKUA 2MLRA 5B5OA 4G0DA 1R1HA 3ZXHA 2Z2DA 3EDIA 1R1JA 2O3EA 4J4MA 1OS2A 1ZP5A 1OMJA 3EDZA 3B2ZA 1FLSA 1HFCA 1MMBA 1L6JA 2D1NA 3E8RA 1JANA 1R1IA 3LKAA 3KEJA 5D2BA 2ERPA 2A8HA 2MLSA 3F18A 1G49A 2RJQA 1CGEA 2W14A 4ZR5A 2XS4A 3LIRA 4JP4A 3ZVSA 2YB9A 2JSDA 1QICA 1IABA 1JIWP 3HYGA 4Q1LA 3TVCA 2W0DA 1CAQA 4H49A 3HDBA 1IAGA 4XBHA 4AXQA 5I0LA 1ZXCA 1JH1A 1HFSA 3DNGA 3HBVP 2Y6CA 3F17A 2DDFA 3LEAA 5D7WA 4DF9A 1GO8P 3Q2GA 4PKRA 1BSWA 3I7IA 5D3CA 1CGLA 1FBLA 4XM8A 1XFWA 1K7GA 4DD8A 3TSKA 2KRJA 2N8RA 1IACA 3F16A 1D8FA 3KMEA 1S4BP 5L79A 1XFYA 3DPEA 1FM1A 5D1SA 4H1QA 5BOYA 3EDGA 4JQGA 2X3CA 1G05A 3LGPA 3F15A 2X7MA 1GO7P 4AYKA 4FXQA 1CK7A 1YCMA 5I4OA 1B8YA 1CXVA 1XFVA 2WO9A 1OM6A 2WO8A 4I35A 3LILA 1QIBA 1KUIA 1XFUA 3LK8A 3EHYA 2MZIA 1ATLA 1SMPA 4GR3A 4IJOA 3F1AA 1RMZA 3KWVC 456CA 1JIZA 830CA 1D8MA 1Y0VA 3HY7A 5I2ZA 2J0TA 2OW0A 2DW2A 3AYUA 3SHIA 5H8XA 1JAOA 1GXDA 3Q2HA 5JMYA 1SLNA 2OI0A 4QKZA 3K7LA 1JAQA 5LABA 2CKIA 3RTTA 3HBUP 3HY9A 3WV3A 3G42A 4A3WA 3BA0A 4PKSA 2W15A 1OO9A 1EAKA 3HDAP 4EFSA 1C8TA 2MZEA 3U1RA 1SU3A 1ASTA 1BUDA 1UMTA 1QJJA 3LMCA 4HX3A 4L6TA 4PKQA 4CTHA 3CKIA 1XFZA 3KEKA 2USNA 1IAEA 3KRYA 3DPFA 1KUHA 3N2UA 3P1VA 1B3DA 2AYKA 1O0TA 1K7IA 4WKIA 3DL1A 3NX7A 4H3XA 2E2DA 1GE7A 3HB2P 2QPJA 1PWUA 1G12A 1KAPP 3L0TA 2O36A 1KUFA 1OM8A 1ND1A 4AIGA 1YP1A 3MA2A 4H84A 5I12A 4GR8A 1ZXVA 3EDHA 1QUAA 1XFXA 2Y6DA 4AUOA 2POJA 2ERQA 2JNPA 1YOUA 1D5JA 4DPEA 3UVCA 4H76A 4JIJA 2EROA 5CZMA 1BKCA 4XM6A 1UTZA 2JT6A 3DWBA 5B5PA 1C7KA 1A85A 1XURA 1UMSA 4JPAA 4G9LA 4GR0A 2OXZA 3KECA 3USNA 1R55A 1PWPA 1Y93A 1EUBA 1GE6A 1Z3JA 1D7XA 4GF1A 2HU6A 3LIKA 3LUNA 4I03A 1JKYA 3EWJA 2RJPA 4GUYA 4IUWA 4L63A 1GKDA 1AF0A 4JA1A 2OZRA 4PKTA 3LE9A 3O64A 3B8ZA 4FU4A 3LJTA 1UTTA 1A86A 1XUDA 5I3MA 3EHXA 3TT4A 1WNIA 1XUCA 4A7BA 2K2GA 1GKCA 2X3AA 3N2VA 1I76A 4GWMA 1HOVA 3G5CA 2W12A 4H2EA 2PJTA 3WV1A 2CLTA 1C3IA 2OW9A 1QJIA 1BUVM 4WF6A 2JT5A 5BPAA 1ZTQA 4FVLA 4IN9A 4WKEA 2X3BA 1AYKA 2SRTA 1BKCI 1Q3AA 1YQYA 1KUKA 4DV8A 1CGFA 3ZUKA 2L0RA 3P24A 2JIHA 1RM8A 2V4BA 3O2XA 1KBCA 4HMAA 3AIGA 1MMPA 4H82A 1MNCA 3OHLA 2MZHA 4XCTA 2AIGP 3GBOA 4R3VA 1DMTA 1KUGA 4L19A 1GE5A 5D1UA 1USNA 2E3XA 966CA 2K9CA 4PKVA 4PKWA 1SATA 3AYKA 3K7NA 1IADA 1QIAA 1OM7A 1JAPA 1SLMA 3L0VA 1SRPA 3F19A 4ILWD 3RTSA 3DSLA 2XS3A 3WV2A 1CQRA 3LJZA 4H30A 5CUHA 1JJ9A 5I43A 1J7NA 1BQQM 5L7FA 3ELMA 2J83A 2DW1A 1BM6A 1R54A 3KHIA 3TS4A 2YIGA 1AKLA 1G4KA 5BOTA 1I1IP 3OHOA 3KMCA 2OY2A 2TCLA 3V96B 1ZVXA 2OW2A 2OW1A 2D1OA 1ZS0A 2DW0A 1UEAA 3VTGA
chains in the Genus database with same CATH superfamily
1BIWA 1BQOA 2FV9A 3LQBA 1DTHA 2OY4A 1PWVA 3I7GA 1BZSA 1Y8JA 4WZVA 1HTDA 4GQLA 5CXAA 5D1TA 3LUMA 1JK3A 1H71P 2DDYA 2FV5A 3B92A 1PWQA 1BKCE 1K7QA 4WK7A 1CIZA 1I73A 1XM5A 1MMRA 4FXYP 2OXWA 1ROSA 1O0QA 1MMQA 1EB6A 1PWWA 2OVXA 3LJGA 4GWNA 2OVZA 3LQ0A 1HV5A 1IAAA 3VI1A 1G9KA 2I47A 2W13A 4ON1A 2OXUA 2WOAA 1OS9A 4XM7A 1HY7A 4PKUA 2MLRA 5B5OA 4G0DA 1R1HA 3ZXHA 3DTIA 2Z2DA 3EDIA 1R1JA 2O3EA 4J4MA 1OS2A 1ZP5A 1OMJA 3EDZA 3B2ZA 1FLSA 3DTEA 1HFCA 1MMBA 1L6JA 2D1NA 3E8RA 1JANA 1R1IA 3LKAA 3KEJA 5D2BA 2ERPA 2A8HA 2MLSA 3F18A 1G49A 2RJQA 1CGEA 2W14A 4ZR5A 2XS4A 3LIRA 4JP4A 3ZVSA 2YB9A 2JSDA 1QICA 1IABA 1JIWP 3HYGA 4Q1LA 3TVCA 2W0DA 1CAQA 4H49A 3DTKA 3HDBA 1IAGA 4XBHA 4AXQA 5I0LA 1ZXCA 1JH1A 1HFSA 3DNGA 3HBVP 2Y6CA 3F17A 2DDFA 1XAXA 3LEAA 5D7WA 4DF9A 1GO8P 3Q2GA 4PKRA 1BSWA 3I7IA 5D3CA 1CGLA 1FBLA 4XM8A 1XFWA 1K7GA 4DD8A 3TSKA 2KRJA 2N8RA 1IACA 3F16A 1D8FA 3KMEA 1S4BP 5L79A 1XFYA 3DPEA 1FM1A 5D1SA 4H1QA 5BOYA 3EDGA 4JQGA 2X3CA 1G05A 3LGPA 3F15A 2X7MA 1GO7P 4AYKA 4FXQA 1CK7A 1YCMA 5I4OA 1B8YA 1CXVA 1XFVA 2WO9A 1OM6A 2WO8A 4I35A 3LILA 1QIBA 1KUIA 1XFUA 3LK8A 3EHYA 2MZIA 1ATLA 1SMPA 4GR3A 4IJOA 3F1AA 1RMZA 3KWVC 456CA 1JIZA 830CA 1D8MA 1Y0VA 3HY7A 5I2ZA 2J0TA 2OW0A 2DW2A 3AYUA 3SHIA 5H8XA 1JAOA 1GXDA 3Q2HA 5JMYA 1SLNA 2OI0A 4QKZA 3K7LA 1JAQA 5LABA 2CKIA 3RTTA 3HBUP 3HY9A 3WV3A 3G42A 4A3WA 3BA0A 4PKSA 2W15A 1OO9A 1EAKA 3HDAP 4EFSA 1C8TA 2MZEA 3U1RA 1SU3A 1ASTA 1BUDA 1UMTA 1QJJA 3LMCA 4HX3A 4L6TA 4PKQA 4CTHA 3CKIA 1XFZA 3KEKA 2USNA 1IAEA 3KRYA 3DPFA 1KUHA 3N2UA 3P1VA 1B3DA 2AYKA 1O0TA 1K7IA 4WKIA 3DL1A 3NX7A 2YUFA 4H3XA 2E2DA 1GE7A 3HB2P 2QPJA 1PWUA 1G12A 1KAPP 3L0TA 2O36A 1KUFA 1OM8A 1ND1A 4AIGA 1YP1A 3MA2A 4H84A 5I12A 4GR8A 1ZXVA 3EDHA 1QUAA 1XFXA 2Y6DA 4AUOA 4L7AA 2POJA 2ERQA 2JNPA 1YOUA 1D5JA 4DPEA 3UVCA 4H76A 4JIJA 2EROA 5CZMA 1BKCA 4XM6A 1UTZA 2JT6A 3DWBA 5B5PA 1C7KA 1A85A 1XURA 1UMSA 4JPAA 4G9LA 4GR0A 2OXZA 3KECA 3USNA 1R55A 1PWPA 1Y93A 1EUBA 1GE6A 1Z3JA 1D7XA 4GF1A 2HU6A 3LIKA 3LUNA 4I03A 1JKYA 3EWJA 2RJPA 4GUYA 4IUWA 4L63A 1GKDA 1AF0A 4JA1A 2OZRA 4PKTA 3LE9A 3O64A 3B8ZA 4FU4A 3LJTA 1UTTA 1A86A 1XUDA 5I3MA 3EHXA 3TT4A 1WNIA 1XUCA 4A7BA 2K2GA 1GKCA 2X3AA 3N2VA 1I76A 4GWMA 1HOVA 3G5CA 2W12A 4H2EA 2PJTA 3WV1A 2CLTA 1C3IA 2OW9A 1QJIA 1BUVM 4WF6A 2JT5A 5BPAA 1ZTQA 4FVLA 4IN9A 4WKEA 2X3BA 1AYKA 2SRTA 1BKCI 1Q3AA 1YQYA 1KUKA 4DV8A 1CGFA 3ZUKA 2L0RA 3P24A 2JIHA 1RM8A 2V4BA 3O2XA 1KBCA 4HMAA 3AIGA 1MMPA 4H82A 1MNCA 3OHLA 1OZ9A 2MZHA 4XCTA 2AIGP 3GBOA 4R3VA 1DMTA 1KUGA 4L19A 1GE5A 5D1UA 1USNA 2E3XA 966CA 2K9CA 4PKVA 4PKWA 1SATA 3AYKA 3K7NA 1IADA 1QIAA 1OM7A 1JAPA 1SLMA 3L0VA 1SRPA 3F19A 4ILWD 3RTSA 3DSLA 2XS3A 3WV2A 1CQRA 3LJZA 4H30A 5CUHA 1JJ9A 5I43A 1J7NA 1TVIA 1BQQM 5L7FA 3ELMA 2J83A 2DW1A 1BM6A 1R54A 3KHIA 3TS4A 2YIGA 1AKLA 1G4KA 5BOTA 1I1IP 3OHOA 3KMCA 2OY2A 2TCLA 3V96B 1ZVXA 2OW2A 2OW1A 2D1OA 1ZS0A 2DW0A 1UEAA 3VTGA
chains in the Genus database with same CATH topology
1BIWA 1BQOA 2FV9A 3LQBA 1DTHA 2OY4A 1PWVA 3I7GA 1BZSA 1Y8JA 4WZVA 1HTDA 4GQLA 5CXAA 5D1TA 3LUMA 1JK3A 1H71P 2DDYA 2FV5A 3B92A 1PWQA 1BKCE 1K7QA 4WK7A 1CIZA 1I73A 1MMRA 4FXYP 2OXWA 1ROSA 1O0QA 1MMQA 1EB6A 1PWWA 2OVXA 3LJGA 4GWNA 2OVZA 3LQ0A 1HV5A 1IAAA 3VI1A 1G9KA 2I47A 2W13A 4ON1A 2OXUA 2WOAA 1OS9A 4XM7A 1HY7A 4PKUA 2MLRA 5B5OA 4G0DA 1R1HA 3ZXHA 3DTIA 2Z2DA 3EDIA 1R1JA 2O3EA 4J4MA 1OS2A 1ZP5A 1OMJA 3EDZA 3B2ZA 1FLSA 3DTEA 1HFCA 1MMBA 1L6JA 2D1NA 3E8RA 1JANA 1R1IA 3LKAA 3KEJA 5D2BA 2ERPA 2A8HA 2MLSA 3F18A 1G49A 2RJQA 1CGEA 2W14A 4ZR5A 2XS4A 3LIRA 4JP4A 3ZVSA 2YB9A 2JSDA 1QICA 1IABA 1JIWP 3HYGA 4Q1LA 3TVCA 2W0DA 1CAQA 4H49A 3DTKA 3HDBA 1IAGA 4XBHA 4AXQA 5I0LA 1ZXCA 1JH1A 1HFSA 3DNGA 3HBVP 2Y6CA 3F17A 2DDFA 3LEAA 5D7WA 4DF9A 1GO8P 3Q2GA 4PKRA 1BSWA 3I7IA 5D3CA 1CGLA 1FBLA 4XM8A 1XFWA 1K7GA 4DD8A 3TSKA 2KRJA 2N8RA 1IACA 3F16A 1D8FA 3KMEA 1S4BP 5L79A 1XFYA 3DPEA 1FM1A 5D1SA 4H1QA 5BOYA 3EDGA 4JQGA 2X3CA 1G05A 3LGPA 3F15A 2X7MA 1GO7P 4AYKA 4FXQA 1CK7A 1YCMA 5I4OA 1B8YA 1CXVA 1XFVA 2WO9A 1OM6A 2WO8A 4I35A 3LILA 1QIBA 1KUIA 1XFUA 3LK8A 3EHYA 2MZIA 1ATLA 1SMPA 4GR3A 4IJOA 3F1AA 1RMZA 3KWVC 456CA 1JIZA 830CA 1D8MA 1Y0VA 3HY7A 5I2ZA 2J0TA 2OW0A 2DW2A 3AYUA 3SHIA 5H8XA 1JAOA 1GXDA 3Q2HA 5JMYA 1SLNA 2OI0A 4QKZA 3K7LA 1JAQA 5LABA 2CKIA 3RTTA 3HBUP 3HY9A 3WV3A 3G42A 4A3WA 3BA0A 4PKSA 2W15A 1OO9A 1EAKA 3HDAP 4EFSA 1C8TA 2MZEA 3U1RA 1SU3A 1ASTA 1BUDA 1UMTA 1QJJA 3LMCA 4HX3A 4L6TA 4PKQA 4CTHA 3CKIA 1XFZA 3KEKA 2USNA 1IAEA 3KRYA 3DPFA 1KUHA 3N2UA 3P1VA 1B3DA 2AYKA 1O0TA 1K7IA 4WKIA 3DL1A 3NX7A 2YUFA 4H3XA 2E2DA 1GE7A 3HB2P 2QPJA 1PWUA 1G12A 1KAPP 3L0TA 2O36A 1KUFA 1OM8A 1ND1A 4AIGA 1YP1A 3MA2A 4H84A 5I12A 4GR8A 1ZXVA 3EDHA 1QUAA 1XFXA 2Y6DA 4AUOA 4L7AA 2POJA 2ERQA 2JNPA 1YOUA 1D5JA 4DPEA 3UVCA 4H76A 4JIJA 2EROA 5CZMA 1BKCA 4XM6A 1UTZA 2JT6A 3DWBA 5B5PA 1C7KA 1A85A 1XURA 1UMSA 4JPAA 4G9LA 4GR0A 2OXZA 3KECA 3USNA 1R55A 1PWPA 1Y93A 1EUBA 1GE6A 1Z3JA 1D7XA 4GF1A 2HU6A 3LIKA 3LUNA 4I03A 1JKYA 3EWJA 2RJPA 4GUYA 4IUWA 4L63A 1GKDA 1AF0A 4JA1A 2OZRA 4PKTA 3LE9A 3O64A 3B8ZA 4FU4A 3LJTA 1UTTA 1A86A 1XUDA 5I3MA 3EHXA 3TT4A 1WNIA 1XUCA 4A7BA 2K2GA 1GKCA 2X3AA 3N2VA 1I76A 4GWMA 1HOVA 3G5CA 2W12A 4H2EA 2PJTA 3WV1A 2CLTA 1C3IA 2OW9A 1QJIA 1BUVM 4WF6A 2JT5A 5BPAA 1ZTQA 4FVLA 4IN9A 4WKEA 2X3BA 1AYKA 2SRTA 1BKCI 1Q3AA 1YQYA 1KUKA 4DV8A 1CGFA 3ZUKA 2L0RA 3P24A 2JIHA 1RM8A 2V4BA 3O2XA 1KBCA 4HMAA 3AIGA 1MMPA 4H82A 1MNCA 3OHLA 2MZHA 4XCTA 2AIGP 3GBOA 4R3VA 1DMTA 1KUGA 4L19A 1GE5A 5D1UA 1USNA 2E3XA 966CA 2K9CA 4PKVA 4PKWA 1SATA 3AYKA 3K7NA 1IADA 1QIAA 1OM7A 1JAPA 1SLMA 3L0VA 1SRPA 3F19A 4ILWD 3RTSA 3DSLA 2XS3A 3WV2A 1CQRA 3LJZA 4H30A 5CUHA 1JJ9A 5I43A 1J7NA 1BQQM 5L7FA 3ELMA 2J83A 2DW1A 1BM6A 1R54A 3KHIA 3TS4A 2YIGA 1AKLA 1G4KA 5BOTA 1I1IP 3OHOA 3KMCA 2OY2A 2TCLA 3V96B 1ZVXA 2OW2A 2OW1A 2D1OA 1ZS0A 2DW0A 1UEAA 3VTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIW A;  1BQO A;  2FV9 A;  3LQB A;  1DTH A;  2OY4 A;  1PWV A;  3I7G A;  1BZS A;  1Y8J A;  4WZV A;  1HTD A;  4GQL A;  5CXA A;  5D1T A;  3LUM A;  1JK3 A;  1H71 P;  2DDY A;  2FV5 A;  3B92 A;  1PWQ A;  1BKC E;  1K7Q A;  4WK7 A;  1CIZ A;  1I73 A;  1MMR A;  4FXY P;  2OXW A;  1ROS A;  1O0Q A;  1MMQ A;  1EB6 A;  1PWW A;  2OVX A;  3LJG A;  4GWN A;  2OVZ A;  3LQ0 A;  1HV5 A;  1IAA A;  3VI1 A;  1G9K A;  2I47 A;  2W13 A;  4ON1 A;  2OXU A;  2WOA A;  1OS9 A;  4XM7 A;  1HY7 A;  4PKU A;  2MLR A;  5B5O A;  4G0D A;  1R1H A;  3ZXH A;  2Z2D A;  3EDI A;  1R1J A;  2O3E A;  4J4M A;  1OS2 A;  1ZP5 A;  1OMJ A;  3EDZ A;  3B2Z A;  1FLS A;  1HFC A;  1MMB A;  1L6J A;  2D1N A;  3E8R A;  1JAN A;  1R1I A;  3LKA A;  3KEJ A;  5D2B A;  2ERP A;  2A8H A;  2MLS A;  3F18 A;  1G49 A;  2RJQ A;  1CGE A;  2W14 A;  4ZR5 A;  2XS4 A;  3LIR A;  4JP4 A;  3ZVS A;  2YB9 A;  2JSD A;  1QIC A;  1IAB A;  1JIW P;  3HYG A;  4Q1L A;  3TVC A;  2W0D A;  1CAQ A;  4H49 A;  3HDB A;  1IAG A;  4XBH A;  4AXQ A;  5I0L A;  1ZXC A;  1JH1 A;  1HFS A;  3DNG A;  3HBV P;  2Y6C A;  3F17 A;  2DDF A;  3LEA A;  5D7W A;  4DF9 A;  1GO8 P;  3Q2G A;  4PKR A;  1BSW A;  3I7I A;  5D3C A;  1CGL A;  1FBL A;  4XM8 A;  1XFW A;  1K7G A;  4DD8 A;  3TSK A;  2KRJ A;  2N8R A;  1IAC A;  3F16 A;  1D8F A;  3KME A;  1S4B P;  5L79 A;  1XFY A;  3DPE A;  1FM1 A;  5D1S A;  4H1Q A;  5BOY A;  3EDG A;  4JQG A;  2X3C A;  1G05 A;  3LGP A;  3F15 A;  2X7M A;  1GO7 P;  4AYK A;  4FXQ A;  1CK7 A;  1YCM A;  5I4O A;  1B8Y A;  1CXV A;  1XFV A;  2WO9 A;  1OM6 A;  2WO8 A;  4I35 A;  3LIL A;  1QIB A;  1KUI A;  1XFU A;  3LK8 A;  3EHY A;  2MZI A;  1ATL A;  1SMP A;  4GR3 A;  4IJO A;  3F1A A;  1RMZ A;  3KWV C;  456C A;  1JIZ A;  830C A;  1D8M A;  1Y0V A;  3HY7 A;  5I2Z A;  2J0T A;  2OW0 A;  2DW2 A;  3AYU A;  3SHI A;  5H8X A;  1JAO A;  1GXD A;  3Q2H A;  5JMY A;  1SLN A;  2OI0 A;  4QKZ A;  3K7L A;  1JAQ A;  5LAB A;  2CKI A;  3RTT A;  3HBU P;  3HY9 A;  3WV3 A;  3G42 A;  4A3W A;  3BA0 A;  4PKS A;  2W15 A;  1OO9 A;  1EAK A;  3HDA P;  4EFS A;  1C8T A;  2MZE A;  3U1R A;  1SU3 A;  1AST A;  1BUD A;  1UMT A;  1QJJ A;  3LMC A;  4HX3 A;  4L6T A;  4PKQ A;  4CTH A;  3CKI A;  1XFZ A;  3KEK A;  2USN A;  1IAE A;  3KRY A;  3DPF A;  1KUH A;  3N2U A;  3P1V A;  1B3D A;  2AYK A;  1O0T A;  1K7I A;  4WKI A;  3DL1 A;  3NX7 A;  4H3X A;  2E2D A;  1GE7 A;  3HB2 P;  2QPJ A;  1PWU A;  1G12 A;  1KAP P;  3L0T A;  2O36 A;  1KUF A;  1OM8 A;  1ND1 A;  4AIG A;  1YP1 A;  3MA2 A;  4H84 A;  5I12 A;  4GR8 A;  1ZXV A;  3EDH A;  1QUA A;  1XFX A;  2Y6D A;  4AUO A;  2POJ A;  2ERQ A;  2JNP A;  1YOU A;  1D5J A;  4DPE A;  3UVC A;  4H76 A;  4JIJ A;  2ERO A;  5CZM A;  1BKC A;  4XM6 A;  1UTZ A;  2JT6 A;  3DWB A;  5B5P A;  1C7K A;  1A85 A;  1XUR A;  1UMS A;  4JPA A;  4G9L A;  4GR0 A;  2OXZ A;  3KEC A;  3USN A;  1R55 A;  1PWP A;  1Y93 A;  1EUB A;  1GE6 A;  1Z3J A;  1D7X A;  4GF1 A;  2HU6 A;  3LIK A;  3LUN A;  4I03 A;  1JKY A;  3EWJ A;  2RJP A;  4GUY A;  4IUW A;  4L63 A;  1GKD A;  1AF0 A;  4JA1 A;  2OZR A;  4PKT A;  3LE9 A;  3O64 A;  3B8Z A;  4FU4 A;  3LJT A;  1UTT A;  1A86 A;  1XUD A;  5I3M A;  3EHX A;  3TT4 A;  1WNI A;  1XUC A;  4A7B A;  2K2G A;  1GKC A;  2X3A A;  3N2V A;  1I76 A;  4GWM A;  1HOV A;  3G5C A;  2W12 A;  4H2E A;  2PJT A;  3WV1 A;  2CLT A;  1C3I A;  2OW9 A;  1QJI A;  1BUV M;  4WF6 A;  2JT5 A;  5BPA A;  1ZTQ A;  4FVL A;  4IN9 A;  4WKE A;  2X3B A;  1AYK A;  2SRT A;  1BKC I;  1Q3A A;  1YQY A;  1KUK A;  4DV8 A;  1CGF A;  3ZUK A;  2L0R A;  3P24 A;  2JIH A;  1RM8 A;  2V4B A;  3O2X A;  1KBC A;  4HMA A;  3AIG A;  1MMP A;  4H82 A;  1MNC A;  3OHL A;  2MZH A;  4XCT A;  2AIG P;  3GBO A;  4R3V A;  1DMT A;  1KUG A;  4L19 A;  1GE5 A;  5D1U A;  1USN A;  2E3X A;  966C A;  2K9C A;  4PKV A;  4PKW A;  1SAT A;  3AYK A;  3K7N A;  1IAD A;  1QIA A;  1OM7 A;  1JAP A;  1SLM A;  3L0V A;  1SRP A;  3F19 A;  4ILW D;  3RTS A;  3DSL A;  2XS3 A;  3WV2 A;  1CQR A;  3LJZ A;  4H30 A;  5CUH A;  1JJ9 A;  5I43 A;  1J7N A;  1BQQ M;  5L7F A;  3ELM A;  2J83 A;  2DW1 A;  1BM6 A;  1R54 A;  3KHI A;  3TS4 A;  2YIG A;  1AKL A;  1G4K A;  5BOT A;  1I1I P;  3OHO A;  3KMC A;  2OY2 A;  2TCL A;  3V96 B;  1ZVX A;  2OW2 A;  2OW1 A;  2D1O A;  1ZS0 A;  2DW0 A;  1UEA A;  3VTG A; 
#chains in the Genus database with same CATH topology
 1BIW A;  1BQO A;  2FV9 A;  3LQB A;  1DTH A;  2OY4 A;  1PWV A;  3I7G A;  1BZS A;  1Y8J A;  4WZV A;  1HTD A;  4GQL A;  5CXA A;  5D1T A;  3LUM A;  1JK3 A;  1H71 P;  2DDY A;  2FV5 A;  3B92 A;  1PWQ A;  1BKC E;  1K7Q A;  4WK7 A;  1CIZ A;  1I73 A;  1XM5 A;  1MMR A;  4FXY P;  2OXW A;  1ROS A;  1O0Q A;  1MMQ A;  1EB6 A;  1PWW A;  2OVX A;  3LJG A;  4GWN A;  2OVZ A;  3LQ0 A;  1HV5 A;  1IAA A;  3VI1 A;  1G9K A;  2I47 A;  2W13 A;  4ON1 A;  2OXU A;  2WOA A;  1OS9 A;  4XM7 A;  1HY7 A;  4PKU A;  2MLR A;  5B5O A;  4G0D A;  1R1H A;  3ZXH A;  3DTI A;  2Z2D A;  3EDI A;  1R1J A;  2O3E A;  4J4M A;  1OS2 A;  1ZP5 A;  1OMJ A;  3EDZ A;  3B2Z A;  1FLS A;  3DTE A;  1HFC A;  1MMB A;  1L6J A;  2D1N A;  3E8R A;  1JAN A;  1R1I A;  3LKA A;  3KEJ A;  5D2B A;  2ERP A;  2A8H A;  2MLS A;  3F18 A;  1G49 A;  2RJQ A;  1CGE A;  2W14 A;  4ZR5 A;  2XS4 A;  3LIR A;  4JP4 A;  3ZVS A;  2YB9 A;  2JSD A;  1QIC A;  1IAB A;  1JIW P;  3HYG A;  4Q1L A;  3TVC A;  2W0D A;  1CAQ A;  4H49 A;  3DTK A;  3HDB A;  1IAG A;  4XBH A;  4AXQ A;  5I0L A;  1ZXC A;  1JH1 A;  1HFS A;  3DNG A;  3HBV P;  2Y6C A;  3F17 A;  2DDF A;  1XAX A;  3LEA A;  5D7W A;  4DF9 A;  1GO8 P;  3Q2G A;  4PKR A;  1BSW A;  3I7I A;  5D3C A;  1CGL A;  1FBL A;  4XM8 A;  1XFW A;  1K7G A;  4DD8 A;  3TSK A;  2KRJ A;  2N8R A;  1IAC A;  3F16 A;  1D8F A;  3KME A;  1S4B P;  5L79 A;  1XFY A;  3DPE A;  1FM1 A;  5D1S A;  4H1Q A;  5BOY A;  3EDG A;  4JQG A;  2X3C A;  1G05 A;  3LGP A;  3F15 A;  2X7M A;  1GO7 P;  4AYK A;  4FXQ A;  1CK7 A;  1YCM A;  5I4O A;  1B8Y A;  1CXV A;  1XFV A;  2WO9 A;  1OM6 A;  2WO8 A;  4I35 A;  3LIL A;  1QIB A;  1KUI A;  1XFU A;  3LK8 A;  3EHY A;  2MZI A;  1ATL A;  1SMP A;  4GR3 A;  4IJO A;  3F1A A;  1RMZ A;  3KWV C;  456C A;  1JIZ A;  830C A;  1D8M A;  1Y0V A;  3HY7 A;  5I2Z A;  2J0T A;  2OW0 A;  2DW2 A;  3AYU A;  3SHI A;  5H8X A;  1JAO A;  1GXD A;  3Q2H A;  5JMY A;  1SLN A;  2OI0 A;  4QKZ A;  3K7L A;  1JAQ A;  5LAB A;  2CKI A;  3RTT A;  3HBU P;  3HY9 A;  3WV3 A;  3G42 A;  4A3W A;  3BA0 A;  4PKS A;  2W15 A;  1OO9 A;  1EAK A;  3HDA P;  4EFS A;  1C8T A;  2MZE A;  3U1R A;  1SU3 A;  1AST A;  1BUD A;  1UMT A;  1QJJ A;  3LMC A;  4HX3 A;  4L6T A;  4PKQ A;  4CTH A;  3CKI A;  1XFZ A;  3KEK A;  2USN A;  1IAE A;  3KRY A;  3DPF A;  1KUH A;  3N2U A;  3P1V A;  1B3D A;  2AYK A;  1O0T A;  1K7I A;  4WKI A;  3DL1 A;  3NX7 A;  2YUF A;  4H3X A;  2E2D A;  1GE7 A;  3HB2 P;  2QPJ A;  1PWU A;  1G12 A;  1KAP P;  3L0T A;  2O36 A;  1KUF A;  1OM8 A;  1ND1 A;  4AIG A;  1YP1 A;  3MA2 A;  4H84 A;  5I12 A;  4GR8 A;  1ZXV A;  3EDH A;  1QUA A;  1XFX A;  2Y6D A;  4AUO A;  4L7A A;  2POJ A;  2ERQ A;  2JNP A;  1YOU A;  1D5J A;  4DPE A;  3UVC A;  4H76 A;  4JIJ A;  2ERO A;  5CZM A;  1BKC A;  4XM6 A;  1UTZ A;  2JT6 A;  3DWB A;  5B5P A;  1C7K A;  1A85 A;  1XUR A;  1UMS A;  4JPA A;  4G9L A;  4GR0 A;  2OXZ A;  3KEC A;  3USN A;  1R55 A;  1PWP A;  1Y93 A;  1EUB A;  1GE6 A;  1Z3J A;  1D7X A;  4GF1 A;  2HU6 A;  3LIK A;  3LUN A;  4I03 A;  1JKY A;  3EWJ A;  2RJP A;  4GUY A;  4IUW A;  4L63 A;  1GKD A;  1AF0 A;  4JA1 A;  2OZR A;  4PKT A;  3LE9 A;  3O64 A;  3B8Z A;  4FU4 A;  3LJT A;  1UTT A;  1A86 A;  1XUD A;  5I3M A;  3EHX A;  3TT4 A;  1WNI A;  1XUC A;  4A7B A;  2K2G A;  1GKC A;  2X3A A;  3N2V A;  1I76 A;  4GWM A;  1HOV A;  3G5C A;  2W12 A;  4H2E A;  2PJT A;  3WV1 A;  2CLT A;  1C3I A;  2OW9 A;  1QJI A;  1BUV M;  4WF6 A;  2JT5 A;  5BPA A;  1ZTQ A;  4FVL A;  4IN9 A;  4WKE A;  2X3B A;  1AYK A;  2SRT A;  1BKC I;  1Q3A A;  1YQY A;  1KUK A;  4DV8 A;  1CGF A;  3ZUK A;  2L0R A;  3P24 A;  2JIH A;  1RM8 A;  2V4B A;  3O2X A;  1KBC A;  4HMA A;  3AIG A;  1MMP A;  4H82 A;  1MNC A;  3OHL A;  1OZ9 A;  2MZH A;  4XCT A;  2AIG P;  3GBO A;  4R3V A;  1DMT A;  1KUG A;  4L19 A;  1GE5 A;  5D1U A;  1USN A;  2E3X A;  966C A;  2K9C A;  4PKV A;  4PKW A;  1SAT A;  3AYK A;  3K7N A;  1IAD A;  1QIA A;  1OM7 A;  1JAP A;  1SLM A;  3L0V A;  1SRP A;  3F19 A;  4ILW D;  3RTS A;  3DSL A;  2XS3 A;  3WV2 A;  1CQR A;  3LJZ A;  4H30 A;  5CUH A;  1JJ9 A;  5I43 A;  1J7N A;  1TVI A;  1BQQ M;  5L7F A;  3ELM A;  2J83 A;  2DW1 A;  1BM6 A;  1R54 A;  3KHI A;  3TS4 A;  2YIG A;  1AKL A;  1G4K A;  5BOT A;  1I1I P;  3OHO A;  3KMC A;  2OY2 A;  2TCL A;  3V96 B;  1ZVX A;  2OW2 A;  2OW1 A;  2D1O A;  1ZS0 A;  2DW0 A;  1UEA A;  3VTG A; 
#chains in the Genus database with same CATH homology
 1BIW A;  1BQO A;  2FV9 A;  3LQB A;  1DTH A;  2OY4 A;  1PWV A;  3I7G A;  1BZS A;  1Y8J A;  4WZV A;  1HTD A;  4GQL A;  5CXA A;  5D1T A;  3LUM A;  1JK3 A;  1H71 P;  2DDY A;  2FV5 A;  3B92 A;  1PWQ A;  1BKC E;  1K7Q A;  4WK7 A;  1CIZ A;  1I73 A;  1MMR A;  4FXY P;  2OXW A;  1ROS A;  1O0Q A;  1MMQ A;  1EB6 A;  1PWW A;  2OVX A;  3LJG A;  4GWN A;  2OVZ A;  3LQ0 A;  1HV5 A;  1IAA A;  3VI1 A;  1G9K A;  2I47 A;  2W13 A;  4ON1 A;  2OXU A;  2WOA A;  1OS9 A;  4XM7 A;  1HY7 A;  4PKU A;  2MLR A;  5B5O A;  4G0D A;  1R1H A;  3ZXH A;  3DTI A;  2Z2D A;  3EDI A;  1R1J A;  2O3E A;  4J4M A;  1OS2 A;  1ZP5 A;  1OMJ A;  3EDZ A;  3B2Z A;  1FLS A;  3DTE A;  1HFC A;  1MMB A;  1L6J A;  2D1N A;  3E8R A;  1JAN A;  1R1I A;  3LKA A;  3KEJ A;  5D2B A;  2ERP A;  2A8H A;  2MLS A;  3F18 A;  1G49 A;  2RJQ A;  1CGE A;  2W14 A;  4ZR5 A;  2XS4 A;  3LIR A;  4JP4 A;  3ZVS A;  2YB9 A;  2JSD A;  1QIC A;  1IAB A;  1JIW P;  3HYG A;  4Q1L A;  3TVC A;  2W0D A;  1CAQ A;  4H49 A;  3DTK A;  3HDB A;  1IAG A;  4XBH A;  4AXQ A;  5I0L A;  1ZXC A;  1JH1 A;  1HFS A;  3DNG A;  3HBV P;  2Y6C A;  3F17 A;  2DDF A;  3LEA A;  5D7W A;  4DF9 A;  1GO8 P;  3Q2G A;  4PKR A;  1BSW A;  3I7I A;  5D3C A;  1CGL A;  1FBL A;  4XM8 A;  1XFW A;  1K7G A;  4DD8 A;  3TSK A;  2KRJ A;  2N8R A;  1IAC A;  3F16 A;  1D8F A;  3KME A;  1S4B P;  5L79 A;  1XFY A;  3DPE A;  1FM1 A;  5D1S A;  4H1Q A;  5BOY A;  3EDG A;  4JQG A;  2X3C A;  1G05 A;  3LGP A;  3F15 A;  2X7M A;  1GO7 P;  4AYK A;  4FXQ A;  1CK7 A;  1YCM A;  5I4O A;  1B8Y A;  1CXV A;  1XFV A;  2WO9 A;  1OM6 A;  2WO8 A;  4I35 A;  3LIL A;  1QIB A;  1KUI A;  1XFU A;  3LK8 A;  3EHY A;  2MZI A;  1ATL A;  1SMP A;  4GR3 A;  4IJO A;  3F1A A;  1RMZ A;  3KWV C;  456C A;  1JIZ A;  830C A;  1D8M A;  1Y0V A;  3HY7 A;  5I2Z A;  2J0T A;  2OW0 A;  2DW2 A;  3AYU A;  3SHI A;  5H8X A;  1JAO A;  1GXD A;  3Q2H A;  5JMY A;  1SLN A;  2OI0 A;  4QKZ A;  3K7L A;  1JAQ A;  5LAB A;  2CKI A;  3RTT A;  3HBU P;  3HY9 A;  3WV3 A;  3G42 A;  4A3W A;  3BA0 A;  4PKS A;  2W15 A;  1OO9 A;  1EAK A;  3HDA P;  4EFS A;  1C8T A;  2MZE A;  3U1R A;  1SU3 A;  1AST A;  1BUD A;  1UMT A;  1QJJ A;  3LMC A;  4HX3 A;  4L6T A;  4PKQ A;  4CTH A;  3CKI A;  1XFZ A;  3KEK A;  2USN A;  1IAE A;  3KRY A;  3DPF A;  1KUH A;  3N2U A;  3P1V A;  1B3D A;  2AYK A;  1O0T A;  1K7I A;  4WKI A;  3DL1 A;  3NX7 A;  2YUF A;  4H3X A;  2E2D A;  1GE7 A;  3HB2 P;  2QPJ A;  1PWU A;  1G12 A;  1KAP P;  3L0T A;  2O36 A;  1KUF A;  1OM8 A;  1ND1 A;  4AIG A;  1YP1 A;  3MA2 A;  4H84 A;  5I12 A;  4GR8 A;  1ZXV A;  3EDH A;  1QUA A;  1XFX A;  2Y6D A;  4AUO A;  4L7A A;  2POJ A;  2ERQ A;  2JNP A;  1YOU A;  1D5J A;  4DPE A;  3UVC A;  4H76 A;  4JIJ A;  2ERO A;  5CZM A;  1BKC A;  4XM6 A;  1UTZ A;  2JT6 A;  3DWB A;  5B5P A;  1C7K A;  1A85 A;  1XUR A;  1UMS A;  4JPA A;  4G9L A;  4GR0 A;  2OXZ A;  3KEC A;  3USN A;  1R55 A;  1PWP A;  1Y93 A;  1EUB A;  1GE6 A;  1Z3J A;  1D7X A;  4GF1 A;  2HU6 A;  3LIK A;  3LUN A;  4I03 A;  1JKY A;  3EWJ A;  2RJP A;  4GUY A;  4IUW A;  4L63 A;  1GKD A;  1AF0 A;  4JA1 A;  2OZR A;  4PKT A;  3LE9 A;  3O64 A;  3B8Z A;  4FU4 A;  3LJT A;  1UTT A;  1A86 A;  1XUD A;  5I3M A;  3EHX A;  3TT4 A;  1WNI A;  1XUC A;  4A7B A;  2K2G A;  1GKC A;  2X3A A;  3N2V A;  1I76 A;  4GWM A;  1HOV A;  3G5C A;  2W12 A;  4H2E A;  2PJT A;  3WV1 A;  2CLT A;  1C3I A;  2OW9 A;  1QJI A;  1BUV M;  4WF6 A;  2JT5 A;  5BPA A;  1ZTQ A;  4FVL A;  4IN9 A;  4WKE A;  2X3B A;  1AYK A;  2SRT A;  1BKC I;  1Q3A A;  1YQY A;  1KUK A;  4DV8 A;  1CGF A;  3ZUK A;  2L0R A;  3P24 A;  2JIH A;  1RM8 A;  2V4B A;  3O2X A;  1KBC A;  4HMA A;  3AIG A;  1MMP A;  4H82 A;  1MNC A;  3OHL A;  2MZH A;  4XCT A;  2AIG P;  3GBO A;  4R3V A;  1DMT A;  1KUG A;  4L19 A;  1GE5 A;  5D1U A;  1USN A;  2E3X A;  966C A;  2K9C A;  4PKV A;  4PKW A;  1SAT A;  3AYK A;  3K7N A;  1IAD A;  1QIA A;  1OM7 A;  1JAP A;  1SLM A;  3L0V A;  1SRP A;  3F19 A;  4ILW D;  3RTS A;  3DSL A;  2XS3 A;  3WV2 A;  1CQR A;  3LJZ A;  4H30 A;  5CUH A;  1JJ9 A;  5I43 A;  1J7N A;  1BQQ M;  5L7F A;  3ELM A;  2J83 A;  2DW1 A;  1BM6 A;  1R54 A;  3KHI A;  3TS4 A;  2YIG A;  1AKL A;  1G4K A;  5BOT A;  1I1I P;  3OHO A;  3KMC A;  2OY2 A;  2TCL A;  3V96 B;  1ZVX A;  2OW2 A;  2OW1 A;  2D1O A;  1ZS0 A;  2DW0 A;  1UEA A;  3VTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...