2Y6DA

The discovery of mmp7 inhibitors exploiting a novel selectivity trigger
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
159
Chain Sequence
GYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYFKLSQDDIKGIQKLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MATRILYSIN
publication title The Discovery of Mmp7 Inhibitors Exploiting a Novel Selectivity Trigger.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 159
sequence length 166
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2y6dA00
4GR0A 4CTHA 1D8FA 4PKTA 4H49A 3G42A 1Y0VA 2JIHA 1ZP5A 1A86A 1PWPA 1C8TA 1I73A 2W15A 4DV8A 5B5PA 1CXVA 2MLRA 2ERPA 1GE6A 1BM6A 2W13A 4HMAA 2OVZA 1OMJA 2D1OA 1PWWA 2WO8A 1G05A 3LUNA 3KWVC 1UTTA 4FXYP 2OY2A 3LK8A 1R54A 4IUWA 4XM7A 3TT4A 4GWMA 1CQRA 1EUBA 3KMCA 1HOVA 1GXDA 3UVCA 1BQQM 5D1SA 5I0LA 2D1NA 4ON1A 5L79A 1Y93A 5D1TA 3B2ZA 3EWJA 1AYKA 3KEJA 1IACA 1CAQA 3AYKA 1SATA 830CA 4R3VA 1RMZA 1XFUA 2OXUA 1XFZA 1BKCI 2SRTA 3EDIA 4PKVA 1G4KA 4PKWA 4FVLA 966CA 3EHXA 3G5CA 1KUGA 1D5JA 4GUYA 3GBOA 3LQBA 4DF9A 1AF0A 3KEKA 3B8ZA 1FM1A 1IADA 1UEAA 3P1VA 3EHYA 2TCLA 4WKIA 1R1JA 1KUFA 1BKCA 3I7GA 3OHLA 4L19A 1R1HA 1PWVA 2W14A 1HTDA 3LJZA 5L7FA 1GO8P 3Q2GA 5D7WA 2JT5A 3WV1A 4AXQA 2Y6CA 1QIBA 1CGFA 2K2GA 1OM6A 1ASTA 1ZVXA 5CXAA 3LEAA 3VI1A 3LJTA 4L63A 2OW2A 1USNA 4I35A 1B3DA 3MA2A 5BOTA 3HY9A 1ZS0A 3AIGA 3DPEA 4GR8A 2OY4A 4GQLA 4AIGA 2FV5A 2OXZA 3LIRA 4FXQA 1G12A 2E3XA 1BUDA 3LKAA 3CKIA 3P24A 5I12A 1FBLA 1QJIA 2OI0A 3LIKA 2OXWA 3B92A 3EDZA 3HB2P 4G0DA 3Q2HA 1XUCA 5D1UA 1QICA 2AIGP 4GR3A 1YP1A 4PKQA 1C3IA 5H8XA 2X3BA 4JPAA 2RJPA 1R55A 2Z2DA 3HBVP 1JH1A 2O3EA 1EB6A 4J4MA 1WNIA 1UTZA 3WV3A 1KUKA 4IN9A 3BA0A 3ELMA 3DPFA 1XFYA 3LJGA 3K7LA 2I47A 2OVXA 4ILWD 3OHOA 1MNCA 1XFWA 2MZHA 5I2ZA 3TVCA 5I4OA 1SLNA 1ZXVA 2OW0A 4XM6A 4DPEA 4AYKA 2JT6A 5B5OA 4JIJA 1YOUA 1IAAA 3F18A 3KHIA 5LABA 2A8HA 4HX3A 3L0TA 1QUAA 2FV9A 1I76A 1BZSA 3ZUKA 4QKZA 1D8MA 1EAKA 1CIZA 1KBCA 3LGPA 4PKSA 3TSKA 2W12A 2CKIA 1CK7A 3LUMA 3NX7A 2HU6A 3I7IA 5CUHA 1HFCA 4L6TA 456CA 5BOYA 4WK7A 1K7GA 1XURA 1H71P 2DDYA 3F19A 1CGEA 1BSWA 3EDGA 4WKEA 2DDFA 2DW0A 2MZEA 3E8RA 1KAPP 4GWNA 1ZXCA 3V96B 1QJJA 2Y6DA 3HY7A 5BPAA 1ND1A 1L6JA 1GKDA 3HDBA 5D2BA 3RTTA 1Z3JA 3HBUP 4H76A 4XBHA 3DWBA 1HV5A 1MMRA 1ATLA 2WO9A 3LMCA 1DTHA 3HYGA 2MZIA 3LE9A 3DNGA 3SHIA 1R1IA 2XS4A 2XS3A 3KRYA 1HY7A 3RTSA 1AKLA 1XUDA 1JAQA 2YB9A 3ZXHA 1MMPA 3F15A 4JA1A 1BUVM 1QIAA 3USNA 1GE7A 1IAGA 1C7KA 1YCMA 1IABA 1GKCA 2RJQA 2EROA 3ZVSA 4A3WA 3HDAP 4Q1LA 3KMEA 4H3XA 1JANA 1MMQA 4DD8A 1O0TA 1HFSA 2USNA 1JKYA 3O64A 1G49A 1OS9A 2POJA 1UMSA 2O36A 5D3CA 2DW2A 1MMBA 4H84A 5I3MA 1YQYA 2J0TA 1GE5A 2V4BA 4EFSA 1I1IP 4IJOA 2X3CA 3LQ0A 2WOAA 1BKCE 3N2VA 4XCTA 2E2DA 4XM8A 1K7QA 3DSLA 1RM8A 3L0VA 3N2UA 3F17A 5I43A 2N8RA 1JJ9A 3TS4A 1OO9A 2PJTA 3K7NA 4A7BA 2X7MA 4ZR5A 1OM7A 4JQGA 1K7IA 1BIWA 2J83A 4PKUA 2W0DA 2CLTA 3KECA 1JAPA 1G9KA 3U1RA 4H30A 2L0RA 2OZRA 4JP4A 1XFVA 1KUIA 1XFXA 4GF1A 1O0QA 3EDHA 1Q3AA 4H1QA 1S4BP 3O2XA 5JMYA 4H2EA 1OS2A 3LILA 1JIZA 1KUHA 5CZMA 2QPJA 1GO7P 3F1AA 4AUOA 4I03A 1SU3A 4H82A 1JAOA 1OM8A 3DL1A 2DW1A 1ZTQA 1ROSA 1J7NA 1D7XA 2AYKA 1SLMA 4PKRA 2K9CA 1FLSA 1JK3A 1IAEA 3F16A 1JIWP 2KRJA 1UMTA 4G9LA 2MLSA 1BQOA 1B8YA 4WF6A 2ERQA 1SRPA 2OW1A 1CGLA 1DMTA 1Y8JA 2JSDA 1SMPA 2JNPA 2OW9A 2YIGA 1PWUA 3WV2A 1A85A 4FU4A 4WZVA 3VTGA 1PWQA 3AYUA 2X3AA
chains in the Genus database with same CATH superfamily
4GR0A 4CTHA 1D8FA 4PKTA 4H49A 3G42A 1Y0VA 2JIHA 1ZP5A 1A86A 1PWPA 1C8TA 1I73A 2W15A 4DV8A 5B5PA 1CXVA 2MLRA 2ERPA 1GE6A 1BM6A 2W13A 4HMAA 2OVZA 1OMJA 1XM5A 2D1OA 1PWWA 2WO8A 1G05A 3LUNA 3KWVC 1UTTA 4FXYP 2OY2A 3LK8A 1R54A 4IUWA 4XM7A 3TT4A 4GWMA 1CQRA 1EUBA 3KMCA 1HOVA 1GXDA 3UVCA 1BQQM 5D1SA 5I0LA 2D1NA 4ON1A 5L79A 1Y93A 5D1TA 3B2ZA 3EWJA 1AYKA 3KEJA 1IACA 4L7AA 1CAQA 3AYKA 1SATA 830CA 4R3VA 1RMZA 1XFUA 2OXUA 1XFZA 1BKCI 2SRTA 3EDIA 4PKVA 1G4KA 4PKWA 4FVLA 966CA 3EHXA 3G5CA 1KUGA 1D5JA 4GUYA 3GBOA 3LQBA 4DF9A 1AF0A 3KEKA 3B8ZA 1FM1A 1IADA 1UEAA 3P1VA 3EHYA 2TCLA 4WKIA 1R1JA 1KUFA 1BKCA 3I7GA 3OHLA 4L19A 1R1HA 1PWVA 2W14A 1HTDA 3LJZA 5L7FA 1GO8P 3Q2GA 5D7WA 2JT5A 3WV1A 4AXQA 2Y6CA 1QIBA 1CGFA 2K2GA 1OM6A 1ASTA 1ZVXA 5CXAA 2YUFA 3LEAA 3VI1A 1OZ9A 3LJTA 4L63A 2OW2A 1USNA 4I35A 1B3DA 3MA2A 5BOTA 3HY9A 1ZS0A 3AIGA 3DPEA 4GR8A 2OY4A 4GQLA 4AIGA 2FV5A 2OXZA 3LIRA 4FXQA 1G12A 2E3XA 1BUDA 3LKAA 3CKIA 3P24A 5I12A 1FBLA 1QJIA 2OI0A 3LIKA 2OXWA 3B92A 3EDZA 3HB2P 4G0DA 3Q2HA 1XUCA 5D1UA 1QICA 2AIGP 4GR3A 1YP1A 4PKQA 1C3IA 5H8XA 2X3BA 4JPAA 2RJPA 1R55A 2Z2DA 3HBVP 1JH1A 2O3EA 1EB6A 4J4MA 1WNIA 1UTZA 3WV3A 1KUKA 4IN9A 3BA0A 3ELMA 3DPFA 1XFYA 3LJGA 3K7LA 2I47A 2OVXA 4ILWD 3OHOA 1MNCA 1XFWA 2MZHA 5I2ZA 3TVCA 5I4OA 1SLNA 1ZXVA 2OW0A 4XM6A 4DPEA 1TVIA 4AYKA 2JT6A 5B5OA 4JIJA 1YOUA 1IAAA 3F18A 3KHIA 5LABA 2A8HA 4HX3A 3L0TA 1QUAA 2FV9A 1I76A 1BZSA 1XAXA 3ZUKA 4QKZA 1D8MA 1EAKA 1CIZA 1KBCA 3LGPA 4PKSA 3TSKA 2W12A 2CKIA 1CK7A 3LUMA 3NX7A 2HU6A 3I7IA 5CUHA 1HFCA 4L6TA 456CA 5BOYA 4WK7A 1K7GA 1XURA 1H71P 2DDYA 3F19A 1CGEA 1BSWA 3EDGA 4WKEA 2DDFA 2DW0A 2MZEA 3E8RA 1KAPP 4GWNA 1ZXCA 3V96B 1QJJA 2Y6DA 3HY7A 5BPAA 1ND1A 1L6JA 1GKDA 3HDBA 5D2BA 3RTTA 1Z3JA 3HBUP 4H76A 4XBHA 3DWBA 1HV5A 1MMRA 1ATLA 2WO9A 3LMCA 1DTHA 3HYGA 2MZIA 3LE9A 3DNGA 3SHIA 1R1IA 2XS4A 2XS3A 3KRYA 1HY7A 3RTSA 1AKLA 1XUDA 1JAQA 2YB9A 3ZXHA 1MMPA 3F15A 4JA1A 1BUVM 1QIAA 3USNA 1GE7A 1IAGA 1C7KA 1YCMA 1IABA 1GKCA 2RJQA 2EROA 3ZVSA 4A3WA 3HDAP 4Q1LA 3KMEA 4H3XA 1JANA 1MMQA 4DD8A 1O0TA 1HFSA 2USNA 1JKYA 3O64A 1G49A 1OS9A 2POJA 1UMSA 2O36A 5D3CA 2DW2A 1MMBA 4H84A 5I3MA 1YQYA 2J0TA 1GE5A 2V4BA 4EFSA 1I1IP 4IJOA 2X3CA 3LQ0A 2WOAA 1BKCE 3N2VA 4XCTA 2E2DA 4XM8A 1K7QA 3DSLA 1RM8A 3L0VA 3N2UA 3F17A 5I43A 2N8RA 3DTIA 1JJ9A 3TS4A 1OO9A 2PJTA 3K7NA 4A7BA 2X7MA 4ZR5A 1OM7A 4JQGA 1K7IA 1BIWA 2J83A 4PKUA 2W0DA 2CLTA 3KECA 1JAPA 1G9KA 3U1RA 4H30A 2L0RA 3DTEA 2OZRA 4JP4A 1XFVA 1KUIA 1XFXA 4GF1A 1O0QA 3EDHA 1Q3AA 4H1QA 1S4BP 3O2XA 5JMYA 4H2EA 1OS2A 3LILA 1JIZA 1KUHA 5CZMA 2QPJA 1GO7P 3F1AA 4AUOA 4I03A 1SU3A 4H82A 1JAOA 1OM8A 3DL1A 2DW1A 1ZTQA 1ROSA 1J7NA 1D7XA 2AYKA 1SLMA 4PKRA 2K9CA 1FLSA 1JK3A 1IAEA 3DTKA 3F16A 1JIWP 2KRJA 1UMTA 4G9LA 2MLSA 1BQOA 1B8YA 4WF6A 2ERQA 1SRPA 2OW1A 1CGLA 1DMTA 1Y8JA 2JSDA 1SMPA 2JNPA 2OW9A 2YIGA 1PWUA 3WV2A 1A85A 4FU4A 4WZVA 3VTGA 1PWQA 3AYUA 2X3AA
chains in the Genus database with same CATH topology
4GR0A 4CTHA 1D8FA 4PKTA 4H49A 3G42A 1Y0VA 2JIHA 1ZP5A 1A86A 1PWPA 1C8TA 1I73A 2W15A 4DV8A 5B5PA 1CXVA 2MLRA 2ERPA 1GE6A 1BM6A 2W13A 4HMAA 2OVZA 1OMJA 2D1OA 1PWWA 2WO8A 1G05A 3LUNA 3KWVC 1UTTA 4FXYP 2OY2A 3LK8A 1R54A 4IUWA 4XM7A 3TT4A 4GWMA 1CQRA 1EUBA 3KMCA 1HOVA 1GXDA 3UVCA 1BQQM 5D1SA 5I0LA 2D1NA 4ON1A 5L79A 1Y93A 5D1TA 3B2ZA 3EWJA 1AYKA 3KEJA 1IACA 4L7AA 1CAQA 3AYKA 1SATA 830CA 4R3VA 1RMZA 1XFUA 2OXUA 1XFZA 1BKCI 2SRTA 3EDIA 4PKVA 1G4KA 4PKWA 4FVLA 966CA 3EHXA 3G5CA 1KUGA 1D5JA 4GUYA 3GBOA 3LQBA 4DF9A 1AF0A 3KEKA 3B8ZA 1FM1A 1IADA 1UEAA 3P1VA 3EHYA 2TCLA 4WKIA 1R1JA 1KUFA 1BKCA 3I7GA 3OHLA 4L19A 1R1HA 1PWVA 2W14A 1HTDA 3LJZA 5L7FA 1GO8P 3Q2GA 5D7WA 2JT5A 3WV1A 4AXQA 2Y6CA 1QIBA 1CGFA 2K2GA 1OM6A 1ASTA 1ZVXA 5CXAA 2YUFA 3LEAA 3VI1A 3LJTA 4L63A 2OW2A 1USNA 4I35A 1B3DA 3MA2A 5BOTA 3HY9A 1ZS0A 3AIGA 3DPEA 4GR8A 2OY4A 4GQLA 4AIGA 2FV5A 2OXZA 3LIRA 4FXQA 1G12A 2E3XA 1BUDA 3LKAA 3CKIA 3P24A 5I12A 1FBLA 1QJIA 2OI0A 3LIKA 2OXWA 3B92A 3EDZA 3HB2P 4G0DA 3Q2HA 1XUCA 5D1UA 1QICA 2AIGP 4GR3A 1YP1A 4PKQA 1C3IA 5H8XA 2X3BA 4JPAA 2RJPA 1R55A 2Z2DA 3HBVP 1JH1A 2O3EA 1EB6A 4J4MA 1WNIA 1UTZA 3WV3A 1KUKA 4IN9A 3BA0A 3ELMA 3DPFA 1XFYA 3LJGA 3K7LA 2I47A 2OVXA 4ILWD 3OHOA 1MNCA 1XFWA 2MZHA 5I2ZA 3TVCA 5I4OA 1SLNA 1ZXVA 2OW0A 4XM6A 4DPEA 4AYKA 2JT6A 5B5OA 4JIJA 1YOUA 1IAAA 3F18A 3KHIA 5LABA 2A8HA 4HX3A 3L0TA 1QUAA 2FV9A 1I76A 1BZSA 3ZUKA 4QKZA 1D8MA 1EAKA 1CIZA 1KBCA 3LGPA 4PKSA 3TSKA 2W12A 2CKIA 1CK7A 3LUMA 3NX7A 2HU6A 3I7IA 5CUHA 1HFCA 4L6TA 456CA 5BOYA 4WK7A 1K7GA 1XURA 1H71P 2DDYA 3F19A 1CGEA 1BSWA 3EDGA 4WKEA 2DDFA 2DW0A 2MZEA 3E8RA 1KAPP 4GWNA 1ZXCA 3V96B 1QJJA 2Y6DA 3HY7A 5BPAA 1ND1A 1L6JA 1GKDA 3HDBA 5D2BA 3RTTA 1Z3JA 3HBUP 4H76A 4XBHA 3DWBA 1HV5A 1MMRA 1ATLA 2WO9A 3LMCA 1DTHA 3HYGA 2MZIA 3LE9A 3DNGA 3SHIA 1R1IA 2XS4A 2XS3A 3KRYA 1HY7A 3RTSA 1AKLA 1XUDA 1JAQA 2YB9A 3ZXHA 1MMPA 3F15A 4JA1A 1BUVM 1QIAA 3USNA 1GE7A 1IAGA 1C7KA 1YCMA 1IABA 1GKCA 2RJQA 2EROA 3ZVSA 4A3WA 3HDAP 4Q1LA 3KMEA 4H3XA 1JANA 1MMQA 4DD8A 1O0TA 1HFSA 2USNA 1JKYA 3O64A 1G49A 1OS9A 2POJA 1UMSA 2O36A 5D3CA 2DW2A 1MMBA 4H84A 5I3MA 1YQYA 2J0TA 1GE5A 2V4BA 4EFSA 1I1IP 4IJOA 2X3CA 3LQ0A 2WOAA 1BKCE 3N2VA 4XCTA 2E2DA 4XM8A 1K7QA 3DSLA 1RM8A 3L0VA 3N2UA 3F17A 5I43A 2N8RA 3DTIA 1JJ9A 3TS4A 1OO9A 2PJTA 3K7NA 4A7BA 2X7MA 4ZR5A 1OM7A 4JQGA 1K7IA 1BIWA 2J83A 4PKUA 2W0DA 2CLTA 3KECA 1JAPA 1G9KA 3U1RA 4H30A 2L0RA 3DTEA 2OZRA 4JP4A 1XFVA 1KUIA 1XFXA 4GF1A 1O0QA 3EDHA 1Q3AA 4H1QA 1S4BP 3O2XA 5JMYA 4H2EA 1OS2A 3LILA 1JIZA 1KUHA 5CZMA 2QPJA 1GO7P 3F1AA 4AUOA 4I03A 1SU3A 4H82A 1JAOA 1OM8A 3DL1A 2DW1A 1ZTQA 1ROSA 1J7NA 1D7XA 2AYKA 1SLMA 4PKRA 2K9CA 1FLSA 1JK3A 1IAEA 3DTKA 3F16A 1JIWP 2KRJA 1UMTA 4G9LA 2MLSA 1BQOA 1B8YA 4WF6A 2ERQA 1SRPA 2OW1A 1CGLA 1DMTA 1Y8JA 2JSDA 1SMPA 2JNPA 2OW9A 2YIGA 1PWUA 3WV2A 1A85A 4FU4A 4WZVA 3VTGA 1PWQA 3AYUA 2X3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR0 A;  4CTH A;  1D8F A;  4PKT A;  4H49 A;  3G42 A;  1Y0V A;  2JIH A;  1ZP5 A;  1A86 A;  1PWP A;  1C8T A;  1I73 A;  2W15 A;  4DV8 A;  5B5P A;  1CXV A;  2MLR A;  2ERP A;  1GE6 A;  1BM6 A;  2W13 A;  4HMA A;  2OVZ A;  1OMJ A;  2D1O A;  1PWW A;  2WO8 A;  1G05 A;  3LUN A;  3KWV C;  1UTT A;  4FXY P;  2OY2 A;  3LK8 A;  1R54 A;  4IUW A;  4XM7 A;  3TT4 A;  4GWM A;  1CQR A;  1EUB A;  3KMC A;  1HOV A;  1GXD A;  3UVC A;  1BQQ M;  5D1S A;  5I0L A;  2D1N A;  4ON1 A;  5L79 A;  1Y93 A;  5D1T A;  3B2Z A;  3EWJ A;  1AYK A;  3KEJ A;  1IAC A;  1CAQ A;  3AYK A;  1SAT A;  830C A;  4R3V A;  1RMZ A;  1XFU A;  2OXU A;  1XFZ A;  1BKC I;  2SRT A;  3EDI A;  4PKV A;  1G4K A;  4PKW A;  4FVL A;  966C A;  3EHX A;  3G5C A;  1KUG A;  1D5J A;  4GUY A;  3GBO A;  3LQB A;  4DF9 A;  1AF0 A;  3KEK A;  3B8Z A;  1FM1 A;  1IAD A;  1UEA A;  3P1V A;  3EHY A;  2TCL A;  4WKI A;  1R1J A;  1KUF A;  1BKC A;  3I7G A;  3OHL A;  4L19 A;  1R1H A;  1PWV A;  2W14 A;  1HTD A;  3LJZ A;  5L7F A;  1GO8 P;  3Q2G A;  5D7W A;  2JT5 A;  3WV1 A;  4AXQ A;  2Y6C A;  1QIB A;  1CGF A;  2K2G A;  1OM6 A;  1AST A;  1ZVX A;  5CXA A;  3LEA A;  3VI1 A;  3LJT A;  4L63 A;  2OW2 A;  1USN A;  4I35 A;  1B3D A;  3MA2 A;  5BOT A;  3HY9 A;  1ZS0 A;  3AIG A;  3DPE A;  4GR8 A;  2OY4 A;  4GQL A;  4AIG A;  2FV5 A;  2OXZ A;  3LIR A;  4FXQ A;  1G12 A;  2E3X A;  1BUD A;  3LKA A;  3CKI A;  3P24 A;  5I12 A;  1FBL A;  1QJI A;  2OI0 A;  3LIK A;  2OXW A;  3B92 A;  3EDZ A;  3HB2 P;  4G0D A;  3Q2H A;  1XUC A;  5D1U A;  1QIC A;  2AIG P;  4GR3 A;  1YP1 A;  4PKQ A;  1C3I A;  5H8X A;  2X3B A;  4JPA A;  2RJP A;  1R55 A;  2Z2D A;  3HBV P;  1JH1 A;  2O3E A;  1EB6 A;  4J4M A;  1WNI A;  1UTZ A;  3WV3 A;  1KUK A;  4IN9 A;  3BA0 A;  3ELM A;  3DPF A;  1XFY A;  3LJG A;  3K7L A;  2I47 A;  2OVX A;  4ILW D;  3OHO A;  1MNC A;  1XFW A;  2MZH A;  5I2Z A;  3TVC A;  5I4O A;  1SLN A;  1ZXV A;  2OW0 A;  4XM6 A;  4DPE A;  4AYK A;  2JT6 A;  5B5O A;  4JIJ A;  1YOU A;  1IAA A;  3F18 A;  3KHI A;  5LAB A;  2A8H A;  4HX3 A;  3L0T A;  1QUA A;  2FV9 A;  1I76 A;  1BZS A;  3ZUK A;  4QKZ A;  1D8M A;  1EAK A;  1CIZ A;  1KBC A;  3LGP A;  4PKS A;  3TSK A;  2W12 A;  2CKI A;  1CK7 A;  3LUM A;  3NX7 A;  2HU6 A;  3I7I A;  5CUH A;  1HFC A;  4L6T A;  456C A;  5BOY A;  4WK7 A;  1K7G A;  1XUR A;  1H71 P;  2DDY A;  3F19 A;  1CGE A;  1BSW A;  3EDG A;  4WKE A;  2DDF A;  2DW0 A;  2MZE A;  3E8R A;  1KAP P;  4GWN A;  1ZXC A;  3V96 B;  1QJJ A;  2Y6D A;  3HY7 A;  5BPA A;  1ND1 A;  1L6J A;  1GKD A;  3HDB A;  5D2B A;  3RTT A;  1Z3J A;  3HBU P;  4H76 A;  4XBH A;  3DWB A;  1HV5 A;  1MMR A;  1ATL A;  2WO9 A;  3LMC A;  1DTH A;  3HYG A;  2MZI A;  3LE9 A;  3DNG A;  3SHI A;  1R1I A;  2XS4 A;  2XS3 A;  3KRY A;  1HY7 A;  3RTS A;  1AKL A;  1XUD A;  1JAQ A;  2YB9 A;  3ZXH A;  1MMP A;  3F15 A;  4JA1 A;  1BUV M;  1QIA A;  3USN A;  1GE7 A;  1IAG A;  1C7K A;  1YCM A;  1IAB A;  1GKC A;  2RJQ A;  2ERO A;  3ZVS A;  4A3W A;  3HDA P;  4Q1L A;  3KME A;  4H3X A;  1JAN A;  1MMQ A;  4DD8 A;  1O0T A;  1HFS A;  2USN A;  1JKY A;  3O64 A;  1G49 A;  1OS9 A;  2POJ A;  1UMS A;  2O36 A;  5D3C A;  2DW2 A;  1MMB A;  4H84 A;  5I3M A;  1YQY A;  2J0T A;  1GE5 A;  2V4B A;  4EFS A;  1I1I P;  4IJO A;  2X3C A;  3LQ0 A;  2WOA A;  1BKC E;  3N2V A;  4XCT A;  2E2D A;  4XM8 A;  1K7Q A;  3DSL A;  1RM8 A;  3L0V A;  3N2U A;  3F17 A;  5I43 A;  2N8R A;  1JJ9 A;  3TS4 A;  1OO9 A;  2PJT A;  3K7N A;  4A7B A;  2X7M A;  4ZR5 A;  1OM7 A;  4JQG A;  1K7I A;  1BIW A;  2J83 A;  4PKU A;  2W0D A;  2CLT A;  3KEC A;  1JAP A;  1G9K A;  3U1R A;  4H30 A;  2L0R A;  2OZR A;  4JP4 A;  1XFV A;  1KUI A;  1XFX A;  4GF1 A;  1O0Q A;  3EDH A;  1Q3A A;  4H1Q A;  1S4B P;  3O2X A;  5JMY A;  4H2E A;  1OS2 A;  3LIL A;  1JIZ A;  1KUH A;  5CZM A;  2QPJ A;  1GO7 P;  3F1A A;  4AUO A;  4I03 A;  1SU3 A;  4H82 A;  1JAO A;  1OM8 A;  3DL1 A;  2DW1 A;  1ZTQ A;  1ROS A;  1J7N A;  1D7X A;  2AYK A;  1SLM A;  4PKR A;  2K9C A;  1FLS A;  1JK3 A;  1IAE A;  3F16 A;  1JIW P;  2KRJ A;  1UMT A;  4G9L A;  2MLS A;  1BQO A;  1B8Y A;  4WF6 A;  2ERQ A;  1SRP A;  2OW1 A;  1CGL A;  1DMT A;  1Y8J A;  2JSD A;  1SMP A;  2JNP A;  2OW9 A;  2YIG A;  1PWU A;  3WV2 A;  1A85 A;  4FU4 A;  4WZV A;  3VTG A;  1PWQ A;  3AYU A;  2X3A A; 
#chains in the Genus database with same CATH topology
 4GR0 A;  4CTH A;  1D8F A;  4PKT A;  4H49 A;  3G42 A;  1Y0V A;  2JIH A;  1ZP5 A;  1A86 A;  1PWP A;  1C8T A;  1I73 A;  2W15 A;  4DV8 A;  5B5P A;  1CXV A;  2MLR A;  2ERP A;  1GE6 A;  1BM6 A;  2W13 A;  4HMA A;  2OVZ A;  1OMJ A;  1XM5 A;  2D1O A;  1PWW A;  2WO8 A;  1G05 A;  3LUN A;  3KWV C;  1UTT A;  4FXY P;  2OY2 A;  3LK8 A;  1R54 A;  4IUW A;  4XM7 A;  3TT4 A;  4GWM A;  1CQR A;  1EUB A;  3KMC A;  1HOV A;  1GXD A;  3UVC A;  1BQQ M;  5D1S A;  5I0L A;  2D1N A;  4ON1 A;  5L79 A;  1Y93 A;  5D1T A;  3B2Z A;  3EWJ A;  1AYK A;  3KEJ A;  1IAC A;  4L7A A;  1CAQ A;  3AYK A;  1SAT A;  830C A;  4R3V A;  1RMZ A;  1XFU A;  2OXU A;  1XFZ A;  1BKC I;  2SRT A;  3EDI A;  4PKV A;  1G4K A;  4PKW A;  4FVL A;  966C A;  3EHX A;  3G5C A;  1KUG A;  1D5J A;  4GUY A;  3GBO A;  3LQB A;  4DF9 A;  1AF0 A;  3KEK A;  3B8Z A;  1FM1 A;  1IAD A;  1UEA A;  3P1V A;  3EHY A;  2TCL A;  4WKI A;  1R1J A;  1KUF A;  1BKC A;  3I7G A;  3OHL A;  4L19 A;  1R1H A;  1PWV A;  2W14 A;  1HTD A;  3LJZ A;  5L7F A;  1GO8 P;  3Q2G A;  5D7W A;  2JT5 A;  3WV1 A;  4AXQ A;  2Y6C A;  1QIB A;  1CGF A;  2K2G A;  1OM6 A;  1AST A;  1ZVX A;  5CXA A;  2YUF A;  3LEA A;  3VI1 A;  1OZ9 A;  3LJT A;  4L63 A;  2OW2 A;  1USN A;  4I35 A;  1B3D A;  3MA2 A;  5BOT A;  3HY9 A;  1ZS0 A;  3AIG A;  3DPE A;  4GR8 A;  2OY4 A;  4GQL A;  4AIG A;  2FV5 A;  2OXZ A;  3LIR A;  4FXQ A;  1G12 A;  2E3X A;  1BUD A;  3LKA A;  3CKI A;  3P24 A;  5I12 A;  1FBL A;  1QJI A;  2OI0 A;  3LIK A;  2OXW A;  3B92 A;  3EDZ A;  3HB2 P;  4G0D A;  3Q2H A;  1XUC A;  5D1U A;  1QIC A;  2AIG P;  4GR3 A;  1YP1 A;  4PKQ A;  1C3I A;  5H8X A;  2X3B A;  4JPA A;  2RJP A;  1R55 A;  2Z2D A;  3HBV P;  1JH1 A;  2O3E A;  1EB6 A;  4J4M A;  1WNI A;  1UTZ A;  3WV3 A;  1KUK A;  4IN9 A;  3BA0 A;  3ELM A;  3DPF A;  1XFY A;  3LJG A;  3K7L A;  2I47 A;  2OVX A;  4ILW D;  3OHO A;  1MNC A;  1XFW A;  2MZH A;  5I2Z A;  3TVC A;  5I4O A;  1SLN A;  1ZXV A;  2OW0 A;  4XM6 A;  4DPE A;  1TVI A;  4AYK A;  2JT6 A;  5B5O A;  4JIJ A;  1YOU A;  1IAA A;  3F18 A;  3KHI A;  5LAB A;  2A8H A;  4HX3 A;  3L0T A;  1QUA A;  2FV9 A;  1I76 A;  1BZS A;  1XAX A;  3ZUK A;  4QKZ A;  1D8M A;  1EAK A;  1CIZ A;  1KBC A;  3LGP A;  4PKS A;  3TSK A;  2W12 A;  2CKI A;  1CK7 A;  3LUM A;  3NX7 A;  2HU6 A;  3I7I A;  5CUH A;  1HFC A;  4L6T A;  456C A;  5BOY A;  4WK7 A;  1K7G A;  1XUR A;  1H71 P;  2DDY A;  3F19 A;  1CGE A;  1BSW A;  3EDG A;  4WKE A;  2DDF A;  2DW0 A;  2MZE A;  3E8R A;  1KAP P;  4GWN A;  1ZXC A;  3V96 B;  1QJJ A;  2Y6D A;  3HY7 A;  5BPA A;  1ND1 A;  1L6J A;  1GKD A;  3HDB A;  5D2B A;  3RTT A;  1Z3J A;  3HBU P;  4H76 A;  4XBH A;  3DWB A;  1HV5 A;  1MMR A;  1ATL A;  2WO9 A;  3LMC A;  1DTH A;  3HYG A;  2MZI A;  3LE9 A;  3DNG A;  3SHI A;  1R1I A;  2XS4 A;  2XS3 A;  3KRY A;  1HY7 A;  3RTS A;  1AKL A;  1XUD A;  1JAQ A;  2YB9 A;  3ZXH A;  1MMP A;  3F15 A;  4JA1 A;  1BUV M;  1QIA A;  3USN A;  1GE7 A;  1IAG A;  1C7K A;  1YCM A;  1IAB A;  1GKC A;  2RJQ A;  2ERO A;  3ZVS A;  4A3W A;  3HDA P;  4Q1L A;  3KME A;  4H3X A;  1JAN A;  1MMQ A;  4DD8 A;  1O0T A;  1HFS A;  2USN A;  1JKY A;  3O64 A;  1G49 A;  1OS9 A;  2POJ A;  1UMS A;  2O36 A;  5D3C A;  2DW2 A;  1MMB A;  4H84 A;  5I3M A;  1YQY A;  2J0T A;  1GE5 A;  2V4B A;  4EFS A;  1I1I P;  4IJO A;  2X3C A;  3LQ0 A;  2WOA A;  1BKC E;  3N2V A;  4XCT A;  2E2D A;  4XM8 A;  1K7Q A;  3DSL A;  1RM8 A;  3L0V A;  3N2U A;  3F17 A;  5I43 A;  2N8R A;  3DTI A;  1JJ9 A;  3TS4 A;  1OO9 A;  2PJT A;  3K7N A;  4A7B A;  2X7M A;  4ZR5 A;  1OM7 A;  4JQG A;  1K7I A;  1BIW A;  2J83 A;  4PKU A;  2W0D A;  2CLT A;  3KEC A;  1JAP A;  1G9K A;  3U1R A;  4H30 A;  2L0R A;  3DTE A;  2OZR A;  4JP4 A;  1XFV A;  1KUI A;  1XFX A;  4GF1 A;  1O0Q A;  3EDH A;  1Q3A A;  4H1Q A;  1S4B P;  3O2X A;  5JMY A;  4H2E A;  1OS2 A;  3LIL A;  1JIZ A;  1KUH A;  5CZM A;  2QPJ A;  1GO7 P;  3F1A A;  4AUO A;  4I03 A;  1SU3 A;  4H82 A;  1JAO A;  1OM8 A;  3DL1 A;  2DW1 A;  1ZTQ A;  1ROS A;  1J7N A;  1D7X A;  2AYK A;  1SLM A;  4PKR A;  2K9C A;  1FLS A;  1JK3 A;  1IAE A;  3DTK A;  3F16 A;  1JIW P;  2KRJ A;  1UMT A;  4G9L A;  2MLS A;  1BQO A;  1B8Y A;  4WF6 A;  2ERQ A;  1SRP A;  2OW1 A;  1CGL A;  1DMT A;  1Y8J A;  2JSD A;  1SMP A;  2JNP A;  2OW9 A;  2YIG A;  1PWU A;  3WV2 A;  1A85 A;  4FU4 A;  4WZV A;  3VTG A;  1PWQ A;  3AYU A;  2X3A A; 
#chains in the Genus database with same CATH homology
 4GR0 A;  4CTH A;  1D8F A;  4PKT A;  4H49 A;  3G42 A;  1Y0V A;  2JIH A;  1ZP5 A;  1A86 A;  1PWP A;  1C8T A;  1I73 A;  2W15 A;  4DV8 A;  5B5P A;  1CXV A;  2MLR A;  2ERP A;  1GE6 A;  1BM6 A;  2W13 A;  4HMA A;  2OVZ A;  1OMJ A;  2D1O A;  1PWW A;  2WO8 A;  1G05 A;  3LUN A;  3KWV C;  1UTT A;  4FXY P;  2OY2 A;  3LK8 A;  1R54 A;  4IUW A;  4XM7 A;  3TT4 A;  4GWM A;  1CQR A;  1EUB A;  3KMC A;  1HOV A;  1GXD A;  3UVC A;  1BQQ M;  5D1S A;  5I0L A;  2D1N A;  4ON1 A;  5L79 A;  1Y93 A;  5D1T A;  3B2Z A;  3EWJ A;  1AYK A;  3KEJ A;  1IAC A;  4L7A A;  1CAQ A;  3AYK A;  1SAT A;  830C A;  4R3V A;  1RMZ A;  1XFU A;  2OXU A;  1XFZ A;  1BKC I;  2SRT A;  3EDI A;  4PKV A;  1G4K A;  4PKW A;  4FVL A;  966C A;  3EHX A;  3G5C A;  1KUG A;  1D5J A;  4GUY A;  3GBO A;  3LQB A;  4DF9 A;  1AF0 A;  3KEK A;  3B8Z A;  1FM1 A;  1IAD A;  1UEA A;  3P1V A;  3EHY A;  2TCL A;  4WKI A;  1R1J A;  1KUF A;  1BKC A;  3I7G A;  3OHL A;  4L19 A;  1R1H A;  1PWV A;  2W14 A;  1HTD A;  3LJZ A;  5L7F A;  1GO8 P;  3Q2G A;  5D7W A;  2JT5 A;  3WV1 A;  4AXQ A;  2Y6C A;  1QIB A;  1CGF A;  2K2G A;  1OM6 A;  1AST A;  1ZVX A;  5CXA A;  2YUF A;  3LEA A;  3VI1 A;  3LJT A;  4L63 A;  2OW2 A;  1USN A;  4I35 A;  1B3D A;  3MA2 A;  5BOT A;  3HY9 A;  1ZS0 A;  3AIG A;  3DPE A;  4GR8 A;  2OY4 A;  4GQL A;  4AIG A;  2FV5 A;  2OXZ A;  3LIR A;  4FXQ A;  1G12 A;  2E3X A;  1BUD A;  3LKA A;  3CKI A;  3P24 A;  5I12 A;  1FBL A;  1QJI A;  2OI0 A;  3LIK A;  2OXW A;  3B92 A;  3EDZ A;  3HB2 P;  4G0D A;  3Q2H A;  1XUC A;  5D1U A;  1QIC A;  2AIG P;  4GR3 A;  1YP1 A;  4PKQ A;  1C3I A;  5H8X A;  2X3B A;  4JPA A;  2RJP A;  1R55 A;  2Z2D A;  3HBV P;  1JH1 A;  2O3E A;  1EB6 A;  4J4M A;  1WNI A;  1UTZ A;  3WV3 A;  1KUK A;  4IN9 A;  3BA0 A;  3ELM A;  3DPF A;  1XFY A;  3LJG A;  3K7L A;  2I47 A;  2OVX A;  4ILW D;  3OHO A;  1MNC A;  1XFW A;  2MZH A;  5I2Z A;  3TVC A;  5I4O A;  1SLN A;  1ZXV A;  2OW0 A;  4XM6 A;  4DPE A;  4AYK A;  2JT6 A;  5B5O A;  4JIJ A;  1YOU A;  1IAA A;  3F18 A;  3KHI A;  5LAB A;  2A8H A;  4HX3 A;  3L0T A;  1QUA A;  2FV9 A;  1I76 A;  1BZS A;  3ZUK A;  4QKZ A;  1D8M A;  1EAK A;  1CIZ A;  1KBC A;  3LGP A;  4PKS A;  3TSK A;  2W12 A;  2CKI A;  1CK7 A;  3LUM A;  3NX7 A;  2HU6 A;  3I7I A;  5CUH A;  1HFC A;  4L6T A;  456C A;  5BOY A;  4WK7 A;  1K7G A;  1XUR A;  1H71 P;  2DDY A;  3F19 A;  1CGE A;  1BSW A;  3EDG A;  4WKE A;  2DDF A;  2DW0 A;  2MZE A;  3E8R A;  1KAP P;  4GWN A;  1ZXC A;  3V96 B;  1QJJ A;  2Y6D A;  3HY7 A;  5BPA A;  1ND1 A;  1L6J A;  1GKD A;  3HDB A;  5D2B A;  3RTT A;  1Z3J A;  3HBU P;  4H76 A;  4XBH A;  3DWB A;  1HV5 A;  1MMR A;  1ATL A;  2WO9 A;  3LMC A;  1DTH A;  3HYG A;  2MZI A;  3LE9 A;  3DNG A;  3SHI A;  1R1I A;  2XS4 A;  2XS3 A;  3KRY A;  1HY7 A;  3RTS A;  1AKL A;  1XUD A;  1JAQ A;  2YB9 A;  3ZXH A;  1MMP A;  3F15 A;  4JA1 A;  1BUV M;  1QIA A;  3USN A;  1GE7 A;  1IAG A;  1C7K A;  1YCM A;  1IAB A;  1GKC A;  2RJQ A;  2ERO A;  3ZVS A;  4A3W A;  3HDA P;  4Q1L A;  3KME A;  4H3X A;  1JAN A;  1MMQ A;  4DD8 A;  1O0T A;  1HFS A;  2USN A;  1JKY A;  3O64 A;  1G49 A;  1OS9 A;  2POJ A;  1UMS A;  2O36 A;  5D3C A;  2DW2 A;  1MMB A;  4H84 A;  5I3M A;  1YQY A;  2J0T A;  1GE5 A;  2V4B A;  4EFS A;  1I1I P;  4IJO A;  2X3C A;  3LQ0 A;  2WOA A;  1BKC E;  3N2V A;  4XCT A;  2E2D A;  4XM8 A;  1K7Q A;  3DSL A;  1RM8 A;  3L0V A;  3N2U A;  3F17 A;  5I43 A;  2N8R A;  3DTI A;  1JJ9 A;  3TS4 A;  1OO9 A;  2PJT A;  3K7N A;  4A7B A;  2X7M A;  4ZR5 A;  1OM7 A;  4JQG A;  1K7I A;  1BIW A;  2J83 A;  4PKU A;  2W0D A;  2CLT A;  3KEC A;  1JAP A;  1G9K A;  3U1R A;  4H30 A;  2L0R A;  3DTE A;  2OZR A;  4JP4 A;  1XFV A;  1KUI A;  1XFX A;  4GF1 A;  1O0Q A;  3EDH A;  1Q3A A;  4H1Q A;  1S4B P;  3O2X A;  5JMY A;  4H2E A;  1OS2 A;  3LIL A;  1JIZ A;  1KUH A;  5CZM A;  2QPJ A;  1GO7 P;  3F1A A;  4AUO A;  4I03 A;  1SU3 A;  4H82 A;  1JAO A;  1OM8 A;  3DL1 A;  2DW1 A;  1ZTQ A;  1ROS A;  1J7N A;  1D7X A;  2AYK A;  1SLM A;  4PKR A;  2K9C A;  1FLS A;  1JK3 A;  1IAE A;  3DTK A;  3F16 A;  1JIW P;  2KRJ A;  1UMT A;  4G9L A;  2MLS A;  1BQO A;  1B8Y A;  4WF6 A;  2ERQ A;  1SRP A;  2OW1 A;  1CGL A;  1DMT A;  1Y8J A;  2JSD A;  1SMP A;  2JNP A;  2OW9 A;  2YIG A;  1PWU A;  3WV2 A;  1A85 A;  4FU4 A;  4WZV A;  3VTG A;  1PWQ A;  3AYU A;  2X3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...