4H76A

Crystal structure of the catalytic domain of human mmp12 in complex with a broad spectrum hydroxamate inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Macrophage metalloelastase
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h76A00
1KBCA 3P1VA 1D8FA 3E8RA 3HDAP 3LJGA 3LEAA 1ASTA 1JKYA 3EDIA 4JA1A 3HYGA 1G49A 1HTDA 4PKVA 3AYUA 3ZXHA 2EROA 2WO8A 4XM8A 1H71P 2KRJA 1JJ9A 2FV5A 4IJOA 4ZR5A 1G9KA 1EAKA 1CIZA 2X3CA 456CA 1R1IA 3WV3A 4FU4A 5B5PA 1XFYA 4ON1A 5I2ZA 1C8TA 2W13A 2JT6A 1BM6A 3F15A 1XURA 3F16A 1R1HA 3TVCA 4XM6A 5I4OA 1ZXCA 4GWNA 2Y6CA 1QIAA 3L0TA 3KEKA 2D1OA 5I3MA 1Q3AA 3ZVSA 2J0TA 3EDZA 4XM7A 2TCLA 3DPFA 1ATLA 1GO8P 4H84A 2JIHA 3LMCA 1CQRA 4DF9A 4XBHA 1KUKA 5CZMA 1CGLA 1FLSA 3LE9A 1MMBA 2ERQA 5L79A 4H2EA 2DW2A 1MNCA 3F18A 1SRPA 4R3VA 4ILWD 1IACA 1HV5A 3I7GA 2OXZA 4JQGA 1ZS0A 4HX3A 3VTGA 2AIGP 1SLMA 3EWJA 5D1SA 2WO9A 2X7MA 1HFSA 3ELMA 1BUDA 1D7XA 3LJZA 3AYKA 2MZEA 3OHLA 1UTZA 1PWUA 2W14A 1XUDA 1CXVA 1JAQA 1KUHA 3EHYA 1UMTA 4PKRA 2K2GA 3GBOA 1USNA 3VI1A 3KMCA 4GF1A 4IUWA 1MMPA 1CK7A 3B2ZA 1B8YA 1XFUA 4PKSA 3Q2GA 1XFXA 1Y93A 1AYKA 4GWMA 4JIJA 3EHXA 2DDYA 1BIWA 3LUMA 3USNA 3LILA 3DWBA 5H8XA 5JMYA 1S4BP 4H3XA 4GR8A 2D1NA 2E2DA 3LIKA 1IADA 3LQBA 3NX7A 1RMZA 2J83A 4GQLA 2Z2DA 4WK7A 1RM8A 5D2BA 1CGFA 1BZSA 1Y0VA 1DMTA 3HY9A 1SATA 3G42A 4A3WA 1FBLA 2CKIA 1D8MA 1QIBA 4G9LA 1GE6A 5L7FA 3KHIA 830CA 1JANA 1A86A 2MZHA 1XFWA 2Y6DA 4GR0A 4AIGA 1JIWP 4IN9A 1ZTQA 1BQQM 2RJPA 3O2XA 2YB9A 3DL1A 4FVLA 2K9CA 2I47A 1DTHA 2JSDA 4DD8A 1SU3A 1OM7A 1BUVM 3RTSA 1SMPA 3F17A 2POJA 4L19A 3EDGA 1A85A 3KMEA 3V96B 1PWWA 1OO9A 3DPEA 1KUFA 1GKCA 1BKCE 4PKWA 1GE7A 4FXYP 1UEAA 3TT4A 1K7IA 2YIGA 3O64A 1ZXVA 1R1JA 2O3EA 3K7LA 3U1RA 2N8RA 2X3BA 4J4MA 4I03A 4WKIA 1R54A 3ZUKA 1G12A 1ND1A 5B5OA 4HMAA 1UMSA 2XS3A 3SHIA 4PKTA 1C7KA 2OZRA 3I7IA 3KRYA 3LUNA 1KUGA 3G5CA 1QJJA 1JIZA 3LGPA 1OS9A 1Y8JA 1OM8A 1JAOA 1YCMA 3BA0A 1GXDA 1MMRA 1ROSA 1K7QA 2E3XA 2PJTA 1O0QA 1KUIA 3K7NA 1XUCA 1WNIA 3HBUP 1I76A 2MLSA 2W12A 2W15A 2CLTA 3HBVP 3F1AA 3KWVC 4QKZA 1KAPP 1ZVXA 4PKUA 2ERPA 3AIGA 4WZVA 3KECA 2A8HA 3LK8A 1D5JA 5CUHA 1JAPA 2USNA 4Q1LA 2HU6A 1GO7P 1GE5A 1I1IP 4AUOA 2FV9A 1UTTA 3LKAA 1K7GA 3N2VA 2DW1A 3WV2A 2WOAA 1PWVA 2OW0A 3MA2A 1PWQA 1IAAA 3RTTA 1YQYA 1ZP5A 3DSLA 4L63A 3F19A 3UVCA 1QICA 1OM6A 5D1UA 1HFCA 4JP4A 1BKCI 1QUAA 5BOTA 3WV1A 1SLNA 3OHOA 5I0LA 2MLRA 5CXAA 4AXQA 2OY4A 2OVZA 1AKLA 1BKCA 1BSWA 1EB6A 4H49A 1YP1A 2W0DA 5I43A 2OW1A 1OS2A 1XFVA 2L0RA 5D7WA 1I73A 5BOYA 5LABA 1G4KA 1B3DA 1O0TA 2DDFA 3B8ZA 4JPAA 1R55A 2AYKA 3KEJA 2O36A 1IABA 4DPEA 966CA 4FXQA 3TS4A 1JK3A 2SRTA 3Q2HA 1JH1A 1GKDA 1MMQA 1J7NA 4AYKA 5D3CA 3TSKA 1Z3JA 4H30A 4H76A 1IAEA 3HY7A 3CKIA 3N2UA 4DV8A 3EDHA 1PWPA 2V4BA 2DW0A 1C3IA 2OW2A 5D1TA 1OMJA 1BQOA 3DNGA 1EUBA 1HY7A 2QPJA 2OY2A 1XFZA 4I35A 2MZIA 5I12A 4PKQA 2JT5A 4WKEA 3L0VA 4GR3A 1G05A 4G0DA 3LQ0A 1AF0A 3B92A 4WF6A 4CTHA 1IAGA 2JNPA 1L6JA 2OW9A 3P24A 4GUYA 4H82A 3LJTA 3HB2P 4A7BA 1FM1A 1HOVA 3HDBA 1CAQA 4H1QA 2OXWA 1CGEA 2X3AA 4EFSA 2OI0A 2RJQA 2OXUA 1YOUA 2XS4A 1QJIA 4L6TA 3LIRA 5BPAA 2OVXA 4XCTA
chains in the Genus database with same CATH superfamily
1KBCA 3P1VA 1D8FA 3E8RA 3HDAP 3LJGA 3LEAA 1ASTA 1JKYA 3EDIA 4JA1A 3HYGA 1G49A 1HTDA 4PKVA 3AYUA 3ZXHA 2EROA 2WO8A 4XM8A 1H71P 2KRJA 1JJ9A 2FV5A 4IJOA 4ZR5A 1G9KA 1EAKA 1CIZA 2X3CA 456CA 1R1IA 3WV3A 4FU4A 5B5PA 1XFYA 4ON1A 5I2ZA 1C8TA 2W13A 2JT6A 1BM6A 3F15A 1XURA 3F16A 1R1HA 3TVCA 4XM6A 5I4OA 1ZXCA 4GWNA 2Y6CA 1QIAA 3L0TA 3KEKA 2D1OA 5I3MA 1Q3AA 3ZVSA 2J0TA 3EDZA 4XM7A 2TCLA 3DPFA 1ATLA 1GO8P 4H84A 2JIHA 3LMCA 1CQRA 4DF9A 4XBHA 1KUKA 5CZMA 1CGLA 1FLSA 3LE9A 1MMBA 2ERQA 5L79A 4H2EA 2DW2A 1MNCA 1XAXA 3F18A 1SRPA 4R3VA 4ILWD 1IACA 1HV5A 3I7GA 2OXZA 4JQGA 1ZS0A 4HX3A 3VTGA 2AIGP 1SLMA 3EWJA 5D1SA 2WO9A 2X7MA 1HFSA 3ELMA 1BUDA 1D7XA 3LJZA 3AYKA 2MZEA 3OHLA 1UTZA 1PWUA 2W14A 1XUDA 1CXVA 1JAQA 1KUHA 3EHYA 2YUFA 1UMTA 4PKRA 2K2GA 3GBOA 1USNA 3VI1A 3KMCA 4GF1A 4IUWA 1MMPA 1XM5A 1CK7A 3B2ZA 1B8YA 1XFUA 4PKSA 3Q2GA 1XFXA 1Y93A 1AYKA 4GWMA 4JIJA 3EHXA 2DDYA 1BIWA 3LUMA 3USNA 3LILA 3DWBA 5H8XA 5JMYA 1S4BP 4H3XA 4GR8A 2D1NA 2E2DA 3LIKA 1IADA 3LQBA 3DTKA 3NX7A 1RMZA 2J83A 4GQLA 2Z2DA 4WK7A 1RM8A 5D2BA 1CGFA 1BZSA 1Y0VA 1DMTA 3HY9A 1SATA 3G42A 4A3WA 1FBLA 2CKIA 1D8MA 1QIBA 4G9LA 1GE6A 5L7FA 3KHIA 830CA 1JANA 1A86A 2MZHA 1XFWA 2Y6DA 4GR0A 4AIGA 1JIWP 4IN9A 1ZTQA 1BQQM 2RJPA 3O2XA 2YB9A 3DL1A 4FVLA 2K9CA 2I47A 1DTHA 2JSDA 4DD8A 1SU3A 1OM7A 1BUVM 3RTSA 1SMPA 3F17A 2POJA 4L19A 3EDGA 1A85A 3KMEA 3V96B 1PWWA 1OO9A 3DPEA 1KUFA 1GKCA 1BKCE 4PKWA 3DTEA 1GE7A 4FXYP 1UEAA 3TT4A 1K7IA 2YIGA 3O64A 1ZXVA 1R1JA 2O3EA 3K7LA 3U1RA 2N8RA 2X3BA 4J4MA 4I03A 4WKIA 1R54A 3ZUKA 1G12A 1ND1A 5B5OA 4HMAA 1UMSA 2XS3A 3SHIA 4PKTA 1C7KA 2OZRA 3I7IA 3KRYA 3LUNA 1KUGA 3G5CA 1QJJA 1JIZA 3LGPA 1OS9A 1Y8JA 1OM8A 1JAOA 1YCMA 3BA0A 1GXDA 1MMRA 1ROSA 1OZ9A 1K7QA 2E3XA 2PJTA 1O0QA 1KUIA 3K7NA 1XUCA 1WNIA 3HBUP 1I76A 2MLSA 2W12A 2W15A 2CLTA 3HBVP 3F1AA 3KWVC 4QKZA 1KAPP 1ZVXA 4PKUA 2ERPA 3AIGA 4WZVA 3KECA 2A8HA 3LK8A 1D5JA 5CUHA 1JAPA 2USNA 4Q1LA 2HU6A 1GO7P 1GE5A 1I1IP 4AUOA 2FV9A 1UTTA 3LKAA 1K7GA 3N2VA 2DW1A 3WV2A 2WOAA 1PWVA 2OW0A 3MA2A 1PWQA 1IAAA 3RTTA 1YQYA 4L7AA 1ZP5A 3DSLA 4L63A 3F19A 3UVCA 1QICA 1OM6A 5D1UA 1HFCA 4JP4A 1BKCI 1QUAA 5BOTA 3WV1A 1SLNA 3OHOA 5I0LA 2MLRA 5CXAA 4AXQA 2OY4A 1TVIA 2OVZA 1AKLA 1BKCA 1BSWA 1EB6A 4H49A 1YP1A 2W0DA 5I43A 2OW1A 1OS2A 1XFVA 2L0RA 5D7WA 1I73A 5BOYA 5LABA 1G4KA 1B3DA 1O0TA 2DDFA 3B8ZA 4JPAA 1R55A 2AYKA 3KEJA 2O36A 1IABA 4DPEA 966CA 4FXQA 3TS4A 1JK3A 2SRTA 3Q2HA 1JH1A 1GKDA 1MMQA 1J7NA 4AYKA 5D3CA 3TSKA 1Z3JA 4H30A 4H76A 1IAEA 3HY7A 3CKIA 3N2UA 4DV8A 3EDHA 1PWPA 2V4BA 2DW0A 1C3IA 2OW2A 5D1TA 1OMJA 1BQOA 3DNGA 1EUBA 1HY7A 2QPJA 2OY2A 1XFZA 4I35A 2MZIA 5I12A 4PKQA 2JT5A 4WKEA 3L0VA 4GR3A 1G05A 4G0DA 3LQ0A 1AF0A 3B92A 4WF6A 4CTHA 1IAGA 2JNPA 1L6JA 2OW9A 3P24A 4GUYA 4H82A 3LJTA 3HB2P 4A7BA 1FM1A 1HOVA 3HDBA 1CAQA 4H1QA 2OXWA 3DTIA 1CGEA 2X3AA 4EFSA 2OI0A 2RJQA 2OXUA 1YOUA 2XS4A 1QJIA 4L6TA 3LIRA 5BPAA 2OVXA 4XCTA
chains in the Genus database with same CATH topology
1KBCA 3P1VA 1D8FA 3E8RA 3HDAP 3LJGA 3LEAA 1ASTA 1JKYA 3EDIA 4JA1A 3HYGA 1G49A 1HTDA 4PKVA 3AYUA 3ZXHA 2EROA 2WO8A 4XM8A 1H71P 2KRJA 1JJ9A 2FV5A 4IJOA 4ZR5A 1G9KA 1EAKA 1CIZA 2X3CA 456CA 1R1IA 3WV3A 4FU4A 5B5PA 1XFYA 4ON1A 5I2ZA 1C8TA 2W13A 2JT6A 1BM6A 3F15A 1XURA 3F16A 1R1HA 3TVCA 4XM6A 5I4OA 1ZXCA 4GWNA 2Y6CA 1QIAA 3L0TA 3KEKA 2D1OA 5I3MA 1Q3AA 3ZVSA 2J0TA 3EDZA 4XM7A 2TCLA 3DPFA 1ATLA 1GO8P 4H84A 2JIHA 3LMCA 1CQRA 4DF9A 4XBHA 1KUKA 5CZMA 1CGLA 1FLSA 3LE9A 1MMBA 2ERQA 5L79A 4H2EA 2DW2A 1MNCA 3F18A 1SRPA 4R3VA 4ILWD 1IACA 1HV5A 3I7GA 2OXZA 4JQGA 1ZS0A 4HX3A 3VTGA 2AIGP 1SLMA 3EWJA 5D1SA 2WO9A 2X7MA 1HFSA 3ELMA 1BUDA 1D7XA 3LJZA 3AYKA 2MZEA 3OHLA 1UTZA 1PWUA 2W14A 1XUDA 1CXVA 1JAQA 1KUHA 3EHYA 2YUFA 1UMTA 4PKRA 2K2GA 3GBOA 1USNA 3VI1A 3KMCA 4GF1A 4IUWA 1MMPA 1CK7A 3B2ZA 1B8YA 1XFUA 4PKSA 3Q2GA 1XFXA 1Y93A 1AYKA 4GWMA 4JIJA 3EHXA 2DDYA 1BIWA 3LUMA 3USNA 3LILA 3DWBA 5H8XA 5JMYA 1S4BP 4H3XA 4GR8A 2D1NA 2E2DA 3LIKA 1IADA 3LQBA 3DTKA 3NX7A 1RMZA 2J83A 4GQLA 2Z2DA 4WK7A 1RM8A 5D2BA 1CGFA 1BZSA 1Y0VA 1DMTA 3HY9A 1SATA 3G42A 4A3WA 1FBLA 2CKIA 1D8MA 1QIBA 4G9LA 1GE6A 5L7FA 3KHIA 830CA 1JANA 1A86A 2MZHA 1XFWA 2Y6DA 4GR0A 4AIGA 1JIWP 4IN9A 1ZTQA 1BQQM 2RJPA 3O2XA 2YB9A 3DL1A 4FVLA 2K9CA 2I47A 1DTHA 2JSDA 4DD8A 1SU3A 1OM7A 1BUVM 3RTSA 1SMPA 3F17A 2POJA 4L19A 3EDGA 1A85A 3KMEA 3V96B 1PWWA 1OO9A 3DPEA 1KUFA 1GKCA 1BKCE 4PKWA 3DTEA 1GE7A 4FXYP 1UEAA 3TT4A 1K7IA 2YIGA 3O64A 1ZXVA 1R1JA 2O3EA 3K7LA 3U1RA 2N8RA 2X3BA 4J4MA 4I03A 4WKIA 1R54A 3ZUKA 1G12A 1ND1A 5B5OA 4HMAA 1UMSA 2XS3A 3SHIA 4PKTA 1C7KA 2OZRA 3I7IA 3KRYA 3LUNA 1KUGA 3G5CA 1QJJA 1JIZA 3LGPA 1OS9A 1Y8JA 1OM8A 1JAOA 1YCMA 3BA0A 1GXDA 1MMRA 1ROSA 1K7QA 2E3XA 2PJTA 1O0QA 1KUIA 3K7NA 1XUCA 1WNIA 3HBUP 1I76A 2MLSA 2W12A 2W15A 2CLTA 3HBVP 3F1AA 3KWVC 4QKZA 1KAPP 1ZVXA 4PKUA 2ERPA 3AIGA 4WZVA 3KECA 2A8HA 3LK8A 1D5JA 5CUHA 1JAPA 2USNA 4Q1LA 2HU6A 1GO7P 1GE5A 1I1IP 4AUOA 2FV9A 1UTTA 3LKAA 1K7GA 3N2VA 2DW1A 3WV2A 2WOAA 1PWVA 2OW0A 3MA2A 1PWQA 1IAAA 3RTTA 1YQYA 4L7AA 1ZP5A 3DSLA 4L63A 3F19A 3UVCA 1QICA 1OM6A 5D1UA 1HFCA 4JP4A 1BKCI 1QUAA 5BOTA 3WV1A 1SLNA 3OHOA 5I0LA 2MLRA 5CXAA 4AXQA 2OY4A 2OVZA 1AKLA 1BKCA 1BSWA 1EB6A 4H49A 1YP1A 2W0DA 5I43A 2OW1A 1OS2A 1XFVA 2L0RA 5D7WA 1I73A 5BOYA 5LABA 1G4KA 1B3DA 1O0TA 2DDFA 3B8ZA 4JPAA 1R55A 2AYKA 3KEJA 2O36A 1IABA 4DPEA 966CA 4FXQA 3TS4A 1JK3A 2SRTA 3Q2HA 1JH1A 1GKDA 1MMQA 1J7NA 4AYKA 5D3CA 3TSKA 1Z3JA 4H30A 4H76A 1IAEA 3HY7A 3CKIA 3N2UA 4DV8A 3EDHA 1PWPA 2V4BA 2DW0A 1C3IA 2OW2A 5D1TA 1OMJA 1BQOA 3DNGA 1EUBA 1HY7A 2QPJA 2OY2A 1XFZA 4I35A 2MZIA 5I12A 4PKQA 2JT5A 4WKEA 3L0VA 4GR3A 1G05A 4G0DA 3LQ0A 1AF0A 3B92A 4WF6A 4CTHA 1IAGA 2JNPA 1L6JA 2OW9A 3P24A 4GUYA 4H82A 3LJTA 3HB2P 4A7BA 1FM1A 1HOVA 3HDBA 1CAQA 4H1QA 2OXWA 3DTIA 1CGEA 2X3AA 4EFSA 2OI0A 2RJQA 2OXUA 1YOUA 2XS4A 1QJIA 4L6TA 3LIRA 5BPAA 2OVXA 4XCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBC A;  3P1V A;  1D8F A;  3E8R A;  3HDA P;  3LJG A;  3LEA A;  1AST A;  1JKY A;  3EDI A;  4JA1 A;  3HYG A;  1G49 A;  1HTD A;  4PKV A;  3AYU A;  3ZXH A;  2ERO A;  2WO8 A;  4XM8 A;  1H71 P;  2KRJ A;  1JJ9 A;  2FV5 A;  4IJO A;  4ZR5 A;  1G9K A;  1EAK A;  1CIZ A;  2X3C A;  456C A;  1R1I A;  3WV3 A;  4FU4 A;  5B5P A;  1XFY A;  4ON1 A;  5I2Z A;  1C8T A;  2W13 A;  2JT6 A;  1BM6 A;  3F15 A;  1XUR A;  3F16 A;  1R1H A;  3TVC A;  4XM6 A;  5I4O A;  1ZXC A;  4GWN A;  2Y6C A;  1QIA A;  3L0T A;  3KEK A;  2D1O A;  5I3M A;  1Q3A A;  3ZVS A;  2J0T A;  3EDZ A;  4XM7 A;  2TCL A;  3DPF A;  1ATL A;  1GO8 P;  4H84 A;  2JIH A;  3LMC A;  1CQR A;  4DF9 A;  4XBH A;  1KUK A;  5CZM A;  1CGL A;  1FLS A;  3LE9 A;  1MMB A;  2ERQ A;  5L79 A;  4H2E A;  2DW2 A;  1MNC A;  3F18 A;  1SRP A;  4R3V A;  4ILW D;  1IAC A;  1HV5 A;  3I7G A;  2OXZ A;  4JQG A;  1ZS0 A;  4HX3 A;  3VTG A;  2AIG P;  1SLM A;  3EWJ A;  5D1S A;  2WO9 A;  2X7M A;  1HFS A;  3ELM A;  1BUD A;  1D7X A;  3LJZ A;  3AYK A;  2MZE A;  3OHL A;  1UTZ A;  1PWU A;  2W14 A;  1XUD A;  1CXV A;  1JAQ A;  1KUH A;  3EHY A;  1UMT A;  4PKR A;  2K2G A;  3GBO A;  1USN A;  3VI1 A;  3KMC A;  4GF1 A;  4IUW A;  1MMP A;  1CK7 A;  3B2Z A;  1B8Y A;  1XFU A;  4PKS A;  3Q2G A;  1XFX A;  1Y93 A;  1AYK A;  4GWM A;  4JIJ A;  3EHX A;  2DDY A;  1BIW A;  3LUM A;  3USN A;  3LIL A;  3DWB A;  5H8X A;  5JMY A;  1S4B P;  4H3X A;  4GR8 A;  2D1N A;  2E2D A;  3LIK A;  1IAD A;  3LQB A;  3NX7 A;  1RMZ A;  2J83 A;  4GQL A;  2Z2D A;  4WK7 A;  1RM8 A;  5D2B A;  1CGF A;  1BZS A;  1Y0V A;  1DMT A;  3HY9 A;  1SAT A;  3G42 A;  4A3W A;  1FBL A;  2CKI A;  1D8M A;  1QIB A;  4G9L A;  1GE6 A;  5L7F A;  3KHI A;  830C A;  1JAN A;  1A86 A;  2MZH A;  1XFW A;  2Y6D A;  4GR0 A;  4AIG A;  1JIW P;  4IN9 A;  1ZTQ A;  1BQQ M;  2RJP A;  3O2X A;  2YB9 A;  3DL1 A;  4FVL A;  2K9C A;  2I47 A;  1DTH A;  2JSD A;  4DD8 A;  1SU3 A;  1OM7 A;  1BUV M;  3RTS A;  1SMP A;  3F17 A;  2POJ A;  4L19 A;  3EDG A;  1A85 A;  3KME A;  3V96 B;  1PWW A;  1OO9 A;  3DPE A;  1KUF A;  1GKC A;  1BKC E;  4PKW A;  1GE7 A;  4FXY P;  1UEA A;  3TT4 A;  1K7I A;  2YIG A;  3O64 A;  1ZXV A;  1R1J A;  2O3E A;  3K7L A;  3U1R A;  2N8R A;  2X3B A;  4J4M A;  4I03 A;  4WKI A;  1R54 A;  3ZUK A;  1G12 A;  1ND1 A;  5B5O A;  4HMA A;  1UMS A;  2XS3 A;  3SHI A;  4PKT A;  1C7K A;  2OZR A;  3I7I A;  3KRY A;  3LUN A;  1KUG A;  3G5C A;  1QJJ A;  1JIZ A;  3LGP A;  1OS9 A;  1Y8J A;  1OM8 A;  1JAO A;  1YCM A;  3BA0 A;  1GXD A;  1MMR A;  1ROS A;  1K7Q A;  2E3X A;  2PJT A;  1O0Q A;  1KUI A;  3K7N A;  1XUC A;  1WNI A;  3HBU P;  1I76 A;  2MLS A;  2W12 A;  2W15 A;  2CLT A;  3HBV P;  3F1A A;  3KWV C;  4QKZ A;  1KAP P;  1ZVX A;  4PKU A;  2ERP A;  3AIG A;  4WZV A;  3KEC A;  2A8H A;  3LK8 A;  1D5J A;  5CUH A;  1JAP A;  2USN A;  4Q1L A;  2HU6 A;  1GO7 P;  1GE5 A;  1I1I P;  4AUO A;  2FV9 A;  1UTT A;  3LKA A;  1K7G A;  3N2V A;  2DW1 A;  3WV2 A;  2WOA A;  1PWV A;  2OW0 A;  3MA2 A;  1PWQ A;  1IAA A;  3RTT A;  1YQY A;  1ZP5 A;  3DSL A;  4L63 A;  3F19 A;  3UVC A;  1QIC A;  1OM6 A;  5D1U A;  1HFC A;  4JP4 A;  1BKC I;  1QUA A;  5BOT A;  3WV1 A;  1SLN A;  3OHO A;  5I0L A;  2MLR A;  5CXA A;  4AXQ A;  2OY4 A;  2OVZ A;  1AKL A;  1BKC A;  1BSW A;  1EB6 A;  4H49 A;  1YP1 A;  2W0D A;  5I43 A;  2OW1 A;  1OS2 A;  1XFV A;  2L0R A;  5D7W A;  1I73 A;  5BOY A;  5LAB A;  1G4K A;  1B3D A;  1O0T A;  2DDF A;  3B8Z A;  4JPA A;  1R55 A;  2AYK A;  3KEJ A;  2O36 A;  1IAB A;  4DPE A;  966C A;  4FXQ A;  3TS4 A;  1JK3 A;  2SRT A;  3Q2H A;  1JH1 A;  1GKD A;  1MMQ A;  1J7N A;  4AYK A;  5D3C A;  3TSK A;  1Z3J A;  4H30 A;  4H76 A;  1IAE A;  3HY7 A;  3CKI A;  3N2U A;  4DV8 A;  3EDH A;  1PWP A;  2V4B A;  2DW0 A;  1C3I A;  2OW2 A;  5D1T A;  1OMJ A;  1BQO A;  3DNG A;  1EUB A;  1HY7 A;  2QPJ A;  2OY2 A;  1XFZ A;  4I35 A;  2MZI A;  5I12 A;  4PKQ A;  2JT5 A;  4WKE A;  3L0V A;  4GR3 A;  1G05 A;  4G0D A;  3LQ0 A;  1AF0 A;  3B92 A;  4WF6 A;  4CTH A;  1IAG A;  2JNP A;  1L6J A;  2OW9 A;  3P24 A;  4GUY A;  4H82 A;  3LJT A;  3HB2 P;  4A7B A;  1FM1 A;  1HOV A;  3HDB A;  1CAQ A;  4H1Q A;  2OXW A;  1CGE A;  2X3A A;  4EFS A;  2OI0 A;  2RJQ A;  2OXU A;  1YOU A;  2XS4 A;  1QJI A;  4L6T A;  3LIR A;  5BPA A;  2OVX A;  4XCT A; 
#chains in the Genus database with same CATH topology
 1KBC A;  3P1V A;  1D8F A;  3E8R A;  3HDA P;  3LJG A;  3LEA A;  1AST A;  1JKY A;  3EDI A;  4JA1 A;  3HYG A;  1G49 A;  1HTD A;  4PKV A;  3AYU A;  3ZXH A;  2ERO A;  2WO8 A;  4XM8 A;  1H71 P;  2KRJ A;  1JJ9 A;  2FV5 A;  4IJO A;  4ZR5 A;  1G9K A;  1EAK A;  1CIZ A;  2X3C A;  456C A;  1R1I A;  3WV3 A;  4FU4 A;  5B5P A;  1XFY A;  4ON1 A;  5I2Z A;  1C8T A;  2W13 A;  2JT6 A;  1BM6 A;  3F15 A;  1XUR A;  3F16 A;  1R1H A;  3TVC A;  4XM6 A;  5I4O A;  1ZXC A;  4GWN A;  2Y6C A;  1QIA A;  3L0T A;  3KEK A;  2D1O A;  5I3M A;  1Q3A A;  3ZVS A;  2J0T A;  3EDZ A;  4XM7 A;  2TCL A;  3DPF A;  1ATL A;  1GO8 P;  4H84 A;  2JIH A;  3LMC A;  1CQR A;  4DF9 A;  4XBH A;  1KUK A;  5CZM A;  1CGL A;  1FLS A;  3LE9 A;  1MMB A;  2ERQ A;  5L79 A;  4H2E A;  2DW2 A;  1MNC A;  1XAX A;  3F18 A;  1SRP A;  4R3V A;  4ILW D;  1IAC A;  1HV5 A;  3I7G A;  2OXZ A;  4JQG A;  1ZS0 A;  4HX3 A;  3VTG A;  2AIG P;  1SLM A;  3EWJ A;  5D1S A;  2WO9 A;  2X7M A;  1HFS A;  3ELM A;  1BUD A;  1D7X A;  3LJZ A;  3AYK A;  2MZE A;  3OHL A;  1UTZ A;  1PWU A;  2W14 A;  1XUD A;  1CXV A;  1JAQ A;  1KUH A;  3EHY A;  2YUF A;  1UMT A;  4PKR A;  2K2G A;  3GBO A;  1USN A;  3VI1 A;  3KMC A;  4GF1 A;  4IUW A;  1MMP A;  1XM5 A;  1CK7 A;  3B2Z A;  1B8Y A;  1XFU A;  4PKS A;  3Q2G A;  1XFX A;  1Y93 A;  1AYK A;  4GWM A;  4JIJ A;  3EHX A;  2DDY A;  1BIW A;  3LUM A;  3USN A;  3LIL A;  3DWB A;  5H8X A;  5JMY A;  1S4B P;  4H3X A;  4GR8 A;  2D1N A;  2E2D A;  3LIK A;  1IAD A;  3LQB A;  3DTK A;  3NX7 A;  1RMZ A;  2J83 A;  4GQL A;  2Z2D A;  4WK7 A;  1RM8 A;  5D2B A;  1CGF A;  1BZS A;  1Y0V A;  1DMT A;  3HY9 A;  1SAT A;  3G42 A;  4A3W A;  1FBL A;  2CKI A;  1D8M A;  1QIB A;  4G9L A;  1GE6 A;  5L7F A;  3KHI A;  830C A;  1JAN A;  1A86 A;  2MZH A;  1XFW A;  2Y6D A;  4GR0 A;  4AIG A;  1JIW P;  4IN9 A;  1ZTQ A;  1BQQ M;  2RJP A;  3O2X A;  2YB9 A;  3DL1 A;  4FVL A;  2K9C A;  2I47 A;  1DTH A;  2JSD A;  4DD8 A;  1SU3 A;  1OM7 A;  1BUV M;  3RTS A;  1SMP A;  3F17 A;  2POJ A;  4L19 A;  3EDG A;  1A85 A;  3KME A;  3V96 B;  1PWW A;  1OO9 A;  3DPE A;  1KUF A;  1GKC A;  1BKC E;  4PKW A;  3DTE A;  1GE7 A;  4FXY P;  1UEA A;  3TT4 A;  1K7I A;  2YIG A;  3O64 A;  1ZXV A;  1R1J A;  2O3E A;  3K7L A;  3U1R A;  2N8R A;  2X3B A;  4J4M A;  4I03 A;  4WKI A;  1R54 A;  3ZUK A;  1G12 A;  1ND1 A;  5B5O A;  4HMA A;  1UMS A;  2XS3 A;  3SHI A;  4PKT A;  1C7K A;  2OZR A;  3I7I A;  3KRY A;  3LUN A;  1KUG A;  3G5C A;  1QJJ A;  1JIZ A;  3LGP A;  1OS9 A;  1Y8J A;  1OM8 A;  1JAO A;  1YCM A;  3BA0 A;  1GXD A;  1MMR A;  1ROS A;  1OZ9 A;  1K7Q A;  2E3X A;  2PJT A;  1O0Q A;  1KUI A;  3K7N A;  1XUC A;  1WNI A;  3HBU P;  1I76 A;  2MLS A;  2W12 A;  2W15 A;  2CLT A;  3HBV P;  3F1A A;  3KWV C;  4QKZ A;  1KAP P;  1ZVX A;  4PKU A;  2ERP A;  3AIG A;  4WZV A;  3KEC A;  2A8H A;  3LK8 A;  1D5J A;  5CUH A;  1JAP A;  2USN A;  4Q1L A;  2HU6 A;  1GO7 P;  1GE5 A;  1I1I P;  4AUO A;  2FV9 A;  1UTT A;  3LKA A;  1K7G A;  3N2V A;  2DW1 A;  3WV2 A;  2WOA A;  1PWV A;  2OW0 A;  3MA2 A;  1PWQ A;  1IAA A;  3RTT A;  1YQY A;  4L7A A;  1ZP5 A;  3DSL A;  4L63 A;  3F19 A;  3UVC A;  1QIC A;  1OM6 A;  5D1U A;  1HFC A;  4JP4 A;  1BKC I;  1QUA A;  5BOT A;  3WV1 A;  1SLN A;  3OHO A;  5I0L A;  2MLR A;  5CXA A;  4AXQ A;  2OY4 A;  1TVI A;  2OVZ A;  1AKL A;  1BKC A;  1BSW A;  1EB6 A;  4H49 A;  1YP1 A;  2W0D A;  5I43 A;  2OW1 A;  1OS2 A;  1XFV A;  2L0R A;  5D7W A;  1I73 A;  5BOY A;  5LAB A;  1G4K A;  1B3D A;  1O0T A;  2DDF A;  3B8Z A;  4JPA A;  1R55 A;  2AYK A;  3KEJ A;  2O36 A;  1IAB A;  4DPE A;  966C A;  4FXQ A;  3TS4 A;  1JK3 A;  2SRT A;  3Q2H A;  1JH1 A;  1GKD A;  1MMQ A;  1J7N A;  4AYK A;  5D3C A;  3TSK A;  1Z3J A;  4H30 A;  4H76 A;  1IAE A;  3HY7 A;  3CKI A;  3N2U A;  4DV8 A;  3EDH A;  1PWP A;  2V4B A;  2DW0 A;  1C3I A;  2OW2 A;  5D1T A;  1OMJ A;  1BQO A;  3DNG A;  1EUB A;  1HY7 A;  2QPJ A;  2OY2 A;  1XFZ A;  4I35 A;  2MZI A;  5I12 A;  4PKQ A;  2JT5 A;  4WKE A;  3L0V A;  4GR3 A;  1G05 A;  4G0D A;  3LQ0 A;  1AF0 A;  3B92 A;  4WF6 A;  4CTH A;  1IAG A;  2JNP A;  1L6J A;  2OW9 A;  3P24 A;  4GUY A;  4H82 A;  3LJT A;  3HB2 P;  4A7B A;  1FM1 A;  1HOV A;  3HDB A;  1CAQ A;  4H1Q A;  2OXW A;  3DTI A;  1CGE A;  2X3A A;  4EFS A;  2OI0 A;  2RJQ A;  2OXU A;  1YOU A;  2XS4 A;  1QJI A;  4L6T A;  3LIR A;  5BPA A;  2OVX A;  4XCT A; 
#chains in the Genus database with same CATH homology
 1KBC A;  3P1V A;  1D8F A;  3E8R A;  3HDA P;  3LJG A;  3LEA A;  1AST A;  1JKY A;  3EDI A;  4JA1 A;  3HYG A;  1G49 A;  1HTD A;  4PKV A;  3AYU A;  3ZXH A;  2ERO A;  2WO8 A;  4XM8 A;  1H71 P;  2KRJ A;  1JJ9 A;  2FV5 A;  4IJO A;  4ZR5 A;  1G9K A;  1EAK A;  1CIZ A;  2X3C A;  456C A;  1R1I A;  3WV3 A;  4FU4 A;  5B5P A;  1XFY A;  4ON1 A;  5I2Z A;  1C8T A;  2W13 A;  2JT6 A;  1BM6 A;  3F15 A;  1XUR A;  3F16 A;  1R1H A;  3TVC A;  4XM6 A;  5I4O A;  1ZXC A;  4GWN A;  2Y6C A;  1QIA A;  3L0T A;  3KEK A;  2D1O A;  5I3M A;  1Q3A A;  3ZVS A;  2J0T A;  3EDZ A;  4XM7 A;  2TCL A;  3DPF A;  1ATL A;  1GO8 P;  4H84 A;  2JIH A;  3LMC A;  1CQR A;  4DF9 A;  4XBH A;  1KUK A;  5CZM A;  1CGL A;  1FLS A;  3LE9 A;  1MMB A;  2ERQ A;  5L79 A;  4H2E A;  2DW2 A;  1MNC A;  3F18 A;  1SRP A;  4R3V A;  4ILW D;  1IAC A;  1HV5 A;  3I7G A;  2OXZ A;  4JQG A;  1ZS0 A;  4HX3 A;  3VTG A;  2AIG P;  1SLM A;  3EWJ A;  5D1S A;  2WO9 A;  2X7M A;  1HFS A;  3ELM A;  1BUD A;  1D7X A;  3LJZ A;  3AYK A;  2MZE A;  3OHL A;  1UTZ A;  1PWU A;  2W14 A;  1XUD A;  1CXV A;  1JAQ A;  1KUH A;  3EHY A;  2YUF A;  1UMT A;  4PKR A;  2K2G A;  3GBO A;  1USN A;  3VI1 A;  3KMC A;  4GF1 A;  4IUW A;  1MMP A;  1CK7 A;  3B2Z A;  1B8Y A;  1XFU A;  4PKS A;  3Q2G A;  1XFX A;  1Y93 A;  1AYK A;  4GWM A;  4JIJ A;  3EHX A;  2DDY A;  1BIW A;  3LUM A;  3USN A;  3LIL A;  3DWB A;  5H8X A;  5JMY A;  1S4B P;  4H3X A;  4GR8 A;  2D1N A;  2E2D A;  3LIK A;  1IAD A;  3LQB A;  3DTK A;  3NX7 A;  1RMZ A;  2J83 A;  4GQL A;  2Z2D A;  4WK7 A;  1RM8 A;  5D2B A;  1CGF A;  1BZS A;  1Y0V A;  1DMT A;  3HY9 A;  1SAT A;  3G42 A;  4A3W A;  1FBL A;  2CKI A;  1D8M A;  1QIB A;  4G9L A;  1GE6 A;  5L7F A;  3KHI A;  830C A;  1JAN A;  1A86 A;  2MZH A;  1XFW A;  2Y6D A;  4GR0 A;  4AIG A;  1JIW P;  4IN9 A;  1ZTQ A;  1BQQ M;  2RJP A;  3O2X A;  2YB9 A;  3DL1 A;  4FVL A;  2K9C A;  2I47 A;  1DTH A;  2JSD A;  4DD8 A;  1SU3 A;  1OM7 A;  1BUV M;  3RTS A;  1SMP A;  3F17 A;  2POJ A;  4L19 A;  3EDG A;  1A85 A;  3KME A;  3V96 B;  1PWW A;  1OO9 A;  3DPE A;  1KUF A;  1GKC A;  1BKC E;  4PKW A;  3DTE A;  1GE7 A;  4FXY P;  1UEA A;  3TT4 A;  1K7I A;  2YIG A;  3O64 A;  1ZXV A;  1R1J A;  2O3E A;  3K7L A;  3U1R A;  2N8R A;  2X3B A;  4J4M A;  4I03 A;  4WKI A;  1R54 A;  3ZUK A;  1G12 A;  1ND1 A;  5B5O A;  4HMA A;  1UMS A;  2XS3 A;  3SHI A;  4PKT A;  1C7K A;  2OZR A;  3I7I A;  3KRY A;  3LUN A;  1KUG A;  3G5C A;  1QJJ A;  1JIZ A;  3LGP A;  1OS9 A;  1Y8J A;  1OM8 A;  1JAO A;  1YCM A;  3BA0 A;  1GXD A;  1MMR A;  1ROS A;  1K7Q A;  2E3X A;  2PJT A;  1O0Q A;  1KUI A;  3K7N A;  1XUC A;  1WNI A;  3HBU P;  1I76 A;  2MLS A;  2W12 A;  2W15 A;  2CLT A;  3HBV P;  3F1A A;  3KWV C;  4QKZ A;  1KAP P;  1ZVX A;  4PKU A;  2ERP A;  3AIG A;  4WZV A;  3KEC A;  2A8H A;  3LK8 A;  1D5J A;  5CUH A;  1JAP A;  2USN A;  4Q1L A;  2HU6 A;  1GO7 P;  1GE5 A;  1I1I P;  4AUO A;  2FV9 A;  1UTT A;  3LKA A;  1K7G A;  3N2V A;  2DW1 A;  3WV2 A;  2WOA A;  1PWV A;  2OW0 A;  3MA2 A;  1PWQ A;  1IAA A;  3RTT A;  1YQY A;  4L7A A;  1ZP5 A;  3DSL A;  4L63 A;  3F19 A;  3UVC A;  1QIC A;  1OM6 A;  5D1U A;  1HFC A;  4JP4 A;  1BKC I;  1QUA A;  5BOT A;  3WV1 A;  1SLN A;  3OHO A;  5I0L A;  2MLR A;  5CXA A;  4AXQ A;  2OY4 A;  2OVZ A;  1AKL A;  1BKC A;  1BSW A;  1EB6 A;  4H49 A;  1YP1 A;  2W0D A;  5I43 A;  2OW1 A;  1OS2 A;  1XFV A;  2L0R A;  5D7W A;  1I73 A;  5BOY A;  5LAB A;  1G4K A;  1B3D A;  1O0T A;  2DDF A;  3B8Z A;  4JPA A;  1R55 A;  2AYK A;  3KEJ A;  2O36 A;  1IAB A;  4DPE A;  966C A;  4FXQ A;  3TS4 A;  1JK3 A;  2SRT A;  3Q2H A;  1JH1 A;  1GKD A;  1MMQ A;  1J7N A;  4AYK A;  5D3C A;  3TSK A;  1Z3J A;  4H30 A;  4H76 A;  1IAE A;  3HY7 A;  3CKI A;  3N2U A;  4DV8 A;  3EDH A;  1PWP A;  2V4B A;  2DW0 A;  1C3I A;  2OW2 A;  5D1T A;  1OMJ A;  1BQO A;  3DNG A;  1EUB A;  1HY7 A;  2QPJ A;  2OY2 A;  1XFZ A;  4I35 A;  2MZI A;  5I12 A;  4PKQ A;  2JT5 A;  4WKE A;  3L0V A;  4GR3 A;  1G05 A;  4G0D A;  3LQ0 A;  1AF0 A;  3B92 A;  4WF6 A;  4CTH A;  1IAG A;  2JNP A;  1L6J A;  2OW9 A;  3P24 A;  4GUY A;  4H82 A;  3LJT A;  3HB2 P;  4A7B A;  1FM1 A;  1HOV A;  3HDB A;  1CAQ A;  4H1Q A;  2OXW A;  3DTI A;  1CGE A;  2X3A A;  4EFS A;  2OI0 A;  2RJQ A;  2OXU A;  1YOU A;  2XS4 A;  1QJI A;  4L6T A;  3LIR A;  5BPA A;  2OVX A;  4XCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...