1KUKA

Crystal structure of a taiwan habu venom metalloproteinase complexed with pekw.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
QRFPQRYIELAIVVDHGMYTKYSSNFKKIRKRVHQMVSNINEMCRPLNIAITLALLDVWSEKDFITVQADAPTTAGLFGDWRERVLLKKKNHDHAQLLTDTNFARNTIGWAYVGRMCDEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGMEHDDKDKCKCDTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metalloproteinase
publication title Determinants of the inhibition of a Taiwan habu venom metalloproteinase by its endogenous inhibitors revealed by X-ray crystallography and synthetic inhibitor analogues.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.44: Atrolysin E.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1kukA00
1PWQA 1BQQM 1HV5A 1SLNA 1DTHA 1BKCI 2CKIA 4XM6A 3EHXA 4DF9A 1O0TA 1K7GA 3HBVP 1A85A 1CIZA 1EAKA 1BZSA 830CA 1RMZA 4WF6A 1OS9A 2OW1A 2X3AA 4H1QA 1AF0A 3EDIA 2E2DA 3MA2A 4H30A 4J4MA 1ZXVA 3F16A 4GR3A 3LK8A 1JKYA 3GBOA 1SMPA 966CA 3LQBA 1G12A 1BUDA 2HU6A 4H76A 3KRYA 4GF1A 1USNA 1OM8A 1AKLA 1IAGA 1JJ9A 1HTDA 4HMAA 4AUOA 1QJIA 1Y93A 3TS4A 4L6TA 1CQRA 2Z2DA 3LILA 4EFSA 5I3MA 4XCTA 4ON1A 1HFSA 3G5CA 1BKCE 1JAQA 2J83A 1UEAA 3AYKA 1G05A 1MNCA 1D8MA 1KUHA 3NX7A 1UMSA 1YOUA 2OVZA 4Q1LA 3LGPA 2MLRA 1C7KA 1PWPA 3OHLA 1JIWP 1SRPA 1G9KA 4WK7A 1ZS0A 2OI0A 4PKWA 4PKVA 4A7BA 4G9LA 3AIGA 4WKIA 3LJGA 1XFWA 5I0LA 2XS3A 1HY7A 1GO8P 5CXAA 4PKTA 1K7IA 1YQYA 4WKEA 2OW9A 3B92A 1KUGA 2KRJA 3LJTA 2OXZA 3K7LA 1DMTA 3HY7A 2MLSA 3EHYA 3RTSA 1Z3JA 1XFYA 2N8RA 1K7QA 1UTZA 4L19A 1CGEA 2JIHA 1BIWA 3B2ZA 2OY4A 1ZP5A 1OMJA 2Y6CA 4FXQA 5D2BA 1FBLA 3HB2P 1H71P 2JT6A 1GKDA 3KEJA 3F18A 4H84A 3KHIA 4I35A 3L0TA 3N2UA 1JIZA 3P24A 1IAAA 2YB9A 1BKCA 1FM1A 4DV8A 4QKZA 2SRTA 1XFVA 1JK3A 1KBCA 1L6JA 5B5OA 3WV1A 1B8YA 4FVLA 1MMQA 3LUMA 3KWVC 1I73A 3B8ZA 3TSKA 1ASTA 1MMBA 3LJZA 2POJA 4AYKA 3OHOA 2MZEA 2DDFA 5D1UA 3P1VA 3EDGA 1ND1A 1C8TA 1MMPA 2ERQA 2DDYA 3HY9A 3LKAA 1AYKA 1CK7A 1JH1A 3KECA 1XUCA 1KUFA 2QPJA 1J7NA 1GE5A 5BPAA 2DW0A 2O36A 1FLSA 1ZTQA 1UMTA 2D1NA 1CAQA 5CZMA 1R55A 2RJQA 5I12A 3BA0A 1SU3A 1GO7P 4PKUA 3VI1A 4IN9A 1GKCA 3SHIA 1MMRA 4GR8A 1IAEA 1XFUA 3LIKA 1Q3AA 2OVXA 456CA 2E3XA 5L79A 4H49A 3ZUKA 3KMEA 1QIAA 2OZRA 3DSLA 1R54A 3HYGA 3HBUP 2O3EA 2X7MA 5D1SA 2CLTA 5CUHA 3ZVSA 4GWMA 4H2EA 4JP4A 3ELMA 4XM8A 3DPEA 5BOTA 2DW1A 1XFZA 3VTGA 4GWNA 1CXVA 4AXQA 3K7NA 2OW2A 2YIGA 1I1IP 3U1RA 4DPEA 1IADA 1Y0VA 4FXYP 1EUBA 3E8RA 3EWJA 1GXDA 1QUAA 3F15A 2AYKA 4JIJA 2OY2A 3WV2A 3EDHA 1Y8JA 2OXWA 4CTHA 3DNGA 2A8HA 1QICA 4A3WA 1EB6A 3HDBA 2WO8A 3I7IA 3DPFA 5LABA 3LUNA 3N2VA 5D1TA 5I2ZA 2JNPA 2MZIA 3F17A 3F1AA 4R3VA 1BQOA 4H3XA 4I03A 3DWBA 4JQGA 4JA1A 2I47A 4XM7A 3Q2GA 1KAPP 2FV9A 2WOAA 1D5JA 2OW0A 3TVCA 1CGFA 2JSDA 2K9CA 4G0DA 1OM6A 2W13A 2WO9A 2D1OA 1ATLA 1R1JA 3LMCA 4H82A 1RM8A 5H8XA 3V96B 1JAOA 1WNIA 1G4KA 3TT4A 3RTTA 3LQ0A 3AYUA 1QJJA 4HX3A 4AIGA 1HFCA 1XFXA 4JPAA 5B5PA 5D3CA 3ZXHA 1D8FA 2DW2A 1BUVM 3USNA 5D7WA 2W14A 2W15A 3O2XA 1B3DA 2OXUA 3KEKA 3LE9A 1R1HA 4IJOA 4GQLA 1SLMA 1ZVXA 1I76A 3F19A 5JMYA 5BOYA 1OS2A 4GUYA 2W12A 1XUDA 3UVCA 1GE7A 1JANA 4GR0A 1PWUA 1A86A 1C3IA 2J0TA 1KUKA 1BM6A 4PKRA 3EDZA 4WZVA 4ZR5A 3HDAP 2X3CA 1HOVA 1GE6A 1OM7A 1UTTA 2PJTA 3Q2HA 1IACA 1YP1A 1ROSA 3CKIA 4ILWD 2K2GA 3G42A 2Y6DA 3O64A 1SATA 4PKQA 2XS4A 1S4BP 3WV3A 1BSWA 5L7FA 1R1IA 2V4BA 4IUWA 1QIBA 3LEAA 4DD8A 1CGLA 1JAPA 3I7GA 1XURA 2X3BA 3DL1A 1G49A 1IABA 3L0VA 1D7XA 1YCMA 2USNA 1O0QA 3LIRA 2RJPA 5I43A 2L0RA 2MZHA 2FV5A 4XBHA 2TCLA 1PWWA 5I4OA 2W0DA 2EROA 4L63A 1PWVA 1OO9A 2ERPA 4PKSA 2AIGP 2JT5A 1KUIA 3KMCA 4FU4A 1ZXCA
chains in the Genus database with same CATH superfamily
4L7AA 1PWQA 1BQQM 1HV5A 1SLNA 1DTHA 1BKCI 2CKIA 4XM6A 3EHXA 4DF9A 1O0TA 1K7GA 3HBVP 1A85A 1CIZA 1EAKA 1BZSA 830CA 1RMZA 4WF6A 1OS9A 2OW1A 2X3AA 4H1QA 1AF0A 3EDIA 2E2DA 3MA2A 4H30A 4J4MA 1ZXVA 3F16A 4GR3A 3LK8A 1JKYA 3GBOA 1SMPA 966CA 3LQBA 1G12A 1BUDA 2HU6A 4H76A 3KRYA 4GF1A 1USNA 1OM8A 1AKLA 1IAGA 1JJ9A 1HTDA 4HMAA 4AUOA 1QJIA 1Y93A 3TS4A 4L6TA 1CQRA 2Z2DA 3LILA 4EFSA 5I3MA 4XCTA 4ON1A 1HFSA 3G5CA 1BKCE 1JAQA 2J83A 1UEAA 3AYKA 1G05A 1MNCA 1D8MA 1KUHA 3NX7A 1UMSA 1YOUA 2OVZA 4Q1LA 3LGPA 2MLRA 1C7KA 1PWPA 3OHLA 1JIWP 1SRPA 1G9KA 4WK7A 1ZS0A 2OI0A 4PKWA 4PKVA 4A7BA 4G9LA 3AIGA 4WKIA 3LJGA 1XFWA 5I0LA 2XS3A 1HY7A 1GO8P 5CXAA 4PKTA 1K7IA 1YQYA 4WKEA 2OW9A 3B92A 1KUGA 2KRJA 3LJTA 2OXZA 3K7LA 1DMTA 3HY7A 2MLSA 3EHYA 3RTSA 1Z3JA 1XFYA 2N8RA 1K7QA 1UTZA 4L19A 1CGEA 2JIHA 1BIWA 3B2ZA 2OY4A 1ZP5A 1OMJA 2Y6CA 4FXQA 5D2BA 1FBLA 3HB2P 1H71P 2JT6A 1GKDA 3KEJA 3F18A 4H84A 3KHIA 4I35A 3L0TA 3DTKA 3N2UA 1JIZA 3P24A 1IAAA 2YB9A 1BKCA 1FM1A 4DV8A 4QKZA 2SRTA 1XFVA 1JK3A 1KBCA 1L6JA 5B5OA 3WV1A 1B8YA 4FVLA 1MMQA 3LUMA 1TVIA 3KWVC 1I73A 3B8ZA 3TSKA 1ASTA 1MMBA 3LJZA 2POJA 4AYKA 3OHOA 2MZEA 2DDFA 5D1UA 3P1VA 3EDGA 1ND1A 1XM5A 1C8TA 1MMPA 2ERQA 2DDYA 3HY9A 3LKAA 1AYKA 1CK7A 3KECA 1JH1A 3DTIA 1XUCA 1KUFA 2QPJA 1J7NA 1GE5A 5BPAA 2DW0A 2O36A 1FLSA 1ZTQA 1UMTA 2D1NA 1CAQA 5CZMA 1R55A 2RJQA 5I12A 3BA0A 1SU3A 1GO7P 4PKUA 3VI1A 4IN9A 1GKCA 3SHIA 1MMRA 4GR8A 1IAEA 1XFUA 3LIKA 1Q3AA 2OVXA 456CA 2E3XA 5L79A 4H49A 3ZUKA 3KMEA 1QIAA 2OZRA 3DSLA 1R54A 3HYGA 3HBUP 2O3EA 2X7MA 5D1SA 2CLTA 5CUHA 3ZVSA 4GWMA 4H2EA 4JP4A 3ELMA 4XM8A 3DPEA 5BOTA 2DW1A 1XFZA 3VTGA 4GWNA 1CXVA 4AXQA 3K7NA 2OW2A 2YIGA 1I1IP 3U1RA 4DPEA 1IADA 1Y0VA 4FXYP 1EUBA 3E8RA 3EWJA 1GXDA 1QUAA 3F15A 2AYKA 4JIJA 2OY2A 3WV2A 3EDHA 1Y8JA 2OXWA 4CTHA 3DNGA 2A8HA 1QICA 4A3WA 1EB6A 3HDBA 2WO8A 3I7IA 3DPFA 5LABA 3LUNA 3N2VA 5D1TA 5I2ZA 2JNPA 2MZIA 3F17A 3F1AA 4R3VA 1BQOA 4H3XA 4I03A 3DWBA 4JQGA 4JA1A 2I47A 4XM7A 3Q2GA 1KAPP 2FV9A 2WOAA 1D5JA 2OW0A 3TVCA 1CGFA 2JSDA 2K9CA 4G0DA 1OM6A 2W13A 2WO9A 2D1OA 1ATLA 1R1JA 3LMCA 4H82A 1RM8A 5H8XA 3V96B 1JAOA 1WNIA 1G4KA 3TT4A 3RTTA 3LQ0A 3AYUA 1QJJA 4HX3A 4AIGA 1HFCA 1XFXA 4JPAA 5B5PA 5D3CA 3ZXHA 1D8FA 2DW2A 1BUVM 3USNA 5D7WA 2W14A 2YUFA 2W15A 3O2XA 1B3DA 2OXUA 3KEKA 3LE9A 1R1HA 4IJOA 4GQLA 1SLMA 1ZVXA 1I76A 3F19A 5JMYA 5BOYA 1OS2A 4GUYA 2W12A 1XUDA 3UVCA 1GE7A 1JANA 4GR0A 1PWUA 1A86A 1C3IA 2J0TA 1KUKA 1BM6A 4PKRA 3EDZA 4WZVA 4ZR5A 3HDAP 2X3CA 1HOVA 1GE6A 1OM7A 1OZ9A 1UTTA 2PJTA 3Q2HA 1IACA 1YP1A 1ROSA 1XAXA 3CKIA 4ILWD 2K2GA 3G42A 2Y6DA 3O64A 1SATA 4PKQA 2XS4A 1S4BP 3WV3A 1BSWA 3DTEA 5L7FA 1R1IA 2V4BA 4IUWA 1QIBA 3LEAA 4DD8A 1CGLA 1JAPA 3I7GA 1XURA 2X3BA 3DL1A 1G49A 1IABA 3L0VA 1D7XA 1YCMA 2USNA 1O0QA 3LIRA 2RJPA 5I43A 2L0RA 2MZHA 2FV5A 4XBHA 2TCLA 1PWWA 5I4OA 2W0DA 2EROA 4L63A 1PWVA 1OO9A 2ERPA 4PKSA 2AIGP 2JT5A 1KUIA 3KMCA 4FU4A 1ZXCA
chains in the Genus database with same CATH topology
4L7AA 1PWQA 1BQQM 1HV5A 1SLNA 1DTHA 1BKCI 2CKIA 4XM6A 3EHXA 4DF9A 1O0TA 1K7GA 3HBVP 1A85A 1CIZA 1EAKA 1BZSA 830CA 1RMZA 4WF6A 1OS9A 2OW1A 2X3AA 4H1QA 1AF0A 3EDIA 2E2DA 3MA2A 4H30A 4J4MA 1ZXVA 3F16A 4GR3A 3LK8A 1JKYA 3GBOA 1SMPA 966CA 3LQBA 1G12A 1BUDA 2HU6A 4H76A 3KRYA 4GF1A 1USNA 1OM8A 1AKLA 1IAGA 1JJ9A 1HTDA 4HMAA 4AUOA 1QJIA 1Y93A 3TS4A 4L6TA 1CQRA 2Z2DA 3LILA 4EFSA 5I3MA 4XCTA 4ON1A 1HFSA 3G5CA 1BKCE 1JAQA 2J83A 1UEAA 3AYKA 1G05A 1MNCA 1D8MA 1KUHA 3NX7A 1UMSA 1YOUA 2OVZA 4Q1LA 3LGPA 2MLRA 1C7KA 1PWPA 3OHLA 1JIWP 1SRPA 1G9KA 4WK7A 1ZS0A 2OI0A 4PKWA 4PKVA 4A7BA 4G9LA 3AIGA 4WKIA 3LJGA 1XFWA 5I0LA 2XS3A 1HY7A 1GO8P 5CXAA 4PKTA 1K7IA 1YQYA 4WKEA 2OW9A 3B92A 1KUGA 2KRJA 3LJTA 2OXZA 3K7LA 1DMTA 3HY7A 2MLSA 3EHYA 3RTSA 1Z3JA 1XFYA 2N8RA 1K7QA 1UTZA 4L19A 1CGEA 2JIHA 1BIWA 3B2ZA 2OY4A 1ZP5A 1OMJA 2Y6CA 4FXQA 5D2BA 1FBLA 3HB2P 1H71P 2JT6A 1GKDA 3KEJA 3F18A 4H84A 3KHIA 4I35A 3L0TA 3DTKA 3N2UA 1JIZA 3P24A 1IAAA 2YB9A 1BKCA 1FM1A 4DV8A 4QKZA 2SRTA 1XFVA 1JK3A 1KBCA 1L6JA 5B5OA 3WV1A 1B8YA 4FVLA 1MMQA 3LUMA 3KWVC 1I73A 3B8ZA 3TSKA 1ASTA 1MMBA 3LJZA 2POJA 4AYKA 3OHOA 2MZEA 2DDFA 5D1UA 3P1VA 3EDGA 1ND1A 1C8TA 1MMPA 2ERQA 2DDYA 3HY9A 3LKAA 1AYKA 1CK7A 3KECA 1JH1A 3DTIA 1XUCA 1KUFA 2QPJA 1J7NA 1GE5A 5BPAA 2DW0A 2O36A 1FLSA 1ZTQA 1UMTA 2D1NA 1CAQA 5CZMA 1R55A 2RJQA 5I12A 3BA0A 1SU3A 1GO7P 4PKUA 3VI1A 4IN9A 1GKCA 3SHIA 1MMRA 4GR8A 1IAEA 1XFUA 3LIKA 1Q3AA 2OVXA 456CA 2E3XA 5L79A 4H49A 3ZUKA 3KMEA 1QIAA 2OZRA 3DSLA 1R54A 3HYGA 3HBUP 2O3EA 2X7MA 5D1SA 2CLTA 5CUHA 3ZVSA 4GWMA 4H2EA 4JP4A 3ELMA 4XM8A 3DPEA 5BOTA 2DW1A 1XFZA 3VTGA 4GWNA 1CXVA 4AXQA 3K7NA 2OW2A 2YIGA 1I1IP 3U1RA 4DPEA 1IADA 1Y0VA 4FXYP 1EUBA 3E8RA 3EWJA 1GXDA 1QUAA 3F15A 2AYKA 4JIJA 2OY2A 3WV2A 3EDHA 1Y8JA 2OXWA 4CTHA 3DNGA 2A8HA 1QICA 4A3WA 1EB6A 3HDBA 2WO8A 3I7IA 3DPFA 5LABA 3LUNA 3N2VA 5D1TA 5I2ZA 2JNPA 2MZIA 3F17A 3F1AA 4R3VA 1BQOA 4H3XA 4I03A 3DWBA 4JQGA 4JA1A 2I47A 4XM7A 3Q2GA 1KAPP 2FV9A 2WOAA 1D5JA 2OW0A 3TVCA 1CGFA 2JSDA 2K9CA 4G0DA 1OM6A 2W13A 2WO9A 2D1OA 1ATLA 1R1JA 3LMCA 4H82A 1RM8A 5H8XA 3V96B 1JAOA 1WNIA 1G4KA 3TT4A 3RTTA 3LQ0A 3AYUA 1QJJA 4HX3A 4AIGA 1HFCA 1XFXA 4JPAA 5B5PA 5D3CA 3ZXHA 1D8FA 2DW2A 1BUVM 3USNA 5D7WA 2W14A 2YUFA 2W15A 3O2XA 1B3DA 2OXUA 3KEKA 3LE9A 1R1HA 4IJOA 4GQLA 1SLMA 1ZVXA 1I76A 3F19A 5JMYA 5BOYA 1OS2A 4GUYA 2W12A 1XUDA 3UVCA 1GE7A 1JANA 4GR0A 1PWUA 1A86A 1C3IA 2J0TA 1KUKA 1BM6A 4PKRA 3EDZA 4WZVA 4ZR5A 3HDAP 2X3CA 1HOVA 1GE6A 1OM7A 1UTTA 2PJTA 3Q2HA 1IACA 1YP1A 1ROSA 3CKIA 4ILWD 2K2GA 3G42A 2Y6DA 3O64A 1SATA 4PKQA 2XS4A 1S4BP 3WV3A 1BSWA 3DTEA 5L7FA 1R1IA 2V4BA 4IUWA 1QIBA 3LEAA 4DD8A 1CGLA 1JAPA 3I7GA 1XURA 2X3BA 3DL1A 1G49A 1IABA 3L0VA 1D7XA 1YCMA 2USNA 1O0QA 3LIRA 2RJPA 5I43A 2L0RA 2MZHA 2FV5A 4XBHA 2TCLA 1PWWA 5I4OA 2W0DA 2EROA 4L63A 1PWVA 1OO9A 2ERPA 4PKSA 2AIGP 2JT5A 1KUIA 3KMCA 4FU4A 1ZXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWQ A;  1BQQ M;  1HV5 A;  1SLN A;  1DTH A;  1BKC I;  2CKI A;  4XM6 A;  3EHX A;  4DF9 A;  1O0T A;  1K7G A;  3HBV P;  1A85 A;  1CIZ A;  1EAK A;  1BZS A;  830C A;  1RMZ A;  4WF6 A;  1OS9 A;  2OW1 A;  2X3A A;  4H1Q A;  1AF0 A;  3EDI A;  2E2D A;  3MA2 A;  4H30 A;  4J4M A;  1ZXV A;  3F16 A;  4GR3 A;  3LK8 A;  1JKY A;  3GBO A;  1SMP A;  966C A;  3LQB A;  1G12 A;  1BUD A;  2HU6 A;  4H76 A;  3KRY A;  4GF1 A;  1USN A;  1OM8 A;  1AKL A;  1IAG A;  1JJ9 A;  1HTD A;  4HMA A;  4AUO A;  1QJI A;  1Y93 A;  3TS4 A;  4L6T A;  1CQR A;  2Z2D A;  3LIL A;  4EFS A;  5I3M A;  4XCT A;  4ON1 A;  1HFS A;  3G5C A;  1BKC E;  1JAQ A;  2J83 A;  1UEA A;  3AYK A;  1G05 A;  1MNC A;  1D8M A;  1KUH A;  3NX7 A;  1UMS A;  1YOU A;  2OVZ A;  4Q1L A;  3LGP A;  2MLR A;  1C7K A;  1PWP A;  3OHL A;  1JIW P;  1SRP A;  1G9K A;  4WK7 A;  1ZS0 A;  2OI0 A;  4PKW A;  4PKV A;  4A7B A;  4G9L A;  3AIG A;  4WKI A;  3LJG A;  1XFW A;  5I0L A;  2XS3 A;  1HY7 A;  1GO8 P;  5CXA A;  4PKT A;  1K7I A;  1YQY A;  4WKE A;  2OW9 A;  3B92 A;  1KUG A;  2KRJ A;  3LJT A;  2OXZ A;  3K7L A;  1DMT A;  3HY7 A;  2MLS A;  3EHY A;  3RTS A;  1Z3J A;  1XFY A;  2N8R A;  1K7Q A;  1UTZ A;  4L19 A;  1CGE A;  2JIH A;  1BIW A;  3B2Z A;  2OY4 A;  1ZP5 A;  1OMJ A;  2Y6C A;  4FXQ A;  5D2B A;  1FBL A;  3HB2 P;  1H71 P;  2JT6 A;  1GKD A;  3KEJ A;  3F18 A;  4H84 A;  3KHI A;  4I35 A;  3L0T A;  3N2U A;  1JIZ A;  3P24 A;  1IAA A;  2YB9 A;  1BKC A;  1FM1 A;  4DV8 A;  4QKZ A;  2SRT A;  1XFV A;  1JK3 A;  1KBC A;  1L6J A;  5B5O A;  3WV1 A;  1B8Y A;  4FVL A;  1MMQ A;  3LUM A;  3KWV C;  1I73 A;  3B8Z A;  3TSK A;  1AST A;  1MMB A;  3LJZ A;  2POJ A;  4AYK A;  3OHO A;  2MZE A;  2DDF A;  5D1U A;  3P1V A;  3EDG A;  1ND1 A;  1C8T A;  1MMP A;  2ERQ A;  2DDY A;  3HY9 A;  3LKA A;  1AYK A;  1CK7 A;  1JH1 A;  3KEC A;  1XUC A;  1KUF A;  2QPJ A;  1J7N A;  1GE5 A;  5BPA A;  2DW0 A;  2O36 A;  1FLS A;  1ZTQ A;  1UMT A;  2D1N A;  1CAQ A;  5CZM A;  1R55 A;  2RJQ A;  5I12 A;  3BA0 A;  1SU3 A;  1GO7 P;  4PKU A;  3VI1 A;  4IN9 A;  1GKC A;  3SHI A;  1MMR A;  4GR8 A;  1IAE A;  1XFU A;  3LIK A;  1Q3A A;  2OVX A;  456C A;  2E3X A;  5L79 A;  4H49 A;  3ZUK A;  3KME A;  1QIA A;  2OZR A;  3DSL A;  1R54 A;  3HYG A;  3HBU P;  2O3E A;  2X7M A;  5D1S A;  2CLT A;  5CUH A;  3ZVS A;  4GWM A;  4H2E A;  4JP4 A;  3ELM A;  4XM8 A;  3DPE A;  5BOT A;  2DW1 A;  1XFZ A;  3VTG A;  4GWN A;  1CXV A;  4AXQ A;  3K7N A;  2OW2 A;  2YIG A;  1I1I P;  3U1R A;  4DPE A;  1IAD A;  1Y0V A;  4FXY P;  1EUB A;  3E8R A;  3EWJ A;  1GXD A;  1QUA A;  3F15 A;  2AYK A;  4JIJ A;  2OY2 A;  3WV2 A;  3EDH A;  1Y8J A;  2OXW A;  4CTH A;  3DNG A;  2A8H A;  1QIC A;  4A3W A;  1EB6 A;  3HDB A;  2WO8 A;  3I7I A;  3DPF A;  5LAB A;  3LUN A;  3N2V A;  5D1T A;  5I2Z A;  2JNP A;  2MZI A;  3F17 A;  3F1A A;  4R3V A;  1BQO A;  4H3X A;  4I03 A;  3DWB A;  4JQG A;  4JA1 A;  2I47 A;  4XM7 A;  3Q2G A;  1KAP P;  2FV9 A;  2WOA A;  1D5J A;  2OW0 A;  3TVC A;  1CGF A;  2JSD A;  2K9C A;  4G0D A;  1OM6 A;  2W13 A;  2WO9 A;  2D1O A;  1ATL A;  1R1J A;  3LMC A;  4H82 A;  1RM8 A;  5H8X A;  3V96 B;  1JAO A;  1WNI A;  1G4K A;  3TT4 A;  3RTT A;  3LQ0 A;  3AYU A;  1QJJ A;  4HX3 A;  4AIG A;  1HFC A;  1XFX A;  4JPA A;  5B5P A;  5D3C A;  3ZXH A;  1D8F A;  2DW2 A;  1BUV M;  3USN A;  5D7W A;  2W14 A;  2W15 A;  3O2X A;  1B3D A;  2OXU A;  3KEK A;  3LE9 A;  1R1H A;  4IJO A;  4GQL A;  1SLM A;  1ZVX A;  1I76 A;  3F19 A;  5JMY A;  5BOY A;  1OS2 A;  4GUY A;  2W12 A;  1XUD A;  3UVC A;  1GE7 A;  1JAN A;  4GR0 A;  1PWU A;  1A86 A;  1C3I A;  2J0T A;  1KUK A;  1BM6 A;  4PKR A;  3EDZ A;  4WZV A;  4ZR5 A;  3HDA P;  2X3C A;  1HOV A;  1GE6 A;  1OM7 A;  1UTT A;  2PJT A;  3Q2H A;  1IAC A;  1YP1 A;  1ROS A;  3CKI A;  4ILW D;  2K2G A;  3G42 A;  2Y6D A;  3O64 A;  1SAT A;  4PKQ A;  2XS4 A;  1S4B P;  3WV3 A;  1BSW A;  5L7F A;  1R1I A;  2V4B A;  4IUW A;  1QIB A;  3LEA A;  4DD8 A;  1CGL A;  1JAP A;  3I7G A;  1XUR A;  2X3B A;  3DL1 A;  1G49 A;  1IAB A;  3L0V A;  1D7X A;  1YCM A;  2USN A;  1O0Q A;  3LIR A;  2RJP A;  5I43 A;  2L0R A;  2MZH A;  2FV5 A;  4XBH A;  2TCL A;  1PWW A;  5I4O A;  2W0D A;  2ERO A;  4L63 A;  1PWV A;  1OO9 A;  2ERP A;  4PKS A;  2AIG P;  2JT5 A;  1KUI A;  3KMC A;  4FU4 A;  1ZXC A; 
#chains in the Genus database with same CATH topology
 4L7A A;  1PWQ A;  1BQQ M;  1HV5 A;  1SLN A;  1DTH A;  1BKC I;  2CKI A;  4XM6 A;  3EHX A;  4DF9 A;  1O0T A;  1K7G A;  3HBV P;  1A85 A;  1CIZ A;  1EAK A;  1BZS A;  830C A;  1RMZ A;  4WF6 A;  1OS9 A;  2OW1 A;  2X3A A;  4H1Q A;  1AF0 A;  3EDI A;  2E2D A;  3MA2 A;  4H30 A;  4J4M A;  1ZXV A;  3F16 A;  4GR3 A;  3LK8 A;  1JKY A;  3GBO A;  1SMP A;  966C A;  3LQB A;  1G12 A;  1BUD A;  2HU6 A;  4H76 A;  3KRY A;  4GF1 A;  1USN A;  1OM8 A;  1AKL A;  1IAG A;  1JJ9 A;  1HTD A;  4HMA A;  4AUO A;  1QJI A;  1Y93 A;  3TS4 A;  4L6T A;  1CQR A;  2Z2D A;  3LIL A;  4EFS A;  5I3M A;  4XCT A;  4ON1 A;  1HFS A;  3G5C A;  1BKC E;  1JAQ A;  2J83 A;  1UEA A;  3AYK A;  1G05 A;  1MNC A;  1D8M A;  1KUH A;  3NX7 A;  1UMS A;  1YOU A;  2OVZ A;  4Q1L A;  3LGP A;  2MLR A;  1C7K A;  1PWP A;  3OHL A;  1JIW P;  1SRP A;  1G9K A;  4WK7 A;  1ZS0 A;  2OI0 A;  4PKW A;  4PKV A;  4A7B A;  4G9L A;  3AIG A;  4WKI A;  3LJG A;  1XFW A;  5I0L A;  2XS3 A;  1HY7 A;  1GO8 P;  5CXA A;  4PKT A;  1K7I A;  1YQY A;  4WKE A;  2OW9 A;  3B92 A;  1KUG A;  2KRJ A;  3LJT A;  2OXZ A;  3K7L A;  1DMT A;  3HY7 A;  2MLS A;  3EHY A;  3RTS A;  1Z3J A;  1XFY A;  2N8R A;  1K7Q A;  1UTZ A;  4L19 A;  1CGE A;  2JIH A;  1BIW A;  3B2Z A;  2OY4 A;  1ZP5 A;  1OMJ A;  2Y6C A;  4FXQ A;  5D2B A;  1FBL A;  3HB2 P;  1H71 P;  2JT6 A;  1GKD A;  3KEJ A;  3F18 A;  4H84 A;  3KHI A;  4I35 A;  3L0T A;  3DTK A;  3N2U A;  1JIZ A;  3P24 A;  1IAA A;  2YB9 A;  1BKC A;  1FM1 A;  4DV8 A;  4QKZ A;  2SRT A;  1XFV A;  1JK3 A;  1KBC A;  1L6J A;  5B5O A;  3WV1 A;  1B8Y A;  4FVL A;  1MMQ A;  3LUM A;  1TVI A;  3KWV C;  1I73 A;  3B8Z A;  3TSK A;  1AST A;  1MMB A;  3LJZ A;  2POJ A;  4AYK A;  3OHO A;  2MZE A;  2DDF A;  5D1U A;  3P1V A;  3EDG A;  1ND1 A;  1XM5 A;  1C8T A;  1MMP A;  2ERQ A;  2DDY A;  3HY9 A;  3LKA A;  1AYK A;  1CK7 A;  3KEC A;  1JH1 A;  3DTI A;  1XUC A;  1KUF A;  2QPJ A;  1J7N A;  1GE5 A;  5BPA A;  2DW0 A;  2O36 A;  1FLS A;  1ZTQ A;  1UMT A;  2D1N A;  1CAQ A;  5CZM A;  1R55 A;  2RJQ A;  5I12 A;  3BA0 A;  1SU3 A;  1GO7 P;  4PKU A;  3VI1 A;  4IN9 A;  1GKC A;  3SHI A;  1MMR A;  4GR8 A;  1IAE A;  1XFU A;  3LIK A;  1Q3A A;  2OVX A;  456C A;  2E3X A;  5L79 A;  4H49 A;  3ZUK A;  3KME A;  1QIA A;  2OZR A;  3DSL A;  1R54 A;  3HYG A;  3HBU P;  2O3E A;  2X7M A;  5D1S A;  2CLT A;  5CUH A;  3ZVS A;  4GWM A;  4H2E A;  4JP4 A;  3ELM A;  4XM8 A;  3DPE A;  5BOT A;  2DW1 A;  1XFZ A;  3VTG A;  4GWN A;  1CXV A;  4AXQ A;  3K7N A;  2OW2 A;  2YIG A;  1I1I P;  3U1R A;  4DPE A;  1IAD A;  1Y0V A;  4FXY P;  1EUB A;  3E8R A;  3EWJ A;  1GXD A;  1QUA A;  3F15 A;  2AYK A;  4JIJ A;  2OY2 A;  3WV2 A;  3EDH A;  1Y8J A;  2OXW A;  4CTH A;  3DNG A;  2A8H A;  1QIC A;  4A3W A;  1EB6 A;  3HDB A;  2WO8 A;  3I7I A;  3DPF A;  5LAB A;  3LUN A;  3N2V A;  5D1T A;  5I2Z A;  2JNP A;  2MZI A;  3F17 A;  3F1A A;  4R3V A;  1BQO A;  4H3X A;  4I03 A;  3DWB A;  4JQG A;  4JA1 A;  2I47 A;  4XM7 A;  3Q2G A;  1KAP P;  2FV9 A;  2WOA A;  1D5J A;  2OW0 A;  3TVC A;  1CGF A;  2JSD A;  2K9C A;  4G0D A;  1OM6 A;  2W13 A;  2WO9 A;  2D1O A;  1ATL A;  1R1J A;  3LMC A;  4H82 A;  1RM8 A;  5H8X A;  3V96 B;  1JAO A;  1WNI A;  1G4K A;  3TT4 A;  3RTT A;  3LQ0 A;  3AYU A;  1QJJ A;  4HX3 A;  4AIG A;  1HFC A;  1XFX A;  4JPA A;  5B5P A;  5D3C A;  3ZXH A;  1D8F A;  2DW2 A;  1BUV M;  3USN A;  5D7W A;  2W14 A;  2YUF A;  2W15 A;  3O2X A;  1B3D A;  2OXU A;  3KEK A;  3LE9 A;  1R1H A;  4IJO A;  4GQL A;  1SLM A;  1ZVX A;  1I76 A;  3F19 A;  5JMY A;  5BOY A;  1OS2 A;  4GUY A;  2W12 A;  1XUD A;  3UVC A;  1GE7 A;  1JAN A;  4GR0 A;  1PWU A;  1A86 A;  1C3I A;  2J0T A;  1KUK A;  1BM6 A;  4PKR A;  3EDZ A;  4WZV A;  4ZR5 A;  3HDA P;  2X3C A;  1HOV A;  1GE6 A;  1OM7 A;  1OZ9 A;  1UTT A;  2PJT A;  3Q2H A;  1IAC A;  1YP1 A;  1ROS A;  1XAX A;  3CKI A;  4ILW D;  2K2G A;  3G42 A;  2Y6D A;  3O64 A;  1SAT A;  4PKQ A;  2XS4 A;  1S4B P;  3WV3 A;  1BSW A;  3DTE A;  5L7F A;  1R1I A;  2V4B A;  4IUW A;  1QIB A;  3LEA A;  4DD8 A;  1CGL A;  1JAP A;  3I7G A;  1XUR A;  2X3B A;  3DL1 A;  1G49 A;  1IAB A;  3L0V A;  1D7X A;  1YCM A;  2USN A;  1O0Q A;  3LIR A;  2RJP A;  5I43 A;  2L0R A;  2MZH A;  2FV5 A;  4XBH A;  2TCL A;  1PWW A;  5I4O A;  2W0D A;  2ERO A;  4L63 A;  1PWV A;  1OO9 A;  2ERP A;  4PKS A;  2AIG P;  2JT5 A;  1KUI A;  3KMC A;  4FU4 A;  1ZXC A; 
#chains in the Genus database with same CATH homology
 4L7A A;  1PWQ A;  1BQQ M;  1HV5 A;  1SLN A;  1DTH A;  1BKC I;  2CKI A;  4XM6 A;  3EHX A;  4DF9 A;  1O0T A;  1K7G A;  3HBV P;  1A85 A;  1CIZ A;  1EAK A;  1BZS A;  830C A;  1RMZ A;  4WF6 A;  1OS9 A;  2OW1 A;  2X3A A;  4H1Q A;  1AF0 A;  3EDI A;  2E2D A;  3MA2 A;  4H30 A;  4J4M A;  1ZXV A;  3F16 A;  4GR3 A;  3LK8 A;  1JKY A;  3GBO A;  1SMP A;  966C A;  3LQB A;  1G12 A;  1BUD A;  2HU6 A;  4H76 A;  3KRY A;  4GF1 A;  1USN A;  1OM8 A;  1AKL A;  1IAG A;  1JJ9 A;  1HTD A;  4HMA A;  4AUO A;  1QJI A;  1Y93 A;  3TS4 A;  4L6T A;  1CQR A;  2Z2D A;  3LIL A;  4EFS A;  5I3M A;  4XCT A;  4ON1 A;  1HFS A;  3G5C A;  1BKC E;  1JAQ A;  2J83 A;  1UEA A;  3AYK A;  1G05 A;  1MNC A;  1D8M A;  1KUH A;  3NX7 A;  1UMS A;  1YOU A;  2OVZ A;  4Q1L A;  3LGP A;  2MLR A;  1C7K A;  1PWP A;  3OHL A;  1JIW P;  1SRP A;  1G9K A;  4WK7 A;  1ZS0 A;  2OI0 A;  4PKW A;  4PKV A;  4A7B A;  4G9L A;  3AIG A;  4WKI A;  3LJG A;  1XFW A;  5I0L A;  2XS3 A;  1HY7 A;  1GO8 P;  5CXA A;  4PKT A;  1K7I A;  1YQY A;  4WKE A;  2OW9 A;  3B92 A;  1KUG A;  2KRJ A;  3LJT A;  2OXZ A;  3K7L A;  1DMT A;  3HY7 A;  2MLS A;  3EHY A;  3RTS A;  1Z3J A;  1XFY A;  2N8R A;  1K7Q A;  1UTZ A;  4L19 A;  1CGE A;  2JIH A;  1BIW A;  3B2Z A;  2OY4 A;  1ZP5 A;  1OMJ A;  2Y6C A;  4FXQ A;  5D2B A;  1FBL A;  3HB2 P;  1H71 P;  2JT6 A;  1GKD A;  3KEJ A;  3F18 A;  4H84 A;  3KHI A;  4I35 A;  3L0T A;  3DTK A;  3N2U A;  1JIZ A;  3P24 A;  1IAA A;  2YB9 A;  1BKC A;  1FM1 A;  4DV8 A;  4QKZ A;  2SRT A;  1XFV A;  1JK3 A;  1KBC A;  1L6J A;  5B5O A;  3WV1 A;  1B8Y A;  4FVL A;  1MMQ A;  3LUM A;  3KWV C;  1I73 A;  3B8Z A;  3TSK A;  1AST A;  1MMB A;  3LJZ A;  2POJ A;  4AYK A;  3OHO A;  2MZE A;  2DDF A;  5D1U A;  3P1V A;  3EDG A;  1ND1 A;  1C8T A;  1MMP A;  2ERQ A;  2DDY A;  3HY9 A;  3LKA A;  1AYK A;  1CK7 A;  3KEC A;  1JH1 A;  3DTI A;  1XUC A;  1KUF A;  2QPJ A;  1J7N A;  1GE5 A;  5BPA A;  2DW0 A;  2O36 A;  1FLS A;  1ZTQ A;  1UMT A;  2D1N A;  1CAQ A;  5CZM A;  1R55 A;  2RJQ A;  5I12 A;  3BA0 A;  1SU3 A;  1GO7 P;  4PKU A;  3VI1 A;  4IN9 A;  1GKC A;  3SHI A;  1MMR A;  4GR8 A;  1IAE A;  1XFU A;  3LIK A;  1Q3A A;  2OVX A;  456C A;  2E3X A;  5L79 A;  4H49 A;  3ZUK A;  3KME A;  1QIA A;  2OZR A;  3DSL A;  1R54 A;  3HYG A;  3HBU P;  2O3E A;  2X7M A;  5D1S A;  2CLT A;  5CUH A;  3ZVS A;  4GWM A;  4H2E A;  4JP4 A;  3ELM A;  4XM8 A;  3DPE A;  5BOT A;  2DW1 A;  1XFZ A;  3VTG A;  4GWN A;  1CXV A;  4AXQ A;  3K7N A;  2OW2 A;  2YIG A;  1I1I P;  3U1R A;  4DPE A;  1IAD A;  1Y0V A;  4FXY P;  1EUB A;  3E8R A;  3EWJ A;  1GXD A;  1QUA A;  3F15 A;  2AYK A;  4JIJ A;  2OY2 A;  3WV2 A;  3EDH A;  1Y8J A;  2OXW A;  4CTH A;  3DNG A;  2A8H A;  1QIC A;  4A3W A;  1EB6 A;  3HDB A;  2WO8 A;  3I7I A;  3DPF A;  5LAB A;  3LUN A;  3N2V A;  5D1T A;  5I2Z A;  2JNP A;  2MZI A;  3F17 A;  3F1A A;  4R3V A;  1BQO A;  4H3X A;  4I03 A;  3DWB A;  4JQG A;  4JA1 A;  2I47 A;  4XM7 A;  3Q2G A;  1KAP P;  2FV9 A;  2WOA A;  1D5J A;  2OW0 A;  3TVC A;  1CGF A;  2JSD A;  2K9C A;  4G0D A;  1OM6 A;  2W13 A;  2WO9 A;  2D1O A;  1ATL A;  1R1J A;  3LMC A;  4H82 A;  1RM8 A;  5H8X A;  3V96 B;  1JAO A;  1WNI A;  1G4K A;  3TT4 A;  3RTT A;  3LQ0 A;  3AYU A;  1QJJ A;  4HX3 A;  4AIG A;  1HFC A;  1XFX A;  4JPA A;  5B5P A;  5D3C A;  3ZXH A;  1D8F A;  2DW2 A;  1BUV M;  3USN A;  5D7W A;  2W14 A;  2YUF A;  2W15 A;  3O2X A;  1B3D A;  2OXU A;  3KEK A;  3LE9 A;  1R1H A;  4IJO A;  4GQL A;  1SLM A;  1ZVX A;  1I76 A;  3F19 A;  5JMY A;  5BOY A;  1OS2 A;  4GUY A;  2W12 A;  1XUD A;  3UVC A;  1GE7 A;  1JAN A;  4GR0 A;  1PWU A;  1A86 A;  1C3I A;  2J0T A;  1KUK A;  1BM6 A;  4PKR A;  3EDZ A;  4WZV A;  4ZR5 A;  3HDA P;  2X3C A;  1HOV A;  1GE6 A;  1OM7 A;  1UTT A;  2PJT A;  3Q2H A;  1IAC A;  1YP1 A;  1ROS A;  3CKI A;  4ILW D;  2K2G A;  3G42 A;  2Y6D A;  3O64 A;  1SAT A;  4PKQ A;  2XS4 A;  1S4B P;  3WV3 A;  1BSW A;  3DTE A;  5L7F A;  1R1I A;  2V4B A;  4IUW A;  1QIB A;  3LEA A;  4DD8 A;  1CGL A;  1JAP A;  3I7G A;  1XUR A;  2X3B A;  3DL1 A;  1G49 A;  1IAB A;  3L0V A;  1D7X A;  1YCM A;  2USN A;  1O0Q A;  3LIR A;  2RJP A;  5I43 A;  2L0R A;  2MZH A;  2FV5 A;  4XBH A;  2TCL A;  1PWW A;  5I4O A;  2W0D A;  2ERO A;  4L63 A;  1PWV A;  1OO9 A;  2ERP A;  4PKS A;  2AIG P;  2JT5 A;  1KUI A;  3KMC A;  4FU4 A;  1ZXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...