1KUKA

Crystal structure of a taiwan habu venom metalloproteinase complexed with pekw.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
b'QRFPQRYIELAIVVDHGMYTKYSSNFKKIRKRVHQMVSNINEMCRPLNIAITLALLDVWSEKDFITVQADAPTTAGLFGDWRERVLLKKKNHDHAQLLTDTNFARNTIGWAYVGRMCDEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGMEHDDKDKCKCDTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metalloproteinase
publication title Determinants of the inhibition of a Taiwan habu venom metalloproteinase by its endogenous inhibitors revealed by X-ray crystallography and synthetic inhibitor analogues.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.44: Atrolysin E.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1kukA00
1BKCI 3WV1A 2QPJA 1G9KA 4GR0A 1USNA 1KUIA 1HFSA 3P1VA 3HY7A 3HYGA 3EDHA 1UEAA 4IUWA 4H76A 1ZVXA 1FBLA 2W14A 1ROSA 1CK7A 4AXQA 5D3CA 3V96B 2O3EA 4GWMA 2MLRA 3K7NA 2W0DA 3LILA 3USNA 4AUOA 4H49A 1D5JA 1GE6A 1I73A 5BOYA 4GR3A 830CA 3KEKA 1MNCA 1UTTA 1PWWA 4FVLA 3B8ZA 1XFWA 3EWJA 2JT5A 5LABA 3N2VA 5D7WA 2OI0A 1ZTQA 1HV5A 4JA1A 1BSWA 4JIJA 3LIKA 2D1OA 3TSKA 1C7KA 1BIWA 1ND1A 4PKSA 1GKCA 1SRPA 1MMBA 4H3XA 1ZS0A 2SRTA 3SHIA 4PKUA 1YP1A 1G4KA 2DDYA 3LIRA 4JP4A 3Q2GA 4XCTA 1MMPA 3F18A 1AKLA 2AIGP 3DNGA 3KECA 4I03A 4A3WA 3AIGA 1ZXCA 3LJTA 4L63A 1IAGA 1I1IP 3TS4A 2USNA 2E3XA 4FU4A 1Q3AA 3U1RA 1K7QA 5I12A 3KHIA 1Y8JA 1XURA 4WKIA 5I3MA 2XS4A 4FXYP 5L79A 2DDFA 1EB6A 1EAKA 5CXAA 5I43A 5CZMA 1RM8A 3GBOA 2MZIA 4H82A 4PKTA 2I47A 1DTHA 1OM7A 1MMQA 1KUGA 3AYKA 4XM6A 5D1SA 2X3AA 1QIBA 2CKIA 3LQ0A 3P24A 1D8FA 1JK3A 1JH1A 2W15A 2K2GA 3F17A 3G5CA 4FXQA 4IJOA 4PKWA 1I76A 2N8RA 3G42A 2JT6A 1CIZA 3KMEA 3RTSA 1L6JA 4HX3A 2AYKA 1H71P 1YOUA 4I35A 3HY9A 3F15A 3K7LA 1PWPA 3LJZA 1JANA 2OXZA 3OHLA 1GKDA 5H8XA 2W13A 3KWVC 2K9CA 2JSDA 1PWVA 1GO8P 5I0LA 1EUBA 2JNPA 5B5PA 4L6TA 2OW1A 1GXDA 5BPAA 1UMSA 3B2ZA 3WV3A 5D1UA 2ERPA 3HBUP 2W12A 4ON1A 3HDBA 3EDZA 1KAPP 1R1IA 1BQOA 1XFZA 3EDIA 2Y6CA 2OXUA 3B92A 3L0TA 4R3VA 1QJJA 2JIHA 3Q2HA 2OXWA 1O0QA 2OW9A 3LJGA 1CGFA 1IAEA 2POJA 1BQQM 3F1AA 4G9LA 456CA 1FM1A 2YIGA 4DV8A 1ZP5A 1Y93A 3EHYA 1A86A 3NX7A 1K7IA 1ATLA 1BKCE 2L0RA 4WF6A 5L7FA 1XUCA 2Z2DA 1IAAA 1G12A 2WO8A 2EROA 4ILWD 1JJ9A 2WO9A 3O2XA 1JIZA 2WOAA 3N2UA 2DW1A 1GO7P 1D7XA 1XUDA 2V4BA 1XFYA 4PKQA 1QUAA 2OW2A 1JKYA 3TVCA 3I7GA 1S4BP 3KRYA 3LK8A 1XFXA 3BA0A 3LUNA 1BM6A 4AIGA 2DW0A 2X3CA 1QIAA 4XM8A 2TCLA 1JAQA 966CA 1CQRA 4XM7A 1C8TA 1BUVM 1Z3JA 1OS9A 3ZUKA 2D1NA 1SLNA 1OMJA 3DWBA 1R1HA 1BKCA 3WV2A 3LKAA 3F16A 3DL1A 1XFVA 2YB9A 5B5OA 4WZVA 2RJPA 3KMCA 1SMPA 3MA2A 1KUFA 4GUYA 4H1QA 1OO9A 4H30A 1IADA 4EFSA 4PKRA 1KUHA 3LE9A 2XS3A 1CXVA 2J0TA 1AF0A 3HB2P 5D1TA 1JAPA 1CGEA 2OY4A 3ZXHA 1HTDA 1ASTA 1KUKA 1CGLA 2PJTA 4IN9A 3DPFA 1QJIA 1IACA 1DMTA 1SATA 2X3BA 2OVZA 2CLTA 2MZEA 3UVCA 1G05A 1IABA 4HMAA 1O0TA 4PKVA 4WK7A 3LMCA 1ZXVA 4ZR5A 5BOTA 2HU6A 2ERQA 1HFCA 2OW0A 4CTHA 4GF1A 3HDAP 4AYKA 2J83A 1JIWP 1UMTA 3E8RA 3CKIA 2O36A 3I7IA 1OM6A 1SLMA 2FV5A 2A8HA 1FLSA 3VI1A 4QKZA 3DPEA 1J7NA 1JAOA 3LUMA 1GE7A 1RMZA 1B8YA 1YQYA 2FV9A 3EHXA 4G0DA 4DF9A 1R1JA 1Y0VA 3HBVP 4L19A 4DPEA 3O64A 1AYKA 3KEJA 1BUDA 1PWUA 1PWQA 4H84A 1XFUA 3F19A 3LGPA 3RTTA 1GE5A 1R54A 1KBCA 1YCMA 1B3DA 2OVXA 1G49A 3TT4A 1HY7A 2DW2A 3LQBA 3ELMA 1A85A 1R55A 3OHOA 4JQGA 1D8MA 1OM8A 1SU3A 5D2BA 1BZSA 4Q1LA 1CAQA 2E2DA 3DSLA 4GWNA 4XBHA 1C3IA 1QICA 1OS2A 4GR8A 2Y6DA 1UTZA 4JPAA 2MLSA 2OZRA 3L0VA 1K7GA 5JMYA 4A7BA 3ZVSA 2X7MA 5I4OA 4H2EA 3AYUA 1MMRA 3LEAA 2RJQA 4J4MA 5I2ZA 3VTGA 1HOVA 1WNIA 2MZHA 5CUHA 4GQLA 2KRJA 3EDGA 4DD8A 2OY2A 4WKEA
chains in the Genus database with same CATH superfamily
1BKCI 3WV1A 2QPJA 1G9KA 4GR0A 1USNA 1KUIA 1HFSA 3P1VA 3HY7A 3HYGA 3EDHA 1UEAA 4IUWA 2YUFA 4H76A 1ZVXA 1FBLA 2W14A 1ROSA 1CK7A 4AXQA 5D3CA 3V96B 2O3EA 4GWMA 2MLRA 3K7NA 2W0DA 3LILA 3USNA 4AUOA 4H49A 1D5JA 1GE6A 1I73A 5BOYA 4GR3A 830CA 3KEKA 1MNCA 1UTTA 1PWWA 4FVLA 3B8ZA 1XFWA 3EWJA 2JT5A 5LABA 3N2VA 5D7WA 2OI0A 1ZTQA 1HV5A 4JA1A 1BSWA 4JIJA 3LIKA 2D1OA 3TSKA 1C7KA 1BIWA 1ND1A 4PKSA 1GKCA 1SRPA 1MMBA 4H3XA 1ZS0A 2SRTA 3SHIA 4PKUA 1YP1A 1G4KA 2DDYA 3LIRA 4JP4A 3Q2GA 4XCTA 1MMPA 3F18A 1AKLA 2AIGP 3DNGA 3KECA 4I03A 4A3WA 3AIGA 1ZXCA 1XAXA 3LJTA 4L63A 1IAGA 1I1IP 3TS4A 2USNA 2E3XA 4FU4A 1Q3AA 3U1RA 1K7QA 5I12A 3KHIA 1Y8JA 1XURA 4WKIA 5I3MA 2XS4A 4FXYP 5L79A 2DDFA 1EB6A 1EAKA 5CXAA 5I43A 5CZMA 1OZ9A 1RM8A 3GBOA 2MZIA 4H82A 4PKTA 2I47A 1DTHA 1OM7A 1MMQA 1KUGA 3AYKA 4XM6A 5D1SA 2X3AA 1QIBA 2CKIA 3LQ0A 3P24A 1D8FA 1JK3A 1JH1A 2W15A 2K2GA 3F17A 3G5CA 4FXQA 4IJOA 4PKWA 3DTIA 1I76A 2N8RA 3G42A 2JT6A 1CIZA 3KMEA 3RTSA 1L6JA 4HX3A 2AYKA 1H71P 1YOUA 4I35A 3HY9A 3F15A 3K7LA 1PWPA 3LJZA 1JANA 2OXZA 3OHLA 1GKDA 5H8XA 2W13A 3KWVC 2K9CA 2JSDA 1PWVA 1GO8P 1TVIA 5I0LA 1EUBA 2JNPA 5B5PA 4L6TA 2OW1A 1GXDA 5BPAA 1UMSA 3B2ZA 3WV3A 5D1UA 2ERPA 3HBUP 2W12A 4ON1A 3HDBA 3EDZA 1KAPP 1R1IA 1BQOA 1XFZA 3EDIA 2Y6CA 2OXUA 3B92A 3L0TA 4R3VA 1QJJA 2JIHA 3Q2HA 2OXWA 1O0QA 2OW9A 3LJGA 1CGFA 1IAEA 2POJA 1BQQM 3F1AA 4G9LA 456CA 1FM1A 2YIGA 4DV8A 1ZP5A 1Y93A 3EHYA 1A86A 3NX7A 1K7IA 1ATLA 1BKCE 3DTKA 2L0RA 4WF6A 5L7FA 1XUCA 2Z2DA 1IAAA 1G12A 2WO8A 2EROA 4ILWD 1JJ9A 2WO9A 3O2XA 1JIZA 1XM5A 2WOAA 3N2UA 2DW1A 1GO7P 1D7XA 1XUDA 2V4BA 1XFYA 4PKQA 1QUAA 2OW2A 1JKYA 3TVCA 3I7GA 1S4BP 3KRYA 3DTEA 3LK8A 1XFXA 3BA0A 3LUNA 1BM6A 4AIGA 2DW0A 2X3CA 1QIAA 4XM8A 2TCLA 1JAQA 966CA 1CQRA 4XM7A 1C8TA 1BUVM 1Z3JA 1OS9A 3ZUKA 2D1NA 1SLNA 1OMJA 3DWBA 1R1HA 1BKCA 3WV2A 3LKAA 3F16A 3DL1A 1XFVA 2YB9A 5B5OA 4WZVA 2RJPA 3KMCA 1SMPA 3MA2A 1KUFA 4GUYA 4H1QA 1OO9A 4H30A 1IADA 4EFSA 4PKRA 1KUHA 3LE9A 2XS3A 1CXVA 2J0TA 1AF0A 3HB2P 5D1TA 1JAPA 1CGEA 2OY4A 3ZXHA 1HTDA 1ASTA 1KUKA 1CGLA 2PJTA 4IN9A 3DPFA 1QJIA 1IACA 4L7AA 1DMTA 1SATA 2X3BA 2OVZA 2CLTA 2MZEA 3UVCA 1G05A 1IABA 4HMAA 1O0TA 4PKVA 4WK7A 3LMCA 1ZXVA 4ZR5A 5BOTA 2HU6A 2ERQA 1HFCA 2OW0A 4CTHA 4GF1A 3HDAP 4AYKA 2J83A 1JIWP 1UMTA 3E8RA 3CKIA 2O36A 3I7IA 1OM6A 1SLMA 2FV5A 2A8HA 1FLSA 3VI1A 4QKZA 3DPEA 1J7NA 1JAOA 3LUMA 1GE7A 1RMZA 1B8YA 1YQYA 2FV9A 3EHXA 4G0DA 4DF9A 1R1JA 1Y0VA 3HBVP 4L19A 4DPEA 3O64A 1AYKA 3KEJA 1BUDA 1PWUA 1PWQA 4H84A 1XFUA 3F19A 3LGPA 3RTTA 1GE5A 1R54A 1KBCA 1YCMA 1B3DA 2OVXA 1G49A 3TT4A 1HY7A 2DW2A 3LQBA 3ELMA 1A85A 1R55A 3OHOA 4JQGA 1D8MA 1OM8A 1SU3A 5D2BA 1BZSA 4Q1LA 1CAQA 2E2DA 3DSLA 4GWNA 4XBHA 1C3IA 1QICA 1OS2A 4GR8A 2Y6DA 1UTZA 4JPAA 2MLSA 2OZRA 3L0VA 1K7GA 5JMYA 4A7BA 3ZVSA 2X7MA 5I4OA 4H2EA 3AYUA 1MMRA 3LEAA 2RJQA 4J4MA 5I2ZA 3VTGA 1HOVA 1WNIA 2MZHA 5CUHA 4GQLA 2KRJA 3EDGA 4DD8A 2OY2A 4WKEA
chains in the Genus database with same CATH topology
1BKCI 3WV1A 2QPJA 1G9KA 4GR0A 1USNA 1KUIA 1HFSA 3P1VA 3HY7A 3HYGA 3EDHA 1UEAA 4IUWA 2YUFA 4H76A 1ZVXA 1FBLA 2W14A 1ROSA 1CK7A 4AXQA 5D3CA 3V96B 2O3EA 4GWMA 2MLRA 3K7NA 2W0DA 3LILA 3USNA 4AUOA 4H49A 1D5JA 1GE6A 1I73A 5BOYA 4GR3A 830CA 3KEKA 1MNCA 1UTTA 1PWWA 4FVLA 3B8ZA 1XFWA 3EWJA 2JT5A 5LABA 3N2VA 5D7WA 2OI0A 1ZTQA 1HV5A 4JA1A 1BSWA 4JIJA 3LIKA 2D1OA 3TSKA 1C7KA 1BIWA 1ND1A 4PKSA 1GKCA 1SRPA 1MMBA 4H3XA 1ZS0A 2SRTA 3SHIA 4PKUA 1YP1A 1G4KA 2DDYA 3LIRA 4JP4A 3Q2GA 4XCTA 1MMPA 3F18A 1AKLA 2AIGP 3DNGA 3KECA 4I03A 4A3WA 3AIGA 1ZXCA 3LJTA 4L63A 1IAGA 1I1IP 3TS4A 2USNA 2E3XA 4FU4A 1Q3AA 3U1RA 1K7QA 5I12A 3KHIA 1Y8JA 1XURA 4WKIA 5I3MA 2XS4A 4FXYP 5L79A 2DDFA 1EB6A 1EAKA 5CXAA 5I43A 5CZMA 1RM8A 3GBOA 2MZIA 4H82A 4PKTA 2I47A 1DTHA 1OM7A 1MMQA 1KUGA 3AYKA 4XM6A 5D1SA 2X3AA 1QIBA 2CKIA 3LQ0A 3P24A 1D8FA 1JK3A 1JH1A 2W15A 2K2GA 3F17A 3G5CA 4FXQA 4IJOA 4PKWA 3DTIA 1I76A 2N8RA 3G42A 2JT6A 1CIZA 3KMEA 3RTSA 1L6JA 4HX3A 2AYKA 1H71P 1YOUA 4I35A 3HY9A 3F15A 3K7LA 1PWPA 3LJZA 1JANA 2OXZA 3OHLA 1GKDA 5H8XA 2W13A 3KWVC 2K9CA 2JSDA 1PWVA 1GO8P 5I0LA 1EUBA 2JNPA 5B5PA 4L6TA 2OW1A 1GXDA 5BPAA 1UMSA 3B2ZA 3WV3A 5D1UA 2ERPA 3HBUP 2W12A 4ON1A 3HDBA 3EDZA 1KAPP 1R1IA 1BQOA 1XFZA 3EDIA 2Y6CA 2OXUA 3B92A 3L0TA 4R3VA 1QJJA 2JIHA 3Q2HA 2OXWA 1O0QA 2OW9A 3LJGA 1CGFA 1IAEA 2POJA 1BQQM 3F1AA 4G9LA 456CA 1FM1A 2YIGA 4DV8A 1ZP5A 1Y93A 3EHYA 1A86A 3NX7A 1K7IA 1ATLA 1BKCE 3DTKA 2L0RA 4WF6A 5L7FA 1XUCA 2Z2DA 1IAAA 1G12A 2WO8A 2EROA 4ILWD 1JJ9A 2WO9A 3O2XA 1JIZA 2WOAA 3N2UA 2DW1A 1GO7P 1D7XA 1XUDA 2V4BA 1XFYA 4PKQA 1QUAA 2OW2A 1JKYA 3TVCA 3I7GA 1S4BP 3KRYA 3DTEA 3LK8A 1XFXA 3BA0A 3LUNA 1BM6A 4AIGA 2DW0A 2X3CA 1QIAA 4XM8A 2TCLA 1JAQA 966CA 1CQRA 4XM7A 1C8TA 1BUVM 1Z3JA 1OS9A 3ZUKA 2D1NA 1SLNA 1OMJA 3DWBA 1R1HA 1BKCA 3WV2A 3LKAA 3F16A 3DL1A 1XFVA 2YB9A 5B5OA 4WZVA 2RJPA 3KMCA 1SMPA 3MA2A 1KUFA 4GUYA 4H1QA 1OO9A 4H30A 1IADA 4EFSA 4PKRA 1KUHA 3LE9A 2XS3A 1CXVA 2J0TA 1AF0A 3HB2P 5D1TA 1JAPA 1CGEA 2OY4A 3ZXHA 1HTDA 1ASTA 1KUKA 1CGLA 2PJTA 4IN9A 3DPFA 1QJIA 1IACA 4L7AA 1DMTA 1SATA 2X3BA 2OVZA 2CLTA 2MZEA 3UVCA 1G05A 1IABA 4HMAA 1O0TA 4PKVA 4WK7A 3LMCA 1ZXVA 4ZR5A 5BOTA 2HU6A 2ERQA 1HFCA 2OW0A 4CTHA 4GF1A 3HDAP 4AYKA 2J83A 1JIWP 1UMTA 3E8RA 3CKIA 2O36A 3I7IA 1OM6A 1SLMA 2FV5A 2A8HA 1FLSA 3VI1A 4QKZA 3DPEA 1J7NA 1JAOA 3LUMA 1GE7A 1RMZA 1B8YA 1YQYA 2FV9A 3EHXA 4G0DA 4DF9A 1R1JA 1Y0VA 3HBVP 4L19A 4DPEA 3O64A 1AYKA 3KEJA 1BUDA 1PWUA 1PWQA 4H84A 1XFUA 3F19A 3LGPA 3RTTA 1GE5A 1R54A 1KBCA 1YCMA 1B3DA 2OVXA 1G49A 3TT4A 1HY7A 2DW2A 3LQBA 3ELMA 1A85A 1R55A 3OHOA 4JQGA 1D8MA 1OM8A 1SU3A 5D2BA 1BZSA 4Q1LA 1CAQA 2E2DA 3DSLA 4GWNA 4XBHA 1C3IA 1QICA 1OS2A 4GR8A 2Y6DA 1UTZA 4JPAA 2MLSA 2OZRA 3L0VA 1K7GA 5JMYA 4A7BA 3ZVSA 2X7MA 5I4OA 4H2EA 3AYUA 1MMRA 3LEAA 2RJQA 4J4MA 5I2ZA 3VTGA 1HOVA 1WNIA 2MZHA 5CUHA 4GQLA 2KRJA 3EDGA 4DD8A 2OY2A 4WKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKC I;  3WV1 A;  2QPJ A;  1G9K A;  4GR0 A;  1USN A;  1KUI A;  1HFS A;  3P1V A;  3HY7 A;  3HYG A;  3EDH A;  1UEA A;  4IUW A;  4H76 A;  1ZVX A;  1FBL A;  2W14 A;  1ROS A;  1CK7 A;  4AXQ A;  5D3C A;  3V96 B;  2O3E A;  4GWM A;  2MLR A;  3K7N A;  2W0D A;  3LIL A;  3USN A;  4AUO A;  4H49 A;  1D5J A;  1GE6 A;  1I73 A;  5BOY A;  4GR3 A;  830C A;  3KEK A;  1MNC A;  1UTT A;  1PWW A;  4FVL A;  3B8Z A;  1XFW A;  3EWJ A;  2JT5 A;  5LAB A;  3N2V A;  5D7W A;  2OI0 A;  1ZTQ A;  1HV5 A;  4JA1 A;  1BSW A;  4JIJ A;  3LIK A;  2D1O A;  3TSK A;  1C7K A;  1BIW A;  1ND1 A;  4PKS A;  1GKC A;  1SRP A;  1MMB A;  4H3X A;  1ZS0 A;  2SRT A;  3SHI A;  4PKU A;  1YP1 A;  1G4K A;  2DDY A;  3LIR A;  4JP4 A;  3Q2G A;  4XCT A;  1MMP A;  3F18 A;  1AKL A;  2AIG P;  3DNG A;  3KEC A;  4I03 A;  4A3W A;  3AIG A;  1ZXC A;  3LJT A;  4L63 A;  1IAG A;  1I1I P;  3TS4 A;  2USN A;  2E3X A;  4FU4 A;  1Q3A A;  3U1R A;  1K7Q A;  5I12 A;  3KHI A;  1Y8J A;  1XUR A;  4WKI A;  5I3M A;  2XS4 A;  4FXY P;  5L79 A;  2DDF A;  1EB6 A;  1EAK A;  5CXA A;  5I43 A;  5CZM A;  1RM8 A;  3GBO A;  2MZI A;  4H82 A;  4PKT A;  2I47 A;  1DTH A;  1OM7 A;  1MMQ A;  1KUG A;  3AYK A;  4XM6 A;  5D1S A;  2X3A A;  1QIB A;  2CKI A;  3LQ0 A;  3P24 A;  1D8F A;  1JK3 A;  1JH1 A;  2W15 A;  2K2G A;  3F17 A;  3G5C A;  4FXQ A;  4IJO A;  4PKW A;  1I76 A;  2N8R A;  3G42 A;  2JT6 A;  1CIZ A;  3KME A;  3RTS A;  1L6J A;  4HX3 A;  2AYK A;  1H71 P;  1YOU A;  4I35 A;  3HY9 A;  3F15 A;  3K7L A;  1PWP A;  3LJZ A;  1JAN A;  2OXZ A;  3OHL A;  1GKD A;  5H8X A;  2W13 A;  3KWV C;  2K9C A;  2JSD A;  1PWV A;  1GO8 P;  5I0L A;  1EUB A;  2JNP A;  5B5P A;  4L6T A;  2OW1 A;  1GXD A;  5BPA A;  1UMS A;  3B2Z A;  3WV3 A;  5D1U A;  2ERP A;  3HBU P;  2W12 A;  4ON1 A;  3HDB A;  3EDZ A;  1KAP P;  1R1I A;  1BQO A;  1XFZ A;  3EDI A;  2Y6C A;  2OXU A;  3B92 A;  3L0T A;  4R3V A;  1QJJ A;  2JIH A;  3Q2H A;  2OXW A;  1O0Q A;  2OW9 A;  3LJG A;  1CGF A;  1IAE A;  2POJ A;  1BQQ M;  3F1A A;  4G9L A;  456C A;  1FM1 A;  2YIG A;  4DV8 A;  1ZP5 A;  1Y93 A;  3EHY A;  1A86 A;  3NX7 A;  1K7I A;  1ATL A;  1BKC E;  2L0R A;  4WF6 A;  5L7F A;  1XUC A;  2Z2D A;  1IAA A;  1G12 A;  2WO8 A;  2ERO A;  4ILW D;  1JJ9 A;  2WO9 A;  3O2X A;  1JIZ A;  2WOA A;  3N2U A;  2DW1 A;  1GO7 P;  1D7X A;  1XUD A;  2V4B A;  1XFY A;  4PKQ A;  1QUA A;  2OW2 A;  1JKY A;  3TVC A;  3I7G A;  1S4B P;  3KRY A;  3LK8 A;  1XFX A;  3BA0 A;  3LUN A;  1BM6 A;  4AIG A;  2DW0 A;  2X3C A;  1QIA A;  4XM8 A;  2TCL A;  1JAQ A;  966C A;  1CQR A;  4XM7 A;  1C8T A;  1BUV M;  1Z3J A;  1OS9 A;  3ZUK A;  2D1N A;  1SLN A;  1OMJ A;  3DWB A;  1R1H A;  1BKC A;  3WV2 A;  3LKA A;  3F16 A;  3DL1 A;  1XFV A;  2YB9 A;  5B5O A;  4WZV A;  2RJP A;  3KMC A;  1SMP A;  3MA2 A;  1KUF A;  4GUY A;  4H1Q A;  1OO9 A;  4H30 A;  1IAD A;  4EFS A;  4PKR A;  1KUH A;  3LE9 A;  2XS3 A;  1CXV A;  2J0T A;  1AF0 A;  3HB2 P;  5D1T A;  1JAP A;  1CGE A;  2OY4 A;  3ZXH A;  1HTD A;  1AST A;  1KUK A;  1CGL A;  2PJT A;  4IN9 A;  3DPF A;  1QJI A;  1IAC A;  1DMT A;  1SAT A;  2X3B A;  2OVZ A;  2CLT A;  2MZE A;  3UVC A;  1G05 A;  1IAB A;  4HMA A;  1O0T A;  4PKV A;  4WK7 A;  3LMC A;  1ZXV A;  4ZR5 A;  5BOT A;  2HU6 A;  2ERQ A;  1HFC A;  2OW0 A;  4CTH A;  4GF1 A;  3HDA P;  4AYK A;  2J83 A;  1JIW P;  1UMT A;  3E8R A;  3CKI A;  2O36 A;  3I7I A;  1OM6 A;  1SLM A;  2FV5 A;  2A8H A;  1FLS A;  3VI1 A;  4QKZ A;  3DPE A;  1J7N A;  1JAO A;  3LUM A;  1GE7 A;  1RMZ A;  1B8Y A;  1YQY A;  2FV9 A;  3EHX A;  4G0D A;  4DF9 A;  1R1J A;  1Y0V A;  3HBV P;  4L19 A;  4DPE A;  3O64 A;  1AYK A;  3KEJ A;  1BUD A;  1PWU A;  1PWQ A;  4H84 A;  1XFU A;  3F19 A;  3LGP A;  3RTT A;  1GE5 A;  1R54 A;  1KBC A;  1YCM A;  1B3D A;  2OVX A;  1G49 A;  3TT4 A;  1HY7 A;  2DW2 A;  3LQB A;  3ELM A;  1A85 A;  1R55 A;  3OHO A;  4JQG A;  1D8M A;  1OM8 A;  1SU3 A;  5D2B A;  1BZS A;  4Q1L A;  1CAQ A;  2E2D A;  3DSL A;  4GWN A;  4XBH A;  1C3I A;  1QIC A;  1OS2 A;  4GR8 A;  2Y6D A;  1UTZ A;  4JPA A;  2MLS A;  2OZR A;  3L0V A;  1K7G A;  5JMY A;  4A7B A;  3ZVS A;  2X7M A;  5I4O A;  4H2E A;  3AYU A;  1MMR A;  3LEA A;  2RJQ A;  4J4M A;  5I2Z A;  3VTG A;  1HOV A;  1WNI A;  2MZH A;  5CUH A;  4GQL A;  2KRJ A;  3EDG A;  4DD8 A;  2OY2 A;  4WKE A; 
#chains in the Genus database with same CATH topology
 1BKC I;  3WV1 A;  2QPJ A;  1G9K A;  4GR0 A;  1USN A;  1KUI A;  1HFS A;  3P1V A;  3HY7 A;  3HYG A;  3EDH A;  1UEA A;  4IUW A;  2YUF A;  4H76 A;  1ZVX A;  1FBL A;  2W14 A;  1ROS A;  1CK7 A;  4AXQ A;  5D3C A;  3V96 B;  2O3E A;  4GWM A;  2MLR A;  3K7N A;  2W0D A;  3LIL A;  3USN A;  4AUO A;  4H49 A;  1D5J A;  1GE6 A;  1I73 A;  5BOY A;  4GR3 A;  830C A;  3KEK A;  1MNC A;  1UTT A;  1PWW A;  4FVL A;  3B8Z A;  1XFW A;  3EWJ A;  2JT5 A;  5LAB A;  3N2V A;  5D7W A;  2OI0 A;  1ZTQ A;  1HV5 A;  4JA1 A;  1BSW A;  4JIJ A;  3LIK A;  2D1O A;  3TSK A;  1C7K A;  1BIW A;  1ND1 A;  4PKS A;  1GKC A;  1SRP A;  1MMB A;  4H3X A;  1ZS0 A;  2SRT A;  3SHI A;  4PKU A;  1YP1 A;  1G4K A;  2DDY A;  3LIR A;  4JP4 A;  3Q2G A;  4XCT A;  1MMP A;  3F18 A;  1AKL A;  2AIG P;  3DNG A;  3KEC A;  4I03 A;  4A3W A;  3AIG A;  1ZXC A;  1XAX A;  3LJT A;  4L63 A;  1IAG A;  1I1I P;  3TS4 A;  2USN A;  2E3X A;  4FU4 A;  1Q3A A;  3U1R A;  1K7Q A;  5I12 A;  3KHI A;  1Y8J A;  1XUR A;  4WKI A;  5I3M A;  2XS4 A;  4FXY P;  5L79 A;  2DDF A;  1EB6 A;  1EAK A;  5CXA A;  5I43 A;  5CZM A;  1OZ9 A;  1RM8 A;  3GBO A;  2MZI A;  4H82 A;  4PKT A;  2I47 A;  1DTH A;  1OM7 A;  1MMQ A;  1KUG A;  3AYK A;  4XM6 A;  5D1S A;  2X3A A;  1QIB A;  2CKI A;  3LQ0 A;  3P24 A;  1D8F A;  1JK3 A;  1JH1 A;  2W15 A;  2K2G A;  3F17 A;  3G5C A;  4FXQ A;  4IJO A;  4PKW A;  3DTI A;  1I76 A;  2N8R A;  3G42 A;  2JT6 A;  1CIZ A;  3KME A;  3RTS A;  1L6J A;  4HX3 A;  2AYK A;  1H71 P;  1YOU A;  4I35 A;  3HY9 A;  3F15 A;  3K7L A;  1PWP A;  3LJZ A;  1JAN A;  2OXZ A;  3OHL A;  1GKD A;  5H8X A;  2W13 A;  3KWV C;  2K9C A;  2JSD A;  1PWV A;  1GO8 P;  1TVI A;  5I0L A;  1EUB A;  2JNP A;  5B5P A;  4L6T A;  2OW1 A;  1GXD A;  5BPA A;  1UMS A;  3B2Z A;  3WV3 A;  5D1U A;  2ERP A;  3HBU P;  2W12 A;  4ON1 A;  3HDB A;  3EDZ A;  1KAP P;  1R1I A;  1BQO A;  1XFZ A;  3EDI A;  2Y6C A;  2OXU A;  3B92 A;  3L0T A;  4R3V A;  1QJJ A;  2JIH A;  3Q2H A;  2OXW A;  1O0Q A;  2OW9 A;  3LJG A;  1CGF A;  1IAE A;  2POJ A;  1BQQ M;  3F1A A;  4G9L A;  456C A;  1FM1 A;  2YIG A;  4DV8 A;  1ZP5 A;  1Y93 A;  3EHY A;  1A86 A;  3NX7 A;  1K7I A;  1ATL A;  1BKC E;  3DTK A;  2L0R A;  4WF6 A;  5L7F A;  1XUC A;  2Z2D A;  1IAA A;  1G12 A;  2WO8 A;  2ERO A;  4ILW D;  1JJ9 A;  2WO9 A;  3O2X A;  1JIZ A;  1XM5 A;  2WOA A;  3N2U A;  2DW1 A;  1GO7 P;  1D7X A;  1XUD A;  2V4B A;  1XFY A;  4PKQ A;  1QUA A;  2OW2 A;  1JKY A;  3TVC A;  3I7G A;  1S4B P;  3KRY A;  3DTE A;  3LK8 A;  1XFX A;  3BA0 A;  3LUN A;  1BM6 A;  4AIG A;  2DW0 A;  2X3C A;  1QIA A;  4XM8 A;  2TCL A;  1JAQ A;  966C A;  1CQR A;  4XM7 A;  1C8T A;  1BUV M;  1Z3J A;  1OS9 A;  3ZUK A;  2D1N A;  1SLN A;  1OMJ A;  3DWB A;  1R1H A;  1BKC A;  3WV2 A;  3LKA A;  3F16 A;  3DL1 A;  1XFV A;  2YB9 A;  5B5O A;  4WZV A;  2RJP A;  3KMC A;  1SMP A;  3MA2 A;  1KUF A;  4GUY A;  4H1Q A;  1OO9 A;  4H30 A;  1IAD A;  4EFS A;  4PKR A;  1KUH A;  3LE9 A;  2XS3 A;  1CXV A;  2J0T A;  1AF0 A;  3HB2 P;  5D1T A;  1JAP A;  1CGE A;  2OY4 A;  3ZXH A;  1HTD A;  1AST A;  1KUK A;  1CGL A;  2PJT A;  4IN9 A;  3DPF A;  1QJI A;  1IAC A;  4L7A A;  1DMT A;  1SAT A;  2X3B A;  2OVZ A;  2CLT A;  2MZE A;  3UVC A;  1G05 A;  1IAB A;  4HMA A;  1O0T A;  4PKV A;  4WK7 A;  3LMC A;  1ZXV A;  4ZR5 A;  5BOT A;  2HU6 A;  2ERQ A;  1HFC A;  2OW0 A;  4CTH A;  4GF1 A;  3HDA P;  4AYK A;  2J83 A;  1JIW P;  1UMT A;  3E8R A;  3CKI A;  2O36 A;  3I7I A;  1OM6 A;  1SLM A;  2FV5 A;  2A8H A;  1FLS A;  3VI1 A;  4QKZ A;  3DPE A;  1J7N A;  1JAO A;  3LUM A;  1GE7 A;  1RMZ A;  1B8Y A;  1YQY A;  2FV9 A;  3EHX A;  4G0D A;  4DF9 A;  1R1J A;  1Y0V A;  3HBV P;  4L19 A;  4DPE A;  3O64 A;  1AYK A;  3KEJ A;  1BUD A;  1PWU A;  1PWQ A;  4H84 A;  1XFU A;  3F19 A;  3LGP A;  3RTT A;  1GE5 A;  1R54 A;  1KBC A;  1YCM A;  1B3D A;  2OVX A;  1G49 A;  3TT4 A;  1HY7 A;  2DW2 A;  3LQB A;  3ELM A;  1A85 A;  1R55 A;  3OHO A;  4JQG A;  1D8M A;  1OM8 A;  1SU3 A;  5D2B A;  1BZS A;  4Q1L A;  1CAQ A;  2E2D A;  3DSL A;  4GWN A;  4XBH A;  1C3I A;  1QIC A;  1OS2 A;  4GR8 A;  2Y6D A;  1UTZ A;  4JPA A;  2MLS A;  2OZR A;  3L0V A;  1K7G A;  5JMY A;  4A7B A;  3ZVS A;  2X7M A;  5I4O A;  4H2E A;  3AYU A;  1MMR A;  3LEA A;  2RJQ A;  4J4M A;  5I2Z A;  3VTG A;  1HOV A;  1WNI A;  2MZH A;  5CUH A;  4GQL A;  2KRJ A;  3EDG A;  4DD8 A;  2OY2 A;  4WKE A; 
#chains in the Genus database with same CATH homology
 1BKC I;  3WV1 A;  2QPJ A;  1G9K A;  4GR0 A;  1USN A;  1KUI A;  1HFS A;  3P1V A;  3HY7 A;  3HYG A;  3EDH A;  1UEA A;  4IUW A;  2YUF A;  4H76 A;  1ZVX A;  1FBL A;  2W14 A;  1ROS A;  1CK7 A;  4AXQ A;  5D3C A;  3V96 B;  2O3E A;  4GWM A;  2MLR A;  3K7N A;  2W0D A;  3LIL A;  3USN A;  4AUO A;  4H49 A;  1D5J A;  1GE6 A;  1I73 A;  5BOY A;  4GR3 A;  830C A;  3KEK A;  1MNC A;  1UTT A;  1PWW A;  4FVL A;  3B8Z A;  1XFW A;  3EWJ A;  2JT5 A;  5LAB A;  3N2V A;  5D7W A;  2OI0 A;  1ZTQ A;  1HV5 A;  4JA1 A;  1BSW A;  4JIJ A;  3LIK A;  2D1O A;  3TSK A;  1C7K A;  1BIW A;  1ND1 A;  4PKS A;  1GKC A;  1SRP A;  1MMB A;  4H3X A;  1ZS0 A;  2SRT A;  3SHI A;  4PKU A;  1YP1 A;  1G4K A;  2DDY A;  3LIR A;  4JP4 A;  3Q2G A;  4XCT A;  1MMP A;  3F18 A;  1AKL A;  2AIG P;  3DNG A;  3KEC A;  4I03 A;  4A3W A;  3AIG A;  1ZXC A;  3LJT A;  4L63 A;  1IAG A;  1I1I P;  3TS4 A;  2USN A;  2E3X A;  4FU4 A;  1Q3A A;  3U1R A;  1K7Q A;  5I12 A;  3KHI A;  1Y8J A;  1XUR A;  4WKI A;  5I3M A;  2XS4 A;  4FXY P;  5L79 A;  2DDF A;  1EB6 A;  1EAK A;  5CXA A;  5I43 A;  5CZM A;  1RM8 A;  3GBO A;  2MZI A;  4H82 A;  4PKT A;  2I47 A;  1DTH A;  1OM7 A;  1MMQ A;  1KUG A;  3AYK A;  4XM6 A;  5D1S A;  2X3A A;  1QIB A;  2CKI A;  3LQ0 A;  3P24 A;  1D8F A;  1JK3 A;  1JH1 A;  2W15 A;  2K2G A;  3F17 A;  3G5C A;  4FXQ A;  4IJO A;  4PKW A;  3DTI A;  1I76 A;  2N8R A;  3G42 A;  2JT6 A;  1CIZ A;  3KME A;  3RTS A;  1L6J A;  4HX3 A;  2AYK A;  1H71 P;  1YOU A;  4I35 A;  3HY9 A;  3F15 A;  3K7L A;  1PWP A;  3LJZ A;  1JAN A;  2OXZ A;  3OHL A;  1GKD A;  5H8X A;  2W13 A;  3KWV C;  2K9C A;  2JSD A;  1PWV A;  1GO8 P;  5I0L A;  1EUB A;  2JNP A;  5B5P A;  4L6T A;  2OW1 A;  1GXD A;  5BPA A;  1UMS A;  3B2Z A;  3WV3 A;  5D1U A;  2ERP A;  3HBU P;  2W12 A;  4ON1 A;  3HDB A;  3EDZ A;  1KAP P;  1R1I A;  1BQO A;  1XFZ A;  3EDI A;  2Y6C A;  2OXU A;  3B92 A;  3L0T A;  4R3V A;  1QJJ A;  2JIH A;  3Q2H A;  2OXW A;  1O0Q A;  2OW9 A;  3LJG A;  1CGF A;  1IAE A;  2POJ A;  1BQQ M;  3F1A A;  4G9L A;  456C A;  1FM1 A;  2YIG A;  4DV8 A;  1ZP5 A;  1Y93 A;  3EHY A;  1A86 A;  3NX7 A;  1K7I A;  1ATL A;  1BKC E;  3DTK A;  2L0R A;  4WF6 A;  5L7F A;  1XUC A;  2Z2D A;  1IAA A;  1G12 A;  2WO8 A;  2ERO A;  4ILW D;  1JJ9 A;  2WO9 A;  3O2X A;  1JIZ A;  2WOA A;  3N2U A;  2DW1 A;  1GO7 P;  1D7X A;  1XUD A;  2V4B A;  1XFY A;  4PKQ A;  1QUA A;  2OW2 A;  1JKY A;  3TVC A;  3I7G A;  1S4B P;  3KRY A;  3DTE A;  3LK8 A;  1XFX A;  3BA0 A;  3LUN A;  1BM6 A;  4AIG A;  2DW0 A;  2X3C A;  1QIA A;  4XM8 A;  2TCL A;  1JAQ A;  966C A;  1CQR A;  4XM7 A;  1C8T A;  1BUV M;  1Z3J A;  1OS9 A;  3ZUK A;  2D1N A;  1SLN A;  1OMJ A;  3DWB A;  1R1H A;  1BKC A;  3WV2 A;  3LKA A;  3F16 A;  3DL1 A;  1XFV A;  2YB9 A;  5B5O A;  4WZV A;  2RJP A;  3KMC A;  1SMP A;  3MA2 A;  1KUF A;  4GUY A;  4H1Q A;  1OO9 A;  4H30 A;  1IAD A;  4EFS A;  4PKR A;  1KUH A;  3LE9 A;  2XS3 A;  1CXV A;  2J0T A;  1AF0 A;  3HB2 P;  5D1T A;  1JAP A;  1CGE A;  2OY4 A;  3ZXH A;  1HTD A;  1AST A;  1KUK A;  1CGL A;  2PJT A;  4IN9 A;  3DPF A;  1QJI A;  1IAC A;  4L7A A;  1DMT A;  1SAT A;  2X3B A;  2OVZ A;  2CLT A;  2MZE A;  3UVC A;  1G05 A;  1IAB A;  4HMA A;  1O0T A;  4PKV A;  4WK7 A;  3LMC A;  1ZXV A;  4ZR5 A;  5BOT A;  2HU6 A;  2ERQ A;  1HFC A;  2OW0 A;  4CTH A;  4GF1 A;  3HDA P;  4AYK A;  2J83 A;  1JIW P;  1UMT A;  3E8R A;  3CKI A;  2O36 A;  3I7I A;  1OM6 A;  1SLM A;  2FV5 A;  2A8H A;  1FLS A;  3VI1 A;  4QKZ A;  3DPE A;  1J7N A;  1JAO A;  3LUM A;  1GE7 A;  1RMZ A;  1B8Y A;  1YQY A;  2FV9 A;  3EHX A;  4G0D A;  4DF9 A;  1R1J A;  1Y0V A;  3HBV P;  4L19 A;  4DPE A;  3O64 A;  1AYK A;  3KEJ A;  1BUD A;  1PWU A;  1PWQ A;  4H84 A;  1XFU A;  3F19 A;  3LGP A;  3RTT A;  1GE5 A;  1R54 A;  1KBC A;  1YCM A;  1B3D A;  2OVX A;  1G49 A;  3TT4 A;  1HY7 A;  2DW2 A;  3LQB A;  3ELM A;  1A85 A;  1R55 A;  3OHO A;  4JQG A;  1D8M A;  1OM8 A;  1SU3 A;  5D2B A;  1BZS A;  4Q1L A;  1CAQ A;  2E2D A;  3DSL A;  4GWN A;  4XBH A;  1C3I A;  1QIC A;  1OS2 A;  4GR8 A;  2Y6D A;  1UTZ A;  4JPA A;  2MLS A;  2OZR A;  3L0V A;  1K7G A;  5JMY A;  4A7B A;  3ZVS A;  2X7M A;  5I4O A;  4H2E A;  3AYU A;  1MMR A;  3LEA A;  2RJQ A;  4J4M A;  5I2Z A;  3VTG A;  1HOV A;  1WNI A;  2MZH A;  5CUH A;  4GQL A;  2KRJ A;  3EDG A;  4DD8 A;  2OY2 A;  4WKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...