3O2XA

Mmp-13 in complex with selective tetrazole core inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase 3
publication title MMP-13 in complex with selective tetrazole core inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3o2xA00
5CUHA 2CLTA 2Y6CA 1JH1A 4FXQA 4H2EA 1OM7A 4QKZA 1I76A 4A7BA 4H30A 3AYUA 1UEAA 3ZXHA 2RJQA 3TVCA 3EWJA 1ZS0A 2OW9A 1GO7P 1BM6A 1Y8JA 2OXWA 3LUMA 3USNA 2OXUA 1OS9A 1JAOA 3F16A 2MZIA 1QIBA 4EFSA 3HB2P 3LGPA 3TT4A 1OO9A 1R1HA 1I73A 1AYKA 2D1NA 3Q2HA 1I1IP 456CA 1C7KA 1YQYA 3L0TA 1BQOA 1O0QA 1MNCA 2W15A 4GF1A 4H84A 2I47A 1PWWA 2OZRA 4GR8A 2QPJA 2WO8A 1PWQA 1ND1A 1EB6A 1ASTA 1HFCA 3BA0A 4FXYP 2ERPA 2X3AA 1CGFA 3LMCA 2N8RA 3DSLA 5L7FA 1XUDA 1SATA 4JIJA 2A8HA 5D1SA 2ERQA 3U1RA 1G12A 2AIGP 3HYGA 3LILA 1R1JA 1D8FA 1Z3JA 5I0LA 5I2ZA 1B8YA 3KEKA 1JAQA 1FBLA 1R55A 1SLNA 1CQRA 4AYKA 1CIZA 3AIGA 1GKDA 2OY2A 2OI0A 4L63A 1CGLA 1XFWA 1BSWA 4CTHA 4ON1A 1ZTQA 4GR0A 1CK7A 1HTDA 2K9CA 3LE9A 1A85A 1PWUA 1XUCA 1JKYA 3EDHA 1KUKA 1AF0A 1KUGA 2W12A 4PKVA 1DMTA 3ELMA 3EHXA 2JT5A 2RJPA 3DL1A 3CKIA 1CAQA 1KUFA 2MLSA 1DTHA 3I7GA 4PKSA 2HU6A 3HY7A 1SMPA 2E3XA 3HDAP 1R54A 3NX7A 1BKCA 3LQ0A 4IJOA 4JA1A 3F1AA 3O64A 1H71P 3WV3A 4IN9A 1J7NA 1K7QA 3EDZA 2OY4A 2X3BA 4JPAA 1YP1A 5D2BA 3LKAA 1EAKA 4H82A 1IADA 1UMSA 3HBVP 5B5PA 2D1OA 3LJZA 1ZVXA 1GXDA 4J4MA 4WKEA 966CA 3KWVC 2MZEA 1EUBA 2SRTA 1IAAA 4JQGA 1RM8A 1SU3A 5D3CA 3WV1A 4IUWA 1SLMA 1R1IA 3ZUKA 1RMZA 1GKCA 3DPEA 3O2XA 1MMRA 3I7IA 1XFUA 1BUVM 1K7IA 2WOAA 1ZXCA 4I35A 3OHLA 4L6TA 2YIGA 3N2VA 4FU4A 5L79A 3LIRA 2O36A 3ZVSA 2XS4A 1KUHA 1BUDA 1XFXA 4AUOA 1JIZA 1OMJA 1ZXVA 1MMQA 4PKQA 3TSKA 4DF9A 2WO9A 3SHIA 2FV5A 2DW1A 1IACA 2J0TA 4G9LA 1AKLA 4H3XA 1O0TA 1BIWA 1SRPA 4GR3A 3LQBA 4AIGA 1BKCI 2W14A 3F18A 3HY9A 4L19A 4PKWA 2EROA 3N2UA 3HBUP 3DNGA 1KBCA 3EDGA 4G0DA 1D7XA 3G42A 1Q3AA 2JIHA 1JIWP 2OW1A 1JK3A 1KAPP 2J83A 3E8RA 4ZR5A 3HDBA 4GWNA 1ZP5A 1CXVA 4H49A 3DPFA 1PWVA 5BOTA 1XFZA 3MA2A 4H76A 1UMTA 2CKIA 4WKIA 3LJTA 1QJJA 1USNA 4HX3A 2E2DA 1OS2A 830CA 4HMAA 4AXQA 5D1UA 4GQLA 5H8XA 1G05A 3B8ZA 2USNA 2OVZA 2OVXA 1C3IA 3EHYA 5BPAA 2Z2DA 3TS4A 3B92A 3KMEA 2JNPA 1QICA 4WK7A 1ATLA 3LIKA 1G9KA 2DW2A 1IABA 1WNIA 2W0DA 4PKRA 5LABA 5I3MA 1GE7A 3F19A 2DW0A 2FV9A 2MZHA 3F17A 4I03A 3GBOA 1QUAA 1HV5A 3KHIA 2MLRA 1OM8A 1YOUA 1HOVA 3DWBA 1IAGA 2JT6A 1IAEA 1JAPA 4WF6A 2DDYA 3Q2GA 1D8MA 1XURA 2Y6DA 3LEAA 1GE6A 4ILWD 1FM1A 4GUYA 3RTSA 3B2ZA 1CGEA 1HY7A 3V96B 4FVLA 4A3WA 2OW2A 4DPEA 3EDIA 3K7NA 4XM6A 5I43A 1GO8P 1BKCE 4GWMA 3WV2A 1MMPA 3KECA 2AYKA 4WZVA 1HFSA 4H1QA 3UVCA 3G5CA 5D7WA 4XBHA 2KRJA 4PKUA 1A86A 1BZSA 1YCMA 1XFYA 1C8TA 1ROSA 5D1TA 3KEJA 1G49A 1MMBA 1L6JA 5CZMA 5I12A 1B3DA 3P1VA 2POJA 2L0RA 1GE5A 2V4BA 2JSDA 1S4BP 1G4KA 2X3CA 2YB9A 1JJ9A 1JANA 2K2GA 1XFVA 2O3EA 2OXZA 1D5JA 3AYKA 3VTGA 3RTTA 3LUNA 1Y0VA 4XM8A 3LJGA 4DV8A 1PWPA 2DDFA 4JP4A 1UTTA 5BOYA 4PKTA 3KMCA 2PJTA 5JMYA 1BQQM 3LK8A 5CXAA 2XS3A 4DD8A 1KUIA 1Y93A 3P24A 4R3VA 3OHOA 3KRYA 1K7GA 2X7MA 3L0VA 4XM7A 2W13A 4XCTA 1OM6A 3F15A 1QIAA 5I4OA 3K7LA 2OW0A 4Q1LA 5B5OA 1UTZA 3VI1A 1QJIA 2TCLA 1FLSA
chains in the Genus database with same CATH superfamily
5CUHA 2CLTA 2Y6CA 1JH1A 4FXQA 4H2EA 1OM7A 4QKZA 1I76A 4A7BA 4H30A 3AYUA 1UEAA 3ZXHA 2RJQA 3TVCA 3EWJA 1ZS0A 2OW9A 1GO7P 1BM6A 1Y8JA 2OXWA 3LUMA 3USNA 2OXUA 1OS9A 1JAOA 3F16A 2MZIA 1QIBA 4EFSA 3HB2P 3LGPA 3TT4A 1OO9A 1R1HA 1I73A 1AYKA 2D1NA 3Q2HA 1OZ9A 1I1IP 456CA 1C7KA 1YQYA 3L0TA 1BQOA 1O0QA 1MNCA 2W15A 4GF1A 4H84A 2I47A 1PWWA 2OZRA 4GR8A 2QPJA 2WO8A 1TVIA 4L7AA 1PWQA 1ND1A 3DTIA 1EB6A 1ASTA 1HFCA 3BA0A 4FXYP 2ERPA 2X3AA 1CGFA 3LMCA 2N8RA 3DSLA 5L7FA 1XUDA 1SATA 4JIJA 2A8HA 5D1SA 2ERQA 3U1RA 1G12A 2AIGP 3HYGA 3LILA 1R1JA 1D8FA 1Z3JA 5I0LA 5I2ZA 1B8YA 3KEKA 1JAQA 1FBLA 1R55A 1SLNA 1CQRA 4AYKA 1CIZA 3AIGA 1GKDA 2OY2A 2OI0A 4L63A 1CGLA 1XFWA 1BSWA 4CTHA 4ON1A 1ZTQA 4GR0A 1CK7A 1HTDA 2K9CA 3LE9A 1A85A 1PWUA 1XUCA 1XAXA 1JKYA 3EDHA 1KUKA 1AF0A 1KUGA 2W12A 4PKVA 1DMTA 3ELMA 3EHXA 2JT5A 2RJPA 3DL1A 3CKIA 1CAQA 1KUFA 2MLSA 2YUFA 1DTHA 3I7GA 4PKSA 2HU6A 3DTEA 3HY7A 1SMPA 2E3XA 3HDAP 1R54A 3NX7A 1BKCA 3LQ0A 4IJOA 4JA1A 3DTKA 3F1AA 3O64A 1H71P 3WV3A 4IN9A 1J7NA 1K7QA 3EDZA 2OY4A 2X3BA 4JPAA 1YP1A 5D2BA 3LKAA 1EAKA 4H82A 1IADA 1UMSA 3HBVP 5B5PA 2D1OA 3LJZA 1ZVXA 1GXDA 4J4MA 4WKEA 966CA 3KWVC 2MZEA 1EUBA 2SRTA 1IAAA 4JQGA 1RM8A 1SU3A 5D3CA 3WV1A 4IUWA 1SLMA 1R1IA 3ZUKA 1RMZA 1GKCA 3DPEA 3O2XA 1MMRA 3I7IA 1XFUA 1BUVM 1K7IA 2WOAA 1ZXCA 4I35A 3OHLA 4L6TA 2YIGA 3N2VA 4FU4A 5L79A 3LIRA 2O36A 3ZVSA 2XS4A 1KUHA 1BUDA 1XFXA 4AUOA 1JIZA 1OMJA 1ZXVA 1MMQA 4PKQA 3TSKA 4DF9A 2WO9A 3SHIA 2FV5A 2DW1A 1IACA 2J0TA 4G9LA 1AKLA 4H3XA 1O0TA 1BIWA 1SRPA 4GR3A 3LQBA 4AIGA 1BKCI 2W14A 3F18A 3HY9A 4L19A 4PKWA 2EROA 3N2UA 3HBUP 3DNGA 1KBCA 3EDGA 4G0DA 1D7XA 3G42A 1Q3AA 2JIHA 1JIWP 2OW1A 1JK3A 1KAPP 2J83A 3E8RA 4ZR5A 3HDBA 4GWNA 1ZP5A 1CXVA 4H49A 3DPFA 1PWVA 5BOTA 1XFZA 3MA2A 4H76A 1UMTA 2CKIA 4WKIA 3LJTA 1QJJA 1USNA 4HX3A 2E2DA 1OS2A 830CA 4HMAA 4AXQA 5D1UA 4GQLA 5H8XA 1G05A 3B8ZA 2USNA 2OVZA 2OVXA 1C3IA 3EHYA 5BPAA 2Z2DA 3TS4A 3B92A 3KMEA 2JNPA 1QICA 4WK7A 1ATLA 3LIKA 1G9KA 2DW2A 1IABA 1WNIA 2W0DA 4PKRA 5LABA 5I3MA 1GE7A 3F19A 2DW0A 2FV9A 2MZHA 3F17A 4I03A 3GBOA 1QUAA 1HV5A 3KHIA 2MLRA 1OM8A 1YOUA 1HOVA 3DWBA 1IAGA 2JT6A 1IAEA 1JAPA 4WF6A 2DDYA 3Q2GA 1D8MA 1XURA 2Y6DA 3LEAA 1GE6A 4ILWD 1FM1A 4GUYA 3RTSA 3B2ZA 1CGEA 1HY7A 3V96B 4FVLA 4A3WA 2OW2A 4DPEA 3EDIA 3K7NA 4XM6A 5I43A 1GO8P 1BKCE 1XM5A 4GWMA 3WV2A 1MMPA 3KECA 2AYKA 4WZVA 1HFSA 4H1QA 3UVCA 3G5CA 5D7WA 4XBHA 2KRJA 4PKUA 1A86A 1BZSA 1YCMA 1XFYA 1C8TA 1ROSA 5D1TA 3KEJA 1G49A 1MMBA 1L6JA 5CZMA 5I12A 1B3DA 3P1VA 2POJA 2L0RA 1GE5A 2V4BA 2JSDA 1S4BP 1G4KA 2X3CA 2YB9A 1JJ9A 1JANA 2K2GA 1XFVA 2O3EA 2OXZA 1D5JA 3AYKA 3VTGA 3RTTA 3LUNA 1Y0VA 4XM8A 3LJGA 4DV8A 1PWPA 2DDFA 4JP4A 1UTTA 5BOYA 4PKTA 3KMCA 2PJTA 5JMYA 1BQQM 3LK8A 5CXAA 2XS3A 4DD8A 1KUIA 1Y93A 3P24A 4R3VA 3OHOA 3KRYA 1K7GA 2X7MA 3L0VA 4XM7A 2W13A 4XCTA 1OM6A 3F15A 1QIAA 5I4OA 3K7LA 2OW0A 4Q1LA 5B5OA 1UTZA 3VI1A 1QJIA 2TCLA 1FLSA
chains in the Genus database with same CATH topology
5CUHA 2CLTA 2Y6CA 1JH1A 4FXQA 4H2EA 1OM7A 4QKZA 1I76A 4A7BA 4H30A 3AYUA 1UEAA 3ZXHA 2RJQA 3TVCA 3EWJA 1ZS0A 2OW9A 1GO7P 1BM6A 1Y8JA 2OXWA 3LUMA 3USNA 2OXUA 1OS9A 1JAOA 3F16A 2MZIA 1QIBA 4EFSA 3HB2P 3LGPA 3TT4A 1OO9A 1R1HA 1I73A 1AYKA 2D1NA 3Q2HA 1I1IP 456CA 1C7KA 1YQYA 3L0TA 1BQOA 1O0QA 1MNCA 2W15A 4GF1A 4H84A 2I47A 1PWWA 2OZRA 4GR8A 2QPJA 2WO8A 4L7AA 1PWQA 1ND1A 3DTIA 1EB6A 1ASTA 1HFCA 3BA0A 4FXYP 2ERPA 2X3AA 1CGFA 3LMCA 2N8RA 3DSLA 5L7FA 1XUDA 1SATA 4JIJA 2A8HA 5D1SA 2ERQA 3U1RA 1G12A 2AIGP 3HYGA 3LILA 1R1JA 1D8FA 1Z3JA 5I0LA 5I2ZA 1B8YA 3KEKA 1JAQA 1FBLA 1R55A 1SLNA 1CQRA 4AYKA 1CIZA 3AIGA 1GKDA 2OY2A 2OI0A 4L63A 1CGLA 1XFWA 1BSWA 4CTHA 4ON1A 1ZTQA 4GR0A 1CK7A 1HTDA 2K9CA 3LE9A 1A85A 1PWUA 1XUCA 1JKYA 3EDHA 1KUKA 1AF0A 1KUGA 2W12A 4PKVA 1DMTA 3ELMA 3EHXA 2JT5A 2RJPA 3DL1A 3CKIA 1CAQA 1KUFA 2MLSA 2YUFA 1DTHA 3I7GA 4PKSA 2HU6A 3DTEA 3HY7A 1SMPA 2E3XA 3HDAP 1R54A 3NX7A 1BKCA 3LQ0A 4IJOA 4JA1A 3DTKA 3F1AA 3O64A 1H71P 3WV3A 4IN9A 1J7NA 1K7QA 3EDZA 2OY4A 2X3BA 4JPAA 1YP1A 5D2BA 3LKAA 1EAKA 4H82A 1IADA 1UMSA 3HBVP 5B5PA 2D1OA 3LJZA 1ZVXA 1GXDA 4J4MA 4WKEA 966CA 3KWVC 2MZEA 1EUBA 2SRTA 1IAAA 4JQGA 1RM8A 1SU3A 5D3CA 3WV1A 4IUWA 1SLMA 1R1IA 3ZUKA 1RMZA 1GKCA 3DPEA 3O2XA 1MMRA 3I7IA 1XFUA 1BUVM 1K7IA 2WOAA 1ZXCA 4I35A 3OHLA 4L6TA 2YIGA 3N2VA 4FU4A 5L79A 3LIRA 2O36A 3ZVSA 2XS4A 1KUHA 1BUDA 1XFXA 4AUOA 1JIZA 1OMJA 1ZXVA 1MMQA 4PKQA 3TSKA 4DF9A 2WO9A 3SHIA 2FV5A 2DW1A 1IACA 2J0TA 4G9LA 1AKLA 4H3XA 1O0TA 1BIWA 1SRPA 4GR3A 3LQBA 4AIGA 1BKCI 2W14A 3F18A 3HY9A 4L19A 4PKWA 2EROA 3N2UA 3HBUP 3DNGA 1KBCA 3EDGA 4G0DA 1D7XA 3G42A 1Q3AA 2JIHA 1JIWP 2OW1A 1JK3A 1KAPP 2J83A 3E8RA 4ZR5A 3HDBA 4GWNA 1ZP5A 1CXVA 4H49A 3DPFA 1PWVA 5BOTA 1XFZA 3MA2A 4H76A 1UMTA 2CKIA 4WKIA 3LJTA 1QJJA 1USNA 4HX3A 2E2DA 1OS2A 830CA 4HMAA 4AXQA 5D1UA 4GQLA 5H8XA 1G05A 3B8ZA 2USNA 2OVZA 2OVXA 1C3IA 3EHYA 5BPAA 2Z2DA 3TS4A 3B92A 3KMEA 2JNPA 1QICA 4WK7A 1ATLA 3LIKA 1G9KA 2DW2A 1IABA 1WNIA 2W0DA 4PKRA 5LABA 5I3MA 1GE7A 3F19A 2DW0A 2FV9A 2MZHA 3F17A 4I03A 3GBOA 1QUAA 1HV5A 3KHIA 2MLRA 1OM8A 1YOUA 1HOVA 3DWBA 1IAGA 2JT6A 1IAEA 1JAPA 4WF6A 2DDYA 3Q2GA 1D8MA 1XURA 2Y6DA 3LEAA 1GE6A 4ILWD 1FM1A 4GUYA 3RTSA 3B2ZA 1CGEA 1HY7A 3V96B 4FVLA 4A3WA 2OW2A 4DPEA 3EDIA 3K7NA 4XM6A 5I43A 1GO8P 1BKCE 4GWMA 3WV2A 1MMPA 3KECA 2AYKA 4WZVA 1HFSA 4H1QA 3UVCA 3G5CA 5D7WA 4XBHA 2KRJA 4PKUA 1A86A 1BZSA 1YCMA 1XFYA 1C8TA 1ROSA 5D1TA 3KEJA 1G49A 1MMBA 1L6JA 5CZMA 5I12A 1B3DA 3P1VA 2POJA 2L0RA 1GE5A 2V4BA 2JSDA 1S4BP 1G4KA 2X3CA 2YB9A 1JJ9A 1JANA 2K2GA 1XFVA 2O3EA 2OXZA 1D5JA 3AYKA 3VTGA 3RTTA 3LUNA 1Y0VA 4XM8A 3LJGA 4DV8A 1PWPA 2DDFA 4JP4A 1UTTA 5BOYA 4PKTA 3KMCA 2PJTA 5JMYA 1BQQM 3LK8A 5CXAA 2XS3A 4DD8A 1KUIA 1Y93A 3P24A 4R3VA 3OHOA 3KRYA 1K7GA 2X7MA 3L0VA 4XM7A 2W13A 4XCTA 1OM6A 3F15A 1QIAA 5I4OA 3K7LA 2OW0A 4Q1LA 5B5OA 1UTZA 3VI1A 1QJIA 2TCLA 1FLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUH A;  2CLT A;  2Y6C A;  1JH1 A;  4FXQ A;  4H2E A;  1OM7 A;  4QKZ A;  1I76 A;  4A7B A;  4H30 A;  3AYU A;  1UEA A;  3ZXH A;  2RJQ A;  3TVC A;  3EWJ A;  1ZS0 A;  2OW9 A;  1GO7 P;  1BM6 A;  1Y8J A;  2OXW A;  3LUM A;  3USN A;  2OXU A;  1OS9 A;  1JAO A;  3F16 A;  2MZI A;  1QIB A;  4EFS A;  3HB2 P;  3LGP A;  3TT4 A;  1OO9 A;  1R1H A;  1I73 A;  1AYK A;  2D1N A;  3Q2H A;  1I1I P;  456C A;  1C7K A;  1YQY A;  3L0T A;  1BQO A;  1O0Q A;  1MNC A;  2W15 A;  4GF1 A;  4H84 A;  2I47 A;  1PWW A;  2OZR A;  4GR8 A;  2QPJ A;  2WO8 A;  1PWQ A;  1ND1 A;  1EB6 A;  1AST A;  1HFC A;  3BA0 A;  4FXY P;  2ERP A;  2X3A A;  1CGF A;  3LMC A;  2N8R A;  3DSL A;  5L7F A;  1XUD A;  1SAT A;  4JIJ A;  2A8H A;  5D1S A;  2ERQ A;  3U1R A;  1G12 A;  2AIG P;  3HYG A;  3LIL A;  1R1J A;  1D8F A;  1Z3J A;  5I0L A;  5I2Z A;  1B8Y A;  3KEK A;  1JAQ A;  1FBL A;  1R55 A;  1SLN A;  1CQR A;  4AYK A;  1CIZ A;  3AIG A;  1GKD A;  2OY2 A;  2OI0 A;  4L63 A;  1CGL A;  1XFW A;  1BSW A;  4CTH A;  4ON1 A;  1ZTQ A;  4GR0 A;  1CK7 A;  1HTD A;  2K9C A;  3LE9 A;  1A85 A;  1PWU A;  1XUC A;  1JKY A;  3EDH A;  1KUK A;  1AF0 A;  1KUG A;  2W12 A;  4PKV A;  1DMT A;  3ELM A;  3EHX A;  2JT5 A;  2RJP A;  3DL1 A;  3CKI A;  1CAQ A;  1KUF A;  2MLS A;  1DTH A;  3I7G A;  4PKS A;  2HU6 A;  3HY7 A;  1SMP A;  2E3X A;  3HDA P;  1R54 A;  3NX7 A;  1BKC A;  3LQ0 A;  4IJO A;  4JA1 A;  3F1A A;  3O64 A;  1H71 P;  3WV3 A;  4IN9 A;  1J7N A;  1K7Q A;  3EDZ A;  2OY4 A;  2X3B A;  4JPA A;  1YP1 A;  5D2B A;  3LKA A;  1EAK A;  4H82 A;  1IAD A;  1UMS A;  3HBV P;  5B5P A;  2D1O A;  3LJZ A;  1ZVX A;  1GXD A;  4J4M A;  4WKE A;  966C A;  3KWV C;  2MZE A;  1EUB A;  2SRT A;  1IAA A;  4JQG A;  1RM8 A;  1SU3 A;  5D3C A;  3WV1 A;  4IUW A;  1SLM A;  1R1I A;  3ZUK A;  1RMZ A;  1GKC A;  3DPE A;  3O2X A;  1MMR A;  3I7I A;  1XFU A;  1BUV M;  1K7I A;  2WOA A;  1ZXC A;  4I35 A;  3OHL A;  4L6T A;  2YIG A;  3N2V A;  4FU4 A;  5L79 A;  3LIR A;  2O36 A;  3ZVS A;  2XS4 A;  1KUH A;  1BUD A;  1XFX A;  4AUO A;  1JIZ A;  1OMJ A;  1ZXV A;  1MMQ A;  4PKQ A;  3TSK A;  4DF9 A;  2WO9 A;  3SHI A;  2FV5 A;  2DW1 A;  1IAC A;  2J0T A;  4G9L A;  1AKL A;  4H3X A;  1O0T A;  1BIW A;  1SRP A;  4GR3 A;  3LQB A;  4AIG A;  1BKC I;  2W14 A;  3F18 A;  3HY9 A;  4L19 A;  4PKW A;  2ERO A;  3N2U A;  3HBU P;  3DNG A;  1KBC A;  3EDG A;  4G0D A;  1D7X A;  3G42 A;  1Q3A A;  2JIH A;  1JIW P;  2OW1 A;  1JK3 A;  1KAP P;  2J83 A;  3E8R A;  4ZR5 A;  3HDB A;  4GWN A;  1ZP5 A;  1CXV A;  4H49 A;  3DPF A;  1PWV A;  5BOT A;  1XFZ A;  3MA2 A;  4H76 A;  1UMT A;  2CKI A;  4WKI A;  3LJT A;  1QJJ A;  1USN A;  4HX3 A;  2E2D A;  1OS2 A;  830C A;  4HMA A;  4AXQ A;  5D1U A;  4GQL A;  5H8X A;  1G05 A;  3B8Z A;  2USN A;  2OVZ A;  2OVX A;  1C3I A;  3EHY A;  5BPA A;  2Z2D A;  3TS4 A;  3B92 A;  3KME A;  2JNP A;  1QIC A;  4WK7 A;  1ATL A;  3LIK A;  1G9K A;  2DW2 A;  1IAB A;  1WNI A;  2W0D A;  4PKR A;  5LAB A;  5I3M A;  1GE7 A;  3F19 A;  2DW0 A;  2FV9 A;  2MZH A;  3F17 A;  4I03 A;  3GBO A;  1QUA A;  1HV5 A;  3KHI A;  2MLR A;  1OM8 A;  1YOU A;  1HOV A;  3DWB A;  1IAG A;  2JT6 A;  1IAE A;  1JAP A;  4WF6 A;  2DDY A;  3Q2G A;  1D8M A;  1XUR A;  2Y6D A;  3LEA A;  1GE6 A;  4ILW D;  1FM1 A;  4GUY A;  3RTS A;  3B2Z A;  1CGE A;  1HY7 A;  3V96 B;  4FVL A;  4A3W A;  2OW2 A;  4DPE A;  3EDI A;  3K7N A;  4XM6 A;  5I43 A;  1GO8 P;  1BKC E;  4GWM A;  3WV2 A;  1MMP A;  3KEC A;  2AYK A;  4WZV A;  1HFS A;  4H1Q A;  3UVC A;  3G5C A;  5D7W A;  4XBH A;  2KRJ A;  4PKU A;  1A86 A;  1BZS A;  1YCM A;  1XFY A;  1C8T A;  1ROS A;  5D1T A;  3KEJ A;  1G49 A;  1MMB A;  1L6J A;  5CZM A;  5I12 A;  1B3D A;  3P1V A;  2POJ A;  2L0R A;  1GE5 A;  2V4B A;  2JSD A;  1S4B P;  1G4K A;  2X3C A;  2YB9 A;  1JJ9 A;  1JAN A;  2K2G A;  1XFV A;  2O3E A;  2OXZ A;  1D5J A;  3AYK A;  3VTG A;  3RTT A;  3LUN A;  1Y0V A;  4XM8 A;  3LJG A;  4DV8 A;  1PWP A;  2DDF A;  4JP4 A;  1UTT A;  5BOY A;  4PKT A;  3KMC A;  2PJT A;  5JMY A;  1BQQ M;  3LK8 A;  5CXA A;  2XS3 A;  4DD8 A;  1KUI A;  1Y93 A;  3P24 A;  4R3V A;  3OHO A;  3KRY A;  1K7G A;  2X7M A;  3L0V A;  4XM7 A;  2W13 A;  4XCT A;  1OM6 A;  3F15 A;  1QIA A;  5I4O A;  3K7L A;  2OW0 A;  4Q1L A;  5B5O A;  1UTZ A;  3VI1 A;  1QJI A;  2TCL A;  1FLS A; 
#chains in the Genus database with same CATH topology
 5CUH A;  2CLT A;  2Y6C A;  1JH1 A;  4FXQ A;  4H2E A;  1OM7 A;  4QKZ A;  1I76 A;  4A7B A;  4H30 A;  3AYU A;  1UEA A;  3ZXH A;  2RJQ A;  3TVC A;  3EWJ A;  1ZS0 A;  2OW9 A;  1GO7 P;  1BM6 A;  1Y8J A;  2OXW A;  3LUM A;  3USN A;  2OXU A;  1OS9 A;  1JAO A;  3F16 A;  2MZI A;  1QIB A;  4EFS A;  3HB2 P;  3LGP A;  3TT4 A;  1OO9 A;  1R1H A;  1I73 A;  1AYK A;  2D1N A;  3Q2H A;  1OZ9 A;  1I1I P;  456C A;  1C7K A;  1YQY A;  3L0T A;  1BQO A;  1O0Q A;  1MNC A;  2W15 A;  4GF1 A;  4H84 A;  2I47 A;  1PWW A;  2OZR A;  4GR8 A;  2QPJ A;  2WO8 A;  1TVI A;  4L7A A;  1PWQ A;  1ND1 A;  3DTI A;  1EB6 A;  1AST A;  1HFC A;  3BA0 A;  4FXY P;  2ERP A;  2X3A A;  1CGF A;  3LMC A;  2N8R A;  3DSL A;  5L7F A;  1XUD A;  1SAT A;  4JIJ A;  2A8H A;  5D1S A;  2ERQ A;  3U1R A;  1G12 A;  2AIG P;  3HYG A;  3LIL A;  1R1J A;  1D8F A;  1Z3J A;  5I0L A;  5I2Z A;  1B8Y A;  3KEK A;  1JAQ A;  1FBL A;  1R55 A;  1SLN A;  1CQR A;  4AYK A;  1CIZ A;  3AIG A;  1GKD A;  2OY2 A;  2OI0 A;  4L63 A;  1CGL A;  1XFW A;  1BSW A;  4CTH A;  4ON1 A;  1ZTQ A;  4GR0 A;  1CK7 A;  1HTD A;  2K9C A;  3LE9 A;  1A85 A;  1PWU A;  1XUC A;  1XAX A;  1JKY A;  3EDH A;  1KUK A;  1AF0 A;  1KUG A;  2W12 A;  4PKV A;  1DMT A;  3ELM A;  3EHX A;  2JT5 A;  2RJP A;  3DL1 A;  3CKI A;  1CAQ A;  1KUF A;  2MLS A;  2YUF A;  1DTH A;  3I7G A;  4PKS A;  2HU6 A;  3DTE A;  3HY7 A;  1SMP A;  2E3X A;  3HDA P;  1R54 A;  3NX7 A;  1BKC A;  3LQ0 A;  4IJO A;  4JA1 A;  3DTK A;  3F1A A;  3O64 A;  1H71 P;  3WV3 A;  4IN9 A;  1J7N A;  1K7Q A;  3EDZ A;  2OY4 A;  2X3B A;  4JPA A;  1YP1 A;  5D2B A;  3LKA A;  1EAK A;  4H82 A;  1IAD A;  1UMS A;  3HBV P;  5B5P A;  2D1O A;  3LJZ A;  1ZVX A;  1GXD A;  4J4M A;  4WKE A;  966C A;  3KWV C;  2MZE A;  1EUB A;  2SRT A;  1IAA A;  4JQG A;  1RM8 A;  1SU3 A;  5D3C A;  3WV1 A;  4IUW A;  1SLM A;  1R1I A;  3ZUK A;  1RMZ A;  1GKC A;  3DPE A;  3O2X A;  1MMR A;  3I7I A;  1XFU A;  1BUV M;  1K7I A;  2WOA A;  1ZXC A;  4I35 A;  3OHL A;  4L6T A;  2YIG A;  3N2V A;  4FU4 A;  5L79 A;  3LIR A;  2O36 A;  3ZVS A;  2XS4 A;  1KUH A;  1BUD A;  1XFX A;  4AUO A;  1JIZ A;  1OMJ A;  1ZXV A;  1MMQ A;  4PKQ A;  3TSK A;  4DF9 A;  2WO9 A;  3SHI A;  2FV5 A;  2DW1 A;  1IAC A;  2J0T A;  4G9L A;  1AKL A;  4H3X A;  1O0T A;  1BIW A;  1SRP A;  4GR3 A;  3LQB A;  4AIG A;  1BKC I;  2W14 A;  3F18 A;  3HY9 A;  4L19 A;  4PKW A;  2ERO A;  3N2U A;  3HBU P;  3DNG A;  1KBC A;  3EDG A;  4G0D A;  1D7X A;  3G42 A;  1Q3A A;  2JIH A;  1JIW P;  2OW1 A;  1JK3 A;  1KAP P;  2J83 A;  3E8R A;  4ZR5 A;  3HDB A;  4GWN A;  1ZP5 A;  1CXV A;  4H49 A;  3DPF A;  1PWV A;  5BOT A;  1XFZ A;  3MA2 A;  4H76 A;  1UMT A;  2CKI A;  4WKI A;  3LJT A;  1QJJ A;  1USN A;  4HX3 A;  2E2D A;  1OS2 A;  830C A;  4HMA A;  4AXQ A;  5D1U A;  4GQL A;  5H8X A;  1G05 A;  3B8Z A;  2USN A;  2OVZ A;  2OVX A;  1C3I A;  3EHY A;  5BPA A;  2Z2D A;  3TS4 A;  3B92 A;  3KME A;  2JNP A;  1QIC A;  4WK7 A;  1ATL A;  3LIK A;  1G9K A;  2DW2 A;  1IAB A;  1WNI A;  2W0D A;  4PKR A;  5LAB A;  5I3M A;  1GE7 A;  3F19 A;  2DW0 A;  2FV9 A;  2MZH A;  3F17 A;  4I03 A;  3GBO A;  1QUA A;  1HV5 A;  3KHI A;  2MLR A;  1OM8 A;  1YOU A;  1HOV A;  3DWB A;  1IAG A;  2JT6 A;  1IAE A;  1JAP A;  4WF6 A;  2DDY A;  3Q2G A;  1D8M A;  1XUR A;  2Y6D A;  3LEA A;  1GE6 A;  4ILW D;  1FM1 A;  4GUY A;  3RTS A;  3B2Z A;  1CGE A;  1HY7 A;  3V96 B;  4FVL A;  4A3W A;  2OW2 A;  4DPE A;  3EDI A;  3K7N A;  4XM6 A;  5I43 A;  1GO8 P;  1BKC E;  1XM5 A;  4GWM A;  3WV2 A;  1MMP A;  3KEC A;  2AYK A;  4WZV A;  1HFS A;  4H1Q A;  3UVC A;  3G5C A;  5D7W A;  4XBH A;  2KRJ A;  4PKU A;  1A86 A;  1BZS A;  1YCM A;  1XFY A;  1C8T A;  1ROS A;  5D1T A;  3KEJ A;  1G49 A;  1MMB A;  1L6J A;  5CZM A;  5I12 A;  1B3D A;  3P1V A;  2POJ A;  2L0R A;  1GE5 A;  2V4B A;  2JSD A;  1S4B P;  1G4K A;  2X3C A;  2YB9 A;  1JJ9 A;  1JAN A;  2K2G A;  1XFV A;  2O3E A;  2OXZ A;  1D5J A;  3AYK A;  3VTG A;  3RTT A;  3LUN A;  1Y0V A;  4XM8 A;  3LJG A;  4DV8 A;  1PWP A;  2DDF A;  4JP4 A;  1UTT A;  5BOY A;  4PKT A;  3KMC A;  2PJT A;  5JMY A;  1BQQ M;  3LK8 A;  5CXA A;  2XS3 A;  4DD8 A;  1KUI A;  1Y93 A;  3P24 A;  4R3V A;  3OHO A;  3KRY A;  1K7G A;  2X7M A;  3L0V A;  4XM7 A;  2W13 A;  4XCT A;  1OM6 A;  3F15 A;  1QIA A;  5I4O A;  3K7L A;  2OW0 A;  4Q1L A;  5B5O A;  1UTZ A;  3VI1 A;  1QJI A;  2TCL A;  1FLS A; 
#chains in the Genus database with same CATH homology
 5CUH A;  2CLT A;  2Y6C A;  1JH1 A;  4FXQ A;  4H2E A;  1OM7 A;  4QKZ A;  1I76 A;  4A7B A;  4H30 A;  3AYU A;  1UEA A;  3ZXH A;  2RJQ A;  3TVC A;  3EWJ A;  1ZS0 A;  2OW9 A;  1GO7 P;  1BM6 A;  1Y8J A;  2OXW A;  3LUM A;  3USN A;  2OXU A;  1OS9 A;  1JAO A;  3F16 A;  2MZI A;  1QIB A;  4EFS A;  3HB2 P;  3LGP A;  3TT4 A;  1OO9 A;  1R1H A;  1I73 A;  1AYK A;  2D1N A;  3Q2H A;  1I1I P;  456C A;  1C7K A;  1YQY A;  3L0T A;  1BQO A;  1O0Q A;  1MNC A;  2W15 A;  4GF1 A;  4H84 A;  2I47 A;  1PWW A;  2OZR A;  4GR8 A;  2QPJ A;  2WO8 A;  4L7A A;  1PWQ A;  1ND1 A;  3DTI A;  1EB6 A;  1AST A;  1HFC A;  3BA0 A;  4FXY P;  2ERP A;  2X3A A;  1CGF A;  3LMC A;  2N8R A;  3DSL A;  5L7F A;  1XUD A;  1SAT A;  4JIJ A;  2A8H A;  5D1S A;  2ERQ A;  3U1R A;  1G12 A;  2AIG P;  3HYG A;  3LIL A;  1R1J A;  1D8F A;  1Z3J A;  5I0L A;  5I2Z A;  1B8Y A;  3KEK A;  1JAQ A;  1FBL A;  1R55 A;  1SLN A;  1CQR A;  4AYK A;  1CIZ A;  3AIG A;  1GKD A;  2OY2 A;  2OI0 A;  4L63 A;  1CGL A;  1XFW A;  1BSW A;  4CTH A;  4ON1 A;  1ZTQ A;  4GR0 A;  1CK7 A;  1HTD A;  2K9C A;  3LE9 A;  1A85 A;  1PWU A;  1XUC A;  1JKY A;  3EDH A;  1KUK A;  1AF0 A;  1KUG A;  2W12 A;  4PKV A;  1DMT A;  3ELM A;  3EHX A;  2JT5 A;  2RJP A;  3DL1 A;  3CKI A;  1CAQ A;  1KUF A;  2MLS A;  2YUF A;  1DTH A;  3I7G A;  4PKS A;  2HU6 A;  3DTE A;  3HY7 A;  1SMP A;  2E3X A;  3HDA P;  1R54 A;  3NX7 A;  1BKC A;  3LQ0 A;  4IJO A;  4JA1 A;  3DTK A;  3F1A A;  3O64 A;  1H71 P;  3WV3 A;  4IN9 A;  1J7N A;  1K7Q A;  3EDZ A;  2OY4 A;  2X3B A;  4JPA A;  1YP1 A;  5D2B A;  3LKA A;  1EAK A;  4H82 A;  1IAD A;  1UMS A;  3HBV P;  5B5P A;  2D1O A;  3LJZ A;  1ZVX A;  1GXD A;  4J4M A;  4WKE A;  966C A;  3KWV C;  2MZE A;  1EUB A;  2SRT A;  1IAA A;  4JQG A;  1RM8 A;  1SU3 A;  5D3C A;  3WV1 A;  4IUW A;  1SLM A;  1R1I A;  3ZUK A;  1RMZ A;  1GKC A;  3DPE A;  3O2X A;  1MMR A;  3I7I A;  1XFU A;  1BUV M;  1K7I A;  2WOA A;  1ZXC A;  4I35 A;  3OHL A;  4L6T A;  2YIG A;  3N2V A;  4FU4 A;  5L79 A;  3LIR A;  2O36 A;  3ZVS A;  2XS4 A;  1KUH A;  1BUD A;  1XFX A;  4AUO A;  1JIZ A;  1OMJ A;  1ZXV A;  1MMQ A;  4PKQ A;  3TSK A;  4DF9 A;  2WO9 A;  3SHI A;  2FV5 A;  2DW1 A;  1IAC A;  2J0T A;  4G9L A;  1AKL A;  4H3X A;  1O0T A;  1BIW A;  1SRP A;  4GR3 A;  3LQB A;  4AIG A;  1BKC I;  2W14 A;  3F18 A;  3HY9 A;  4L19 A;  4PKW A;  2ERO A;  3N2U A;  3HBU P;  3DNG A;  1KBC A;  3EDG A;  4G0D A;  1D7X A;  3G42 A;  1Q3A A;  2JIH A;  1JIW P;  2OW1 A;  1JK3 A;  1KAP P;  2J83 A;  3E8R A;  4ZR5 A;  3HDB A;  4GWN A;  1ZP5 A;  1CXV A;  4H49 A;  3DPF A;  1PWV A;  5BOT A;  1XFZ A;  3MA2 A;  4H76 A;  1UMT A;  2CKI A;  4WKI A;  3LJT A;  1QJJ A;  1USN A;  4HX3 A;  2E2D A;  1OS2 A;  830C A;  4HMA A;  4AXQ A;  5D1U A;  4GQL A;  5H8X A;  1G05 A;  3B8Z A;  2USN A;  2OVZ A;  2OVX A;  1C3I A;  3EHY A;  5BPA A;  2Z2D A;  3TS4 A;  3B92 A;  3KME A;  2JNP A;  1QIC A;  4WK7 A;  1ATL A;  3LIK A;  1G9K A;  2DW2 A;  1IAB A;  1WNI A;  2W0D A;  4PKR A;  5LAB A;  5I3M A;  1GE7 A;  3F19 A;  2DW0 A;  2FV9 A;  2MZH A;  3F17 A;  4I03 A;  3GBO A;  1QUA A;  1HV5 A;  3KHI A;  2MLR A;  1OM8 A;  1YOU A;  1HOV A;  3DWB A;  1IAG A;  2JT6 A;  1IAE A;  1JAP A;  4WF6 A;  2DDY A;  3Q2G A;  1D8M A;  1XUR A;  2Y6D A;  3LEA A;  1GE6 A;  4ILW D;  1FM1 A;  4GUY A;  3RTS A;  3B2Z A;  1CGE A;  1HY7 A;  3V96 B;  4FVL A;  4A3W A;  2OW2 A;  4DPE A;  3EDI A;  3K7N A;  4XM6 A;  5I43 A;  1GO8 P;  1BKC E;  4GWM A;  3WV2 A;  1MMP A;  3KEC A;  2AYK A;  4WZV A;  1HFS A;  4H1Q A;  3UVC A;  3G5C A;  5D7W A;  4XBH A;  2KRJ A;  4PKU A;  1A86 A;  1BZS A;  1YCM A;  1XFY A;  1C8T A;  1ROS A;  5D1T A;  3KEJ A;  1G49 A;  1MMB A;  1L6J A;  5CZM A;  5I12 A;  1B3D A;  3P1V A;  2POJ A;  2L0R A;  1GE5 A;  2V4B A;  2JSD A;  1S4B P;  1G4K A;  2X3C A;  2YB9 A;  1JJ9 A;  1JAN A;  2K2G A;  1XFV A;  2O3E A;  2OXZ A;  1D5J A;  3AYK A;  3VTG A;  3RTT A;  3LUN A;  1Y0V A;  4XM8 A;  3LJG A;  4DV8 A;  1PWP A;  2DDF A;  4JP4 A;  1UTT A;  5BOY A;  4PKT A;  3KMC A;  2PJT A;  5JMY A;  1BQQ M;  3LK8 A;  5CXA A;  2XS3 A;  4DD8 A;  1KUI A;  1Y93 A;  3P24 A;  4R3V A;  3OHO A;  3KRY A;  1K7G A;  2X7M A;  3L0V A;  4XM7 A;  2W13 A;  4XCT A;  1OM6 A;  3F15 A;  1QIA A;  5I4O A;  3K7L A;  2OW0 A;  4Q1L A;  5B5O A;  1UTZ A;  3VI1 A;  1QJI A;  2TCL A;  1FLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...