3O2XA

Mmp-13 in complex with selective tetrazole core inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Collagenase 3
publication title MMP-13 in complex with selective tetrazole core inhibitor
rcsb
source organism Homo sapiens
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3o2xA00
1OS9A 3DWBA 3GBOA 1ND1A 2AIGP 3HY9A 1JAQA 4PKSA 3RTSA 5JMYA 1KBCA 4PKTA 1R54A 4JQGA 3F1AA 1BSWA 1BM6A 3EHXA 3LMCA 4ON1A 2CLTA 1ROSA 1XFUA 3TT4A 4XM6A 1G49A 1OO9A 4H2EA 2OY4A 2OXUA 3E8RA 1DMTA 1O0QA 3O64A 2A8HA 3I7IA 1XFVA 1PWUA 1R1JA 4PKWA 1JKYA 1XFZA 3K7NA 5I43A 3MA2A 1GKDA 2K9CA 1ZTQA 2RJPA 2MLRA 1QICA 1I76A 3Q2HA 3KECA 2OY2A 5BPAA 1EAKA 2OVZA 4I35A 5I12A 1SRPA 3ZVSA 1SMPA 2W15A 3HDAP 1MMBA 3TSKA 5BOTA 3G5CA 2DW2A 4FXQA 4WKEA 1KUFA 4QKZA 1ZP5A 3CKIA 2D1NA 1I73A 3KMEA 2POJA 1XFWA 3LJGA 2WO9A 2DDFA 4H82A 2D1OA 1JJ9A 3Q2GA 1IAAA 1OM8A 4PKQA 5H8XA 2AYKA 830CA 1CGLA 1BKCA 3K7LA 3AYKA 3L0VA 1D8FA 4J4MA 1PWPA 1UMSA 1AYKA 3EDGA 1C8TA 1SU3A 2W0DA 1CGEA 1PWWA 1UTTA 1HFSA 3AYUA 1A85A 1BIWA 1Z3JA 1CIZA 1GE6A 1Y8JA 2X3CA 2OW0A 1BUVM 1R55A 3LJZA 1C3IA 2EROA 3B8ZA 1WNIA 2JSDA 3LE9A 1G12A 2L0RA 2X3AA 4ZR5A 1CK7A 1CQRA 4H30A 2OW2A 1R1HA 3VTGA 1SLMA 3SHIA 1XFYA 2KRJA 3EDHA 3LIRA 2ERPA 1RM8A 5L7FA 1GE5A 1GO7P 1K7QA 4HX3A 1JIWP 3V96B 456CA 4Q1LA 1KAPP 4FXYP 1KUIA 1BKCE 3EDIA 3HY7A 2W13A 3KMCA 1ZXCA 4GQLA 5I2ZA 3LILA 5CZMA 1BKCI 3KHIA 3HBVP 3LIKA 3HDBA 4CTHA 3HB2P 2K2GA 1G4KA 3F19A 2YIGA 4JA1A 2OW1A 3G42A 3LQBA 3DPEA 4ILWD 1D7XA 2XS4A 4L63A 5LABA 2DDYA 4H49A 2XS3A 1GO8P 1JANA 3ZUKA 1XUDA 4JIJA 2OI0A 1BQQM 1SATA 1PWQA 1IAEA 2HU6A 4H84A 1D5JA 4AIGA 4AYKA 1G9KA 1BUDA 2O36A 1FLSA 4IUWA 3DPFA 2E2DA 1XURA 1EB6A 1IAGA 3N2VA 1DTHA 4DF9A 3F15A 2FV5A 3DL1A 1KUHA 1JIZA 5I4OA 2QPJA 1GKCA 3KEJA 4PKVA 2JNPA 2MZEA 2N8RA 1EUBA 2JIHA 2TCLA 2DW0A 4EFSA 5B5OA 3DSLA 1C7KA 2WOAA 1O0TA 4G0DA 1AKLA 3B2ZA 5I3MA 1HY7A 1H71P 1Y93A 3WV3A 4GUYA 3ELMA 3BA0A 1FBLA 1S4BP 1CAQA 2MLSA 5D2BA 1ATLA 5BOYA 2J83A 3OHLA 2I47A 3KRYA 5B5PA 3HBUP 5D7WA 3LK8A 4GF1A 1Y0VA 3LUMA 3USNA 1K7GA 2JT5A 3KWVC 4GR0A 3N2UA 3O2XA 4WK7A 3F16A 4GR3A 2E3XA 1BZSA 4DD8A 3TVCA 2CKIA 1OS2A 1GE7A 1QJIA 3WV1A 3LKAA 3OHOA 2MZHA 966CA 1XFXA 4FU4A 2OXZA 4XBHA 3VI1A 2O3EA 1HFCA 1OM7A 3EWJA 1QIAA 4AXQA 5CXAA 1D8MA 3F17A 2OVXA 5I0LA 1K7IA 1G05A 3DNGA 4A3WA 5D1SA 1CGFA 4IJOA 1ZVXA 1QUAA 2WO8A 4H3XA 1IABA 4PKUA 1HTDA 1B3DA 1YQYA 1RMZA 3B92A 4JPAA 4XM8A 1PWVA 2J0TA 3HYGA 5D3CA 1ASTA 1CXVA 4R3VA 2W12A 1MMPA 4DV8A 2FV9A 2V4BA 1HV5A 1IACA 1I1IP 1J7NA 3EHYA 1Q3AA 1YCMA 1R1IA 3L0TA 4H1QA 4XM7A 1OMJA 1OM6A 3NX7A 1FM1A 3AIGA 4A7BA 5L79A 2RJQA 3RTTA 2OZRA 2X7MA 3I7GA 2YB9A 1HOVA 1B8YA 4GWMA 2W14A 4IN9A 3LGPA 1JK3A 1SLNA 1XUCA 3ZXHA 1YOUA 4PKRA 3TS4A 5CUHA 3U1RA 1JAPA 4AUOA 3KEKA 1A86A 2OXWA 1MNCA 1KUGA 1BQOA 1JH1A 3WV2A 1YP1A 4WZVA 4WKIA 3P24A 5D1TA 3EDZA 2SRTA 4L19A 4L6TA 4FVLA 1MMQA 4WF6A 3LEAA 4GWNA 4I03A 2OW9A 3P1VA 1KUKA 3UVCA 1ZS0A 2Y6DA 4G9LA 3LQ0A 2MZIA 2PJTA 2Y6CA 2Z2DA 4JP4A 5D1UA 2JT6A 3F18A 1UTZA 2USNA 1L6JA 2X3BA 4H76A 1USNA 1JAOA 1QJJA 3LJTA 3LUNA 4XCTA 1MMRA 1UMTA 4DPEA 1ZXVA 1AF0A 4HMAA 1GXDA 1IADA 1QIBA 1UEAA 2DW1A 4GR8A 2ERQA
chains in the Genus database with same CATH superfamily
1OS9A 3DWBA 3GBOA 1ND1A 2AIGP 3HY9A 1JAQA 4PKSA 3RTSA 5JMYA 1KBCA 4PKTA 1R54A 4JQGA 3F1AA 1BSWA 1BM6A 3EHXA 3LMCA 4ON1A 2CLTA 1ROSA 1XFUA 3TT4A 4XM6A 1G49A 1OO9A 4H2EA 2OY4A 2OXUA 3E8RA 1DMTA 1O0QA 3O64A 2A8HA 3I7IA 1XFVA 1PWUA 1R1JA 4PKWA 1JKYA 1XFZA 3K7NA 5I43A 3MA2A 1GKDA 2K9CA 4L7AA 1ZTQA 2RJPA 2MLRA 1QICA 1I76A 3Q2HA 3KECA 2OY2A 5BPAA 1EAKA 2OVZA 4I35A 5I12A 1SRPA 3ZVSA 1SMPA 2W15A 3HDAP 1MMBA 3TSKA 5BOTA 3G5CA 2DW2A 4FXQA 4WKEA 1KUFA 4QKZA 1ZP5A 3CKIA 2D1NA 1I73A 3KMEA 2POJA 1XFWA 3LJGA 2WO9A 2DDFA 4H82A 2D1OA 1JJ9A 3Q2GA 1IAAA 1OM8A 4PKQA 5H8XA 2AYKA 830CA 1CGLA 1BKCA 3K7LA 3AYKA 3L0VA 1D8FA 4J4MA 1PWPA 1UMSA 1AYKA 3EDGA 1C8TA 1SU3A 2W0DA 1CGEA 1PWWA 1UTTA 1HFSA 3AYUA 1A85A 1BIWA 1Z3JA 1CIZA 1GE6A 1Y8JA 2X3CA 2OW0A 1BUVM 1R55A 3LJZA 1C3IA 2EROA 3B8ZA 1WNIA 2JSDA 3LE9A 1G12A 2L0RA 2X3AA 4ZR5A 1CK7A 1XAXA 1CQRA 4H30A 2OW2A 1R1HA 3VTGA 1SLMA 3SHIA 1XFYA 2KRJA 3EDHA 3LIRA 2ERPA 1RM8A 5L7FA 1GE5A 1GO7P 1K7QA 4HX3A 1JIWP 3V96B 456CA 4Q1LA 1KAPP 4FXYP 1KUIA 1BKCE 3EDIA 3HY7A 2W13A 3KMCA 1ZXCA 4GQLA 1TVIA 5I2ZA 3LILA 5CZMA 1BKCI 3KHIA 3HBVP 3LIKA 3HDBA 4CTHA 3HB2P 2K2GA 1G4KA 3F19A 2YIGA 4JA1A 2OW1A 3G42A 3LQBA 3DPEA 1XM5A 4ILWD 1D7XA 2XS4A 4L63A 5LABA 2DDYA 4H49A 2XS3A 1GO8P 1JANA 3ZUKA 1XUDA 4JIJA 2OI0A 1BQQM 1SATA 1PWQA 1IAEA 2HU6A 4H84A 1D5JA 4AIGA 4AYKA 1G9KA 1BUDA 2O36A 1FLSA 4IUWA 3DPFA 2E2DA 1XURA 1EB6A 1IAGA 3N2VA 1DTHA 4DF9A 3F15A 2FV5A 3DL1A 1KUHA 1JIZA 5I4OA 2QPJA 1GKCA 3KEJA 4PKVA 2JNPA 2MZEA 2N8RA 1EUBA 2JIHA 2TCLA 2DW0A 4EFSA 5B5OA 3DSLA 1C7KA 2WOAA 1O0TA 4G0DA 1AKLA 3B2ZA 5I3MA 1HY7A 1H71P 1Y93A 3WV3A 4GUYA 3ELMA 3BA0A 1FBLA 1S4BP 1CAQA 2MLSA 5D2BA 1ATLA 5BOYA 2J83A 3OHLA 2I47A 3KRYA 5B5PA 3HBUP 5D7WA 3LK8A 4GF1A 1Y0VA 3LUMA 3USNA 1K7GA 2JT5A 3KWVC 4GR0A 3N2UA 3O2XA 4WK7A 3F16A 4GR3A 2E3XA 1BZSA 4DD8A 3TVCA 2CKIA 1OS2A 1GE7A 1QJIA 3WV1A 3LKAA 3OHOA 2MZHA 966CA 1XFXA 4FU4A 2OXZA 4XBHA 3VI1A 2O3EA 1HFCA 1OM7A 3EWJA 1QIAA 4AXQA 5CXAA 1D8MA 3F17A 2OVXA 5I0LA 1K7IA 1G05A 3DNGA 4A3WA 5D1SA 1CGFA 4IJOA 1ZVXA 1QUAA 2WO8A 4H3XA 1IABA 4PKUA 1HTDA 1B3DA 1YQYA 1RMZA 1OZ9A 3B92A 4JPAA 4XM8A 1PWVA 2J0TA 3HYGA 5D3CA 1ASTA 1CXVA 4R3VA 2W12A 1MMPA 4DV8A 2FV9A 2V4BA 3DTIA 1HV5A 1IACA 1I1IP 1J7NA 3EHYA 1Q3AA 1YCMA 1R1IA 3L0TA 4H1QA 4XM7A 1OMJA 1OM6A 3NX7A 1FM1A 3AIGA 4A7BA 5L79A 2RJQA 3DTEA 3RTTA 2OZRA 2X7MA 3I7GA 2YB9A 1HOVA 1B8YA 4GWMA 2W14A 4IN9A 3LGPA 1JK3A 1SLNA 1XUCA 3ZXHA 1YOUA 4PKRA 3TS4A 5CUHA 3U1RA 1JAPA 4AUOA 3KEKA 1A86A 2OXWA 1MNCA 1KUGA 1BQOA 1JH1A 3WV2A 1YP1A 4WZVA 4WKIA 3P24A 5D1TA 3EDZA 2SRTA 4L19A 4L6TA 4FVLA 1MMQA 4WF6A 3LEAA 4GWNA 4I03A 2OW9A 3P1VA 1KUKA 3UVCA 1ZS0A 2Y6DA 4G9LA 3LQ0A 2MZIA 2PJTA 2Y6CA 2Z2DA 2YUFA 4JP4A 5D1UA 2JT6A 3F18A 1UTZA 2USNA 1L6JA 2X3BA 3DTKA 4H76A 1USNA 1JAOA 1QJJA 3LJTA 3LUNA 4XCTA 1MMRA 1UMTA 4DPEA 1ZXVA 1AF0A 4HMAA 1GXDA 1IADA 1QIBA 1UEAA 2DW1A 4GR8A 2ERQA
chains in the Genus database with same CATH topology
1OS9A 3DWBA 3GBOA 1ND1A 2AIGP 3HY9A 1JAQA 4PKSA 3RTSA 5JMYA 1KBCA 4PKTA 1R54A 4JQGA 3F1AA 1BSWA 1BM6A 3EHXA 3LMCA 4ON1A 2CLTA 1ROSA 1XFUA 3TT4A 4XM6A 1G49A 1OO9A 4H2EA 2OY4A 2OXUA 3E8RA 1DMTA 1O0QA 3O64A 2A8HA 3I7IA 1XFVA 1PWUA 1R1JA 4PKWA 1JKYA 1XFZA 3K7NA 5I43A 3MA2A 1GKDA 2K9CA 4L7AA 1ZTQA 2RJPA 2MLRA 1QICA 1I76A 3Q2HA 3KECA 2OY2A 5BPAA 1EAKA 2OVZA 4I35A 5I12A 1SRPA 3ZVSA 1SMPA 2W15A 3HDAP 1MMBA 3TSKA 5BOTA 3G5CA 2DW2A 4FXQA 4WKEA 1KUFA 4QKZA 1ZP5A 3CKIA 2D1NA 1I73A 3KMEA 2POJA 1XFWA 3LJGA 2WO9A 2DDFA 4H82A 2D1OA 1JJ9A 3Q2GA 1IAAA 1OM8A 4PKQA 5H8XA 2AYKA 830CA 1CGLA 1BKCA 3K7LA 3AYKA 3L0VA 1D8FA 4J4MA 1PWPA 1UMSA 1AYKA 3EDGA 1C8TA 1SU3A 2W0DA 1CGEA 1PWWA 1UTTA 1HFSA 3AYUA 1A85A 1BIWA 1Z3JA 1CIZA 1GE6A 1Y8JA 2X3CA 2OW0A 1BUVM 1R55A 3LJZA 1C3IA 2EROA 3B8ZA 1WNIA 2JSDA 3LE9A 1G12A 2L0RA 2X3AA 4ZR5A 1CK7A 1CQRA 4H30A 2OW2A 1R1HA 3VTGA 1SLMA 3SHIA 1XFYA 2KRJA 3EDHA 3LIRA 2ERPA 1RM8A 5L7FA 1GE5A 1GO7P 1K7QA 4HX3A 1JIWP 3V96B 456CA 4Q1LA 1KAPP 4FXYP 1KUIA 1BKCE 3EDIA 3HY7A 2W13A 3KMCA 1ZXCA 4GQLA 5I2ZA 3LILA 5CZMA 1BKCI 3KHIA 3HBVP 3LIKA 3HDBA 4CTHA 3HB2P 2K2GA 1G4KA 3F19A 2YIGA 4JA1A 2OW1A 3G42A 3LQBA 3DPEA 4ILWD 1D7XA 2XS4A 4L63A 5LABA 2DDYA 4H49A 2XS3A 1GO8P 1JANA 3ZUKA 1XUDA 4JIJA 2OI0A 1BQQM 1SATA 1PWQA 1IAEA 2HU6A 4H84A 1D5JA 4AIGA 4AYKA 1G9KA 1BUDA 2O36A 1FLSA 4IUWA 3DPFA 2E2DA 1XURA 1EB6A 1IAGA 3N2VA 1DTHA 4DF9A 3F15A 2FV5A 3DL1A 1KUHA 1JIZA 5I4OA 2QPJA 1GKCA 3KEJA 4PKVA 2JNPA 2MZEA 2N8RA 1EUBA 2JIHA 2TCLA 2DW0A 4EFSA 5B5OA 3DSLA 1C7KA 2WOAA 1O0TA 4G0DA 1AKLA 3B2ZA 5I3MA 1HY7A 1H71P 1Y93A 3WV3A 4GUYA 3ELMA 3BA0A 1FBLA 1S4BP 1CAQA 2MLSA 5D2BA 1ATLA 5BOYA 2J83A 3OHLA 2I47A 3KRYA 5B5PA 3HBUP 5D7WA 3LK8A 4GF1A 1Y0VA 3LUMA 3USNA 1K7GA 2JT5A 3KWVC 4GR0A 3N2UA 3O2XA 4WK7A 3F16A 4GR3A 2E3XA 1BZSA 4DD8A 3TVCA 2CKIA 1OS2A 1GE7A 1QJIA 3WV1A 3LKAA 3OHOA 2MZHA 966CA 1XFXA 4FU4A 2OXZA 4XBHA 3VI1A 2O3EA 1HFCA 1OM7A 3EWJA 1QIAA 4AXQA 5CXAA 1D8MA 3F17A 2OVXA 5I0LA 1K7IA 1G05A 3DNGA 4A3WA 5D1SA 1CGFA 4IJOA 1ZVXA 1QUAA 2WO8A 4H3XA 1IABA 4PKUA 1HTDA 1B3DA 1YQYA 1RMZA 3B92A 4JPAA 4XM8A 1PWVA 2J0TA 3HYGA 5D3CA 1ASTA 1CXVA 4R3VA 2W12A 1MMPA 4DV8A 2FV9A 2V4BA 3DTIA 1HV5A 1IACA 1I1IP 1J7NA 3EHYA 1Q3AA 1YCMA 1R1IA 3L0TA 4H1QA 4XM7A 1OMJA 1OM6A 3NX7A 1FM1A 3AIGA 4A7BA 5L79A 2RJQA 3DTEA 3RTTA 2OZRA 2X7MA 3I7GA 2YB9A 1HOVA 1B8YA 4GWMA 2W14A 4IN9A 3LGPA 1JK3A 1SLNA 1XUCA 3ZXHA 1YOUA 4PKRA 3TS4A 5CUHA 3U1RA 1JAPA 4AUOA 3KEKA 1A86A 2OXWA 1MNCA 1KUGA 1BQOA 1JH1A 3WV2A 1YP1A 4WZVA 4WKIA 3P24A 5D1TA 3EDZA 2SRTA 4L19A 4L6TA 4FVLA 1MMQA 4WF6A 3LEAA 4GWNA 4I03A 2OW9A 3P1VA 1KUKA 3UVCA 1ZS0A 2Y6DA 4G9LA 3LQ0A 2MZIA 2PJTA 2Y6CA 2Z2DA 2YUFA 4JP4A 5D1UA 2JT6A 3F18A 1UTZA 2USNA 1L6JA 2X3BA 3DTKA 4H76A 1USNA 1JAOA 1QJJA 3LJTA 3LUNA 4XCTA 1MMRA 1UMTA 4DPEA 1ZXVA 1AF0A 4HMAA 1GXDA 1IADA 1QIBA 1UEAA 2DW1A 4GR8A 2ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OS9 A;  3DWB A;  3GBO A;  1ND1 A;  2AIG P;  3HY9 A;  1JAQ A;  4PKS A;  3RTS A;  5JMY A;  1KBC A;  4PKT A;  1R54 A;  4JQG A;  3F1A A;  1BSW A;  1BM6 A;  3EHX A;  3LMC A;  4ON1 A;  2CLT A;  1ROS A;  1XFU A;  3TT4 A;  4XM6 A;  1G49 A;  1OO9 A;  4H2E A;  2OY4 A;  2OXU A;  3E8R A;  1DMT A;  1O0Q A;  3O64 A;  2A8H A;  3I7I A;  1XFV A;  1PWU A;  1R1J A;  4PKW A;  1JKY A;  1XFZ A;  3K7N A;  5I43 A;  3MA2 A;  1GKD A;  2K9C A;  1ZTQ A;  2RJP A;  2MLR A;  1QIC A;  1I76 A;  3Q2H A;  3KEC A;  2OY2 A;  5BPA A;  1EAK A;  2OVZ A;  4I35 A;  5I12 A;  1SRP A;  3ZVS A;  1SMP A;  2W15 A;  3HDA P;  1MMB A;  3TSK A;  5BOT A;  3G5C A;  2DW2 A;  4FXQ A;  4WKE A;  1KUF A;  4QKZ A;  1ZP5 A;  3CKI A;  2D1N A;  1I73 A;  3KME A;  2POJ A;  1XFW A;  3LJG A;  2WO9 A;  2DDF A;  4H82 A;  2D1O A;  1JJ9 A;  3Q2G A;  1IAA A;  1OM8 A;  4PKQ A;  5H8X A;  2AYK A;  830C A;  1CGL A;  1BKC A;  3K7L A;  3AYK A;  3L0V A;  1D8F A;  4J4M A;  1PWP A;  1UMS A;  1AYK A;  3EDG A;  1C8T A;  1SU3 A;  2W0D A;  1CGE A;  1PWW A;  1UTT A;  1HFS A;  3AYU A;  1A85 A;  1BIW A;  1Z3J A;  1CIZ A;  1GE6 A;  1Y8J A;  2X3C A;  2OW0 A;  1BUV M;  1R55 A;  3LJZ A;  1C3I A;  2ERO A;  3B8Z A;  1WNI A;  2JSD A;  3LE9 A;  1G12 A;  2L0R A;  2X3A A;  4ZR5 A;  1CK7 A;  1CQR A;  4H30 A;  2OW2 A;  1R1H A;  3VTG A;  1SLM A;  3SHI A;  1XFY A;  2KRJ A;  3EDH A;  3LIR A;  2ERP A;  1RM8 A;  5L7F A;  1GE5 A;  1GO7 P;  1K7Q A;  4HX3 A;  1JIW P;  3V96 B;  456C A;  4Q1L A;  1KAP P;  4FXY P;  1KUI A;  1BKC E;  3EDI A;  3HY7 A;  2W13 A;  3KMC A;  1ZXC A;  4GQL A;  5I2Z A;  3LIL A;  5CZM A;  1BKC I;  3KHI A;  3HBV P;  3LIK A;  3HDB A;  4CTH A;  3HB2 P;  2K2G A;  1G4K A;  3F19 A;  2YIG A;  4JA1 A;  2OW1 A;  3G42 A;  3LQB A;  3DPE A;  4ILW D;  1D7X A;  2XS4 A;  4L63 A;  5LAB A;  2DDY A;  4H49 A;  2XS3 A;  1GO8 P;  1JAN A;  3ZUK A;  1XUD A;  4JIJ A;  2OI0 A;  1BQQ M;  1SAT A;  1PWQ A;  1IAE A;  2HU6 A;  4H84 A;  1D5J A;  4AIG A;  4AYK A;  1G9K A;  1BUD A;  2O36 A;  1FLS A;  4IUW A;  3DPF A;  2E2D A;  1XUR A;  1EB6 A;  1IAG A;  3N2V A;  1DTH A;  4DF9 A;  3F15 A;  2FV5 A;  3DL1 A;  1KUH A;  1JIZ A;  5I4O A;  2QPJ A;  1GKC A;  3KEJ A;  4PKV A;  2JNP A;  2MZE A;  2N8R A;  1EUB A;  2JIH A;  2TCL A;  2DW0 A;  4EFS A;  5B5O A;  3DSL A;  1C7K A;  2WOA A;  1O0T A;  4G0D A;  1AKL A;  3B2Z A;  5I3M A;  1HY7 A;  1H71 P;  1Y93 A;  3WV3 A;  4GUY A;  3ELM A;  3BA0 A;  1FBL A;  1S4B P;  1CAQ A;  2MLS A;  5D2B A;  1ATL A;  5BOY A;  2J83 A;  3OHL A;  2I47 A;  3KRY A;  5B5P A;  3HBU P;  5D7W A;  3LK8 A;  4GF1 A;  1Y0V A;  3LUM A;  3USN A;  1K7G A;  2JT5 A;  3KWV C;  4GR0 A;  3N2U A;  3O2X A;  4WK7 A;  3F16 A;  4GR3 A;  2E3X A;  1BZS A;  4DD8 A;  3TVC A;  2CKI A;  1OS2 A;  1GE7 A;  1QJI A;  3WV1 A;  3LKA A;  3OHO A;  2MZH A;  966C A;  1XFX A;  4FU4 A;  2OXZ A;  4XBH A;  3VI1 A;  2O3E A;  1HFC A;  1OM7 A;  3EWJ A;  1QIA A;  4AXQ A;  5CXA A;  1D8M A;  3F17 A;  2OVX A;  5I0L A;  1K7I A;  1G05 A;  3DNG A;  4A3W A;  5D1S A;  1CGF A;  4IJO A;  1ZVX A;  1QUA A;  2WO8 A;  4H3X A;  1IAB A;  4PKU A;  1HTD A;  1B3D A;  1YQY A;  1RMZ A;  3B92 A;  4JPA A;  4XM8 A;  1PWV A;  2J0T A;  3HYG A;  5D3C A;  1AST A;  1CXV A;  4R3V A;  2W12 A;  1MMP A;  4DV8 A;  2FV9 A;  2V4B A;  1HV5 A;  1IAC A;  1I1I P;  1J7N A;  3EHY A;  1Q3A A;  1YCM A;  1R1I A;  3L0T A;  4H1Q A;  4XM7 A;  1OMJ A;  1OM6 A;  3NX7 A;  1FM1 A;  3AIG A;  4A7B A;  5L79 A;  2RJQ A;  3RTT A;  2OZR A;  2X7M A;  3I7G A;  2YB9 A;  1HOV A;  1B8Y A;  4GWM A;  2W14 A;  4IN9 A;  3LGP A;  1JK3 A;  1SLN A;  1XUC A;  3ZXH A;  1YOU A;  4PKR A;  3TS4 A;  5CUH A;  3U1R A;  1JAP A;  4AUO A;  3KEK A;  1A86 A;  2OXW A;  1MNC A;  1KUG A;  1BQO A;  1JH1 A;  3WV2 A;  1YP1 A;  4WZV A;  4WKI A;  3P24 A;  5D1T A;  3EDZ A;  2SRT A;  4L19 A;  4L6T A;  4FVL A;  1MMQ A;  4WF6 A;  3LEA A;  4GWN A;  4I03 A;  2OW9 A;  3P1V A;  1KUK A;  3UVC A;  1ZS0 A;  2Y6D A;  4G9L A;  3LQ0 A;  2MZI A;  2PJT A;  2Y6C A;  2Z2D A;  4JP4 A;  5D1U A;  2JT6 A;  3F18 A;  1UTZ A;  2USN A;  1L6J A;  2X3B A;  4H76 A;  1USN A;  1JAO A;  1QJJ A;  3LJT A;  3LUN A;  4XCT A;  1MMR A;  1UMT A;  4DPE A;  1ZXV A;  1AF0 A;  4HMA A;  1GXD A;  1IAD A;  1QIB A;  1UEA A;  2DW1 A;  4GR8 A;  2ERQ A; 
#chains in the Genus database with same CATH topology
 1OS9 A;  3DWB A;  3GBO A;  1ND1 A;  2AIG P;  3HY9 A;  1JAQ A;  4PKS A;  3RTS A;  5JMY A;  1KBC A;  4PKT A;  1R54 A;  4JQG A;  3F1A A;  1BSW A;  1BM6 A;  3EHX A;  3LMC A;  4ON1 A;  2CLT A;  1ROS A;  1XFU A;  3TT4 A;  4XM6 A;  1G49 A;  1OO9 A;  4H2E A;  2OY4 A;  2OXU A;  3E8R A;  1DMT A;  1O0Q A;  3O64 A;  2A8H A;  3I7I A;  1XFV A;  1PWU A;  1R1J A;  4PKW A;  1JKY A;  1XFZ A;  3K7N A;  5I43 A;  3MA2 A;  1GKD A;  2K9C A;  4L7A A;  1ZTQ A;  2RJP A;  2MLR A;  1QIC A;  1I76 A;  3Q2H A;  3KEC A;  2OY2 A;  5BPA A;  1EAK A;  2OVZ A;  4I35 A;  5I12 A;  1SRP A;  3ZVS A;  1SMP A;  2W15 A;  3HDA P;  1MMB A;  3TSK A;  5BOT A;  3G5C A;  2DW2 A;  4FXQ A;  4WKE A;  1KUF A;  4QKZ A;  1ZP5 A;  3CKI A;  2D1N A;  1I73 A;  3KME A;  2POJ A;  1XFW A;  3LJG A;  2WO9 A;  2DDF A;  4H82 A;  2D1O A;  1JJ9 A;  3Q2G A;  1IAA A;  1OM8 A;  4PKQ A;  5H8X A;  2AYK A;  830C A;  1CGL A;  1BKC A;  3K7L A;  3AYK A;  3L0V A;  1D8F A;  4J4M A;  1PWP A;  1UMS A;  1AYK A;  3EDG A;  1C8T A;  1SU3 A;  2W0D A;  1CGE A;  1PWW A;  1UTT A;  1HFS A;  3AYU A;  1A85 A;  1BIW A;  1Z3J A;  1CIZ A;  1GE6 A;  1Y8J A;  2X3C A;  2OW0 A;  1BUV M;  1R55 A;  3LJZ A;  1C3I A;  2ERO A;  3B8Z A;  1WNI A;  2JSD A;  3LE9 A;  1G12 A;  2L0R A;  2X3A A;  4ZR5 A;  1CK7 A;  1XAX A;  1CQR A;  4H30 A;  2OW2 A;  1R1H A;  3VTG A;  1SLM A;  3SHI A;  1XFY A;  2KRJ A;  3EDH A;  3LIR A;  2ERP A;  1RM8 A;  5L7F A;  1GE5 A;  1GO7 P;  1K7Q A;  4HX3 A;  1JIW P;  3V96 B;  456C A;  4Q1L A;  1KAP P;  4FXY P;  1KUI A;  1BKC E;  3EDI A;  3HY7 A;  2W13 A;  3KMC A;  1ZXC A;  4GQL A;  1TVI A;  5I2Z A;  3LIL A;  5CZM A;  1BKC I;  3KHI A;  3HBV P;  3LIK A;  3HDB A;  4CTH A;  3HB2 P;  2K2G A;  1G4K A;  3F19 A;  2YIG A;  4JA1 A;  2OW1 A;  3G42 A;  3LQB A;  3DPE A;  1XM5 A;  4ILW D;  1D7X A;  2XS4 A;  4L63 A;  5LAB A;  2DDY A;  4H49 A;  2XS3 A;  1GO8 P;  1JAN A;  3ZUK A;  1XUD A;  4JIJ A;  2OI0 A;  1BQQ M;  1SAT A;  1PWQ A;  1IAE A;  2HU6 A;  4H84 A;  1D5J A;  4AIG A;  4AYK A;  1G9K A;  1BUD A;  2O36 A;  1FLS A;  4IUW A;  3DPF A;  2E2D A;  1XUR A;  1EB6 A;  1IAG A;  3N2V A;  1DTH A;  4DF9 A;  3F15 A;  2FV5 A;  3DL1 A;  1KUH A;  1JIZ A;  5I4O A;  2QPJ A;  1GKC A;  3KEJ A;  4PKV A;  2JNP A;  2MZE A;  2N8R A;  1EUB A;  2JIH A;  2TCL A;  2DW0 A;  4EFS A;  5B5O A;  3DSL A;  1C7K A;  2WOA A;  1O0T A;  4G0D A;  1AKL A;  3B2Z A;  5I3M A;  1HY7 A;  1H71 P;  1Y93 A;  3WV3 A;  4GUY A;  3ELM A;  3BA0 A;  1FBL A;  1S4B P;  1CAQ A;  2MLS A;  5D2B A;  1ATL A;  5BOY A;  2J83 A;  3OHL A;  2I47 A;  3KRY A;  5B5P A;  3HBU P;  5D7W A;  3LK8 A;  4GF1 A;  1Y0V A;  3LUM A;  3USN A;  1K7G A;  2JT5 A;  3KWV C;  4GR0 A;  3N2U A;  3O2X A;  4WK7 A;  3F16 A;  4GR3 A;  2E3X A;  1BZS A;  4DD8 A;  3TVC A;  2CKI A;  1OS2 A;  1GE7 A;  1QJI A;  3WV1 A;  3LKA A;  3OHO A;  2MZH A;  966C A;  1XFX A;  4FU4 A;  2OXZ A;  4XBH A;  3VI1 A;  2O3E A;  1HFC A;  1OM7 A;  3EWJ A;  1QIA A;  4AXQ A;  5CXA A;  1D8M A;  3F17 A;  2OVX A;  5I0L A;  1K7I A;  1G05 A;  3DNG A;  4A3W A;  5D1S A;  1CGF A;  4IJO A;  1ZVX A;  1QUA A;  2WO8 A;  4H3X A;  1IAB A;  4PKU A;  1HTD A;  1B3D A;  1YQY A;  1RMZ A;  1OZ9 A;  3B92 A;  4JPA A;  4XM8 A;  1PWV A;  2J0T A;  3HYG A;  5D3C A;  1AST A;  1CXV A;  4R3V A;  2W12 A;  1MMP A;  4DV8 A;  2FV9 A;  2V4B A;  3DTI A;  1HV5 A;  1IAC A;  1I1I P;  1J7N A;  3EHY A;  1Q3A A;  1YCM A;  1R1I A;  3L0T A;  4H1Q A;  4XM7 A;  1OMJ A;  1OM6 A;  3NX7 A;  1FM1 A;  3AIG A;  4A7B A;  5L79 A;  2RJQ A;  3DTE A;  3RTT A;  2OZR A;  2X7M A;  3I7G A;  2YB9 A;  1HOV A;  1B8Y A;  4GWM A;  2W14 A;  4IN9 A;  3LGP A;  1JK3 A;  1SLN A;  1XUC A;  3ZXH A;  1YOU A;  4PKR A;  3TS4 A;  5CUH A;  3U1R A;  1JAP A;  4AUO A;  3KEK A;  1A86 A;  2OXW A;  1MNC A;  1KUG A;  1BQO A;  1JH1 A;  3WV2 A;  1YP1 A;  4WZV A;  4WKI A;  3P24 A;  5D1T A;  3EDZ A;  2SRT A;  4L19 A;  4L6T A;  4FVL A;  1MMQ A;  4WF6 A;  3LEA A;  4GWN A;  4I03 A;  2OW9 A;  3P1V A;  1KUK A;  3UVC A;  1ZS0 A;  2Y6D A;  4G9L A;  3LQ0 A;  2MZI A;  2PJT A;  2Y6C A;  2Z2D A;  2YUF A;  4JP4 A;  5D1U A;  2JT6 A;  3F18 A;  1UTZ A;  2USN A;  1L6J A;  2X3B A;  3DTK A;  4H76 A;  1USN A;  1JAO A;  1QJJ A;  3LJT A;  3LUN A;  4XCT A;  1MMR A;  1UMT A;  4DPE A;  1ZXV A;  1AF0 A;  4HMA A;  1GXD A;  1IAD A;  1QIB A;  1UEA A;  2DW1 A;  4GR8 A;  2ERQ A; 
#chains in the Genus database with same CATH homology
 1OS9 A;  3DWB A;  3GBO A;  1ND1 A;  2AIG P;  3HY9 A;  1JAQ A;  4PKS A;  3RTS A;  5JMY A;  1KBC A;  4PKT A;  1R54 A;  4JQG A;  3F1A A;  1BSW A;  1BM6 A;  3EHX A;  3LMC A;  4ON1 A;  2CLT A;  1ROS A;  1XFU A;  3TT4 A;  4XM6 A;  1G49 A;  1OO9 A;  4H2E A;  2OY4 A;  2OXU A;  3E8R A;  1DMT A;  1O0Q A;  3O64 A;  2A8H A;  3I7I A;  1XFV A;  1PWU A;  1R1J A;  4PKW A;  1JKY A;  1XFZ A;  3K7N A;  5I43 A;  3MA2 A;  1GKD A;  2K9C A;  4L7A A;  1ZTQ A;  2RJP A;  2MLR A;  1QIC A;  1I76 A;  3Q2H A;  3KEC A;  2OY2 A;  5BPA A;  1EAK A;  2OVZ A;  4I35 A;  5I12 A;  1SRP A;  3ZVS A;  1SMP A;  2W15 A;  3HDA P;  1MMB A;  3TSK A;  5BOT A;  3G5C A;  2DW2 A;  4FXQ A;  4WKE A;  1KUF A;  4QKZ A;  1ZP5 A;  3CKI A;  2D1N A;  1I73 A;  3KME A;  2POJ A;  1XFW A;  3LJG A;  2WO9 A;  2DDF A;  4H82 A;  2D1O A;  1JJ9 A;  3Q2G A;  1IAA A;  1OM8 A;  4PKQ A;  5H8X A;  2AYK A;  830C A;  1CGL A;  1BKC A;  3K7L A;  3AYK A;  3L0V A;  1D8F A;  4J4M A;  1PWP A;  1UMS A;  1AYK A;  3EDG A;  1C8T A;  1SU3 A;  2W0D A;  1CGE A;  1PWW A;  1UTT A;  1HFS A;  3AYU A;  1A85 A;  1BIW A;  1Z3J A;  1CIZ A;  1GE6 A;  1Y8J A;  2X3C A;  2OW0 A;  1BUV M;  1R55 A;  3LJZ A;  1C3I A;  2ERO A;  3B8Z A;  1WNI A;  2JSD A;  3LE9 A;  1G12 A;  2L0R A;  2X3A A;  4ZR5 A;  1CK7 A;  1CQR A;  4H30 A;  2OW2 A;  1R1H A;  3VTG A;  1SLM A;  3SHI A;  1XFY A;  2KRJ A;  3EDH A;  3LIR A;  2ERP A;  1RM8 A;  5L7F A;  1GE5 A;  1GO7 P;  1K7Q A;  4HX3 A;  1JIW P;  3V96 B;  456C A;  4Q1L A;  1KAP P;  4FXY P;  1KUI A;  1BKC E;  3EDI A;  3HY7 A;  2W13 A;  3KMC A;  1ZXC A;  4GQL A;  5I2Z A;  3LIL A;  5CZM A;  1BKC I;  3KHI A;  3HBV P;  3LIK A;  3HDB A;  4CTH A;  3HB2 P;  2K2G A;  1G4K A;  3F19 A;  2YIG A;  4JA1 A;  2OW1 A;  3G42 A;  3LQB A;  3DPE A;  4ILW D;  1D7X A;  2XS4 A;  4L63 A;  5LAB A;  2DDY A;  4H49 A;  2XS3 A;  1GO8 P;  1JAN A;  3ZUK A;  1XUD A;  4JIJ A;  2OI0 A;  1BQQ M;  1SAT A;  1PWQ A;  1IAE A;  2HU6 A;  4H84 A;  1D5J A;  4AIG A;  4AYK A;  1G9K A;  1BUD A;  2O36 A;  1FLS A;  4IUW A;  3DPF A;  2E2D A;  1XUR A;  1EB6 A;  1IAG A;  3N2V A;  1DTH A;  4DF9 A;  3F15 A;  2FV5 A;  3DL1 A;  1KUH A;  1JIZ A;  5I4O A;  2QPJ A;  1GKC A;  3KEJ A;  4PKV A;  2JNP A;  2MZE A;  2N8R A;  1EUB A;  2JIH A;  2TCL A;  2DW0 A;  4EFS A;  5B5O A;  3DSL A;  1C7K A;  2WOA A;  1O0T A;  4G0D A;  1AKL A;  3B2Z A;  5I3M A;  1HY7 A;  1H71 P;  1Y93 A;  3WV3 A;  4GUY A;  3ELM A;  3BA0 A;  1FBL A;  1S4B P;  1CAQ A;  2MLS A;  5D2B A;  1ATL A;  5BOY A;  2J83 A;  3OHL A;  2I47 A;  3KRY A;  5B5P A;  3HBU P;  5D7W A;  3LK8 A;  4GF1 A;  1Y0V A;  3LUM A;  3USN A;  1K7G A;  2JT5 A;  3KWV C;  4GR0 A;  3N2U A;  3O2X A;  4WK7 A;  3F16 A;  4GR3 A;  2E3X A;  1BZS A;  4DD8 A;  3TVC A;  2CKI A;  1OS2 A;  1GE7 A;  1QJI A;  3WV1 A;  3LKA A;  3OHO A;  2MZH A;  966C A;  1XFX A;  4FU4 A;  2OXZ A;  4XBH A;  3VI1 A;  2O3E A;  1HFC A;  1OM7 A;  3EWJ A;  1QIA A;  4AXQ A;  5CXA A;  1D8M A;  3F17 A;  2OVX A;  5I0L A;  1K7I A;  1G05 A;  3DNG A;  4A3W A;  5D1S A;  1CGF A;  4IJO A;  1ZVX A;  1QUA A;  2WO8 A;  4H3X A;  1IAB A;  4PKU A;  1HTD A;  1B3D A;  1YQY A;  1RMZ A;  3B92 A;  4JPA A;  4XM8 A;  1PWV A;  2J0T A;  3HYG A;  5D3C A;  1AST A;  1CXV A;  4R3V A;  2W12 A;  1MMP A;  4DV8 A;  2FV9 A;  2V4B A;  3DTI A;  1HV5 A;  1IAC A;  1I1I P;  1J7N A;  3EHY A;  1Q3A A;  1YCM A;  1R1I A;  3L0T A;  4H1Q A;  4XM7 A;  1OMJ A;  1OM6 A;  3NX7 A;  1FM1 A;  3AIG A;  4A7B A;  5L79 A;  2RJQ A;  3DTE A;  3RTT A;  2OZR A;  2X7M A;  3I7G A;  2YB9 A;  1HOV A;  1B8Y A;  4GWM A;  2W14 A;  4IN9 A;  3LGP A;  1JK3 A;  1SLN A;  1XUC A;  3ZXH A;  1YOU A;  4PKR A;  3TS4 A;  5CUH A;  3U1R A;  1JAP A;  4AUO A;  3KEK A;  1A86 A;  2OXW A;  1MNC A;  1KUG A;  1BQO A;  1JH1 A;  3WV2 A;  1YP1 A;  4WZV A;  4WKI A;  3P24 A;  5D1T A;  3EDZ A;  2SRT A;  4L19 A;  4L6T A;  4FVL A;  1MMQ A;  4WF6 A;  3LEA A;  4GWN A;  4I03 A;  2OW9 A;  3P1V A;  1KUK A;  3UVC A;  1ZS0 A;  2Y6D A;  4G9L A;  3LQ0 A;  2MZI A;  2PJT A;  2Y6C A;  2Z2D A;  2YUF A;  4JP4 A;  5D1U A;  2JT6 A;  3F18 A;  1UTZ A;  2USN A;  1L6J A;  2X3B A;  3DTK A;  4H76 A;  1USN A;  1JAO A;  1QJJ A;  3LJT A;  3LUN A;  4XCT A;  1MMR A;  1UMT A;  4DPE A;  1ZXV A;  1AF0 A;  4HMA A;  1GXD A;  1IAD A;  1QIB A;  1UEA A;  2DW1 A;  4GR8 A;  2ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...