3O2XA

Mmp-13 in complex with selective tetrazole core inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
b'ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase 3
publication title MMP-13 in complex with selective tetrazole core inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3o2xA00
4IJOA 3EWJA 1PWVA 3N2VA 3HBUP 5BPAA 1JH1A 3LJTA 2MZHA 1R1HA 4H82A 1OM6A 1PWUA 3V96B 4J4MA 1QIAA 3WV1A 1R1IA 3TS4A 1JIWP 1AKLA 1SRPA 1HTDA 4EFSA 1L6JA 1KUFA 1CAQA 1S4BP 5B5PA 4GWMA 5D3CA 3F18A 4Q1LA 4H2EA 3ZUKA 1FBLA 2OW1A 2QPJA 1UTTA 2W13A 4AXQA 4FXYP 4GQLA 3TT4A 4IN9A 3L0TA 4PKTA 4G0DA 1EAKA 4DPEA 1HV5A 2OXUA 1PWQA 2D1NA 2OY4A 3DNGA 1CK7A 1HFSA 2OW2A 3LGPA 1WNIA 4AYKA 1KUKA 4H84A 4PKUA 456CA 4L6TA 1PWPA 5CUHA 1ND1A 4WF6A 2E3XA 4HX3A 2CKIA 1A85A 3EDGA 5D2BA 3ELMA 3HB2P 1C8TA 2E2DA 3LE9A 1BUDA 3KWVC 4XCTA 1USNA 3LK8A 1XUDA 1GO8P 3AIGA 1UTZA 1OM8A 2RJQA 2L0RA 1KUHA 1AF0A 5I2ZA 3O2XA 1IAEA 4FU4A 3G5CA 3LQBA 1JAOA 4JPAA 1I73A 830CA 1D5JA 1QJJA 3Q2GA 4QKZA 1ZP5A 1R1JA 1K7IA 3TSKA 1GO7P 1Q3AA 3OHOA 3U1RA 2AYKA 2OVXA 2Z2DA 1GE6A 966CA 4I03A 2O36A 3LUNA 1MMQA 1GXDA 2Y6DA 2WO8A 3EHXA 5H8XA 2OI0A 4JA1A 4H3XA 1G4KA 1UMSA 1IABA 2OZRA 4WKIA 3MA2A 4I35A 1CXVA 4GR8A 3ZVSA 3N2UA 2J0TA 2K9CA 3DL1A 2JIHA 1SU3A 3ZXHA 1BIWA 1D8MA 1Z3JA 3WV3A 1QICA 1FLSA 2WOAA 1XURA 1K7GA 2TCLA 1C7KA 2AIGP 3P24A 4DD8A 1EB6A 1A86A 1IADA 4JP4A 3VI1A 1ASTA 1G49A 1BKCE 1OS2A 1O0QA 1C3IA 1JIZA 3DSLA 4GUYA 5BOTA 3HBVP 2SRTA 3P1VA 2DW2A 1IACA 2FV9A 1JKYA 4WZVA 1MMBA 5D1SA 3CKIA 1JANA 3HDAP 3O64A 2MZIA 1UEAA 2OXZA 3HY7A 1GE7A 3BA0A 4AUOA 1JJ9A 4DV8A 4WK7A 5JMYA 2W12A 1R55A 3KEJA 4FXQA 1CGFA 5L79A 1KUIA 1BQOA 1JK3A 1XUCA 3E8RA 3OHLA 2PJTA 3NX7A 2JT5A 3G42A 3RTSA 2RJPA 1KUGA 4PKWA 4XM8A 4ON1A 1OS9A 1I76A 5D1TA 1HY7A 2A8HA 3LJZA 3KMCA 4L19A 1QUAA 2OVZA 3K7NA 4H1QA 3B2ZA 1Y0VA 1CGEA 4PKSA 2X7MA 2X3BA 4PKVA 3LJGA 4GR0A 4L63A 4FVLA 1GKCA 1EUBA 2DDYA 3LIRA 2O3EA 1JAPA 4A7BA 2DW0A 4GF1A 2YB9A 2OW0A 1BKCA 2ERPA 2D1OA 1BUVM 5D7WA 3F15A 5I43A 1XFYA 1XFVA 2J83A 1YQYA 2WO9A 2HU6A 3AYUA 4A3WA 3RTTA 1G12A 1AYKA 1R54A 1KBCA 5L7FA 2JSDA 4ZR5A 1ATLA 2W15A 4JIJA 1ZS0A 1OO9A 2YIGA 1G9KA 4WKEA 1BQQM 1G05A 3K7LA 3F19A 4R3VA 1OM7A 2OXWA 1XFZA 4DF9A 3LMCA 1BZSA 1JAQA 3B8ZA 2N8RA 3KMEA 2DDFA 3DWBA 3B92A 3LILA 1GE5A 1CIZA 2K2GA 4H76A 1K7QA 2EROA 4GWNA 2Y6CA 3I7GA 1D8FA 3DPFA 1YP1A 1ZTQA 1GKDA 1H71P 1MNCA 1RMZA 2XS4A 3F17A 5B5OA 4ILWD 1SATA 5CXAA 3EHYA 2JNPA 5I12A 4HMAA 2X3CA 4XM7A 1QJIA 3UVCA 3DPEA 1PWWA 5D1UA 3AYKA 5BOYA 1CGLA 1ZXVA 1B8YA 1SLNA 1Y93A 3KRYA 2W14A 2POJA 3HY9A 1O0TA 3WV2A 3USNA 3LIKA 1ZVXA 1I1IP 2CLTA 3TVCA 5LABA 3L0VA 3EDIA 5I4OA 3KEKA 3SHIA 3HYGA 3VTGA 1BM6A 4AIGA 1SMPA 3F1AA 4H30A 3HDBA 3LQ0A 1XFUA 3EDHA 1OMJA 1MMPA 1J7NA 1ROSA 4JQGA 2ERQA 1XFXA 1KAPP 1QIBA 1IAAA 2OW9A 4PKRA 4CTHA 3LKAA 5I0LA 1FM1A 1MMRA 3Q2HA 2FV5A 1SLMA 3EDZA 4XM6A 1HOVA 1B3DA 4XBHA 1IAGA 3LUMA 2OY2A 4H49A 1CQRA 1BSWA 4IUWA 1BKCI 2DW1A 1ZXCA 1D7XA 1HFCA 1XFWA 3KECA 1UMTA 1YOUA 5I3MA 2JT6A 2V4BA 4PKQA 2USNA 2W0DA 3I7IA 4G9LA 3F16A 1RM8A 2KRJA 1DMTA 2I47A 2MLSA 2X3AA 2XS3A 1YCMA 2MLRA 5CZMA 2MZEA 4GR3A 1DTHA 3KHIA 3LEAA 1Y8JA 3GBOA
chains in the Genus database with same CATH superfamily
4IJOA 3EWJA 1PWVA 3N2VA 3HBUP 5BPAA 1JH1A 3LJTA 2MZHA 1R1HA 4H82A 1OM6A 1PWUA 3V96B 4J4MA 1QIAA 3WV1A 1R1IA 3TS4A 1JIWP 1AKLA 1SRPA 1HTDA 4EFSA 1L6JA 1KUFA 1CAQA 1S4BP 5B5PA 4GWMA 5D3CA 3F18A 4Q1LA 4H2EA 3ZUKA 1FBLA 2OW1A 2QPJA 1UTTA 2W13A 4AXQA 4FXYP 4GQLA 3TT4A 4IN9A 3L0TA 4PKTA 4G0DA 1EAKA 4DPEA 1HV5A 2OXUA 1PWQA 2D1NA 2OY4A 3DNGA 1CK7A 1HFSA 2OW2A 3LGPA 1WNIA 4AYKA 1KUKA 4H84A 4PKUA 456CA 4L6TA 1PWPA 5CUHA 1ND1A 4WF6A 2E3XA 4HX3A 2CKIA 1A85A 3DTIA 3EDGA 5D2BA 3ELMA 3HB2P 1C8TA 2E2DA 3LE9A 1BUDA 3KWVC 4L7AA 4XCTA 1USNA 3LK8A 1XUDA 1GO8P 3AIGA 1UTZA 1OM8A 2RJQA 2L0RA 1KUHA 1AF0A 5I2ZA 3O2XA 1IAEA 4FU4A 3G5CA 3LQBA 1JAOA 4JPAA 1I73A 830CA 1D5JA 1QJJA 3Q2GA 4QKZA 1ZP5A 1R1JA 1K7IA 3TSKA 1GO7P 1Q3AA 3OHOA 3U1RA 2AYKA 2OVXA 2Z2DA 1GE6A 966CA 4I03A 2O36A 3LUNA 1MMQA 1GXDA 2Y6DA 2WO8A 3EHXA 5H8XA 2OI0A 4JA1A 4H3XA 1G4KA 1UMSA 1IABA 2OZRA 4WKIA 3MA2A 4I35A 1CXVA 4GR8A 3ZVSA 3N2UA 2J0TA 2K9CA 3DL1A 2JIHA 1SU3A 1OZ9A 3ZXHA 1BIWA 1D8MA 1Z3JA 3WV3A 1QICA 1FLSA 2WOAA 1XURA 1K7GA 2TCLA 1C7KA 2AIGP 3P24A 4DD8A 1EB6A 1A86A 1IADA 4JP4A 3VI1A 1ASTA 1G49A 1BKCE 1OS2A 1O0QA 1C3IA 1JIZA 3DSLA 4GUYA 5BOTA 3HBVP 2SRTA 3P1VA 2DW2A 1IACA 2FV9A 1JKYA 4WZVA 1MMBA 5D1SA 3CKIA 1JANA 3HDAP 3O64A 2MZIA 1UEAA 2OXZA 3HY7A 1GE7A 3BA0A 4AUOA 3DTKA 1JJ9A 4DV8A 4WK7A 5JMYA 2W12A 1R55A 3KEJA 4FXQA 1CGFA 5L79A 1KUIA 1BQOA 1JK3A 1XUCA 3E8RA 3OHLA 2PJTA 3NX7A 2JT5A 3G42A 3RTSA 2RJPA 1KUGA 4PKWA 4XM8A 4ON1A 1OS9A 1I76A 5D1TA 1HY7A 2A8HA 3LJZA 3KMCA 4L19A 1QUAA 2OVZA 3K7NA 4H1QA 3B2ZA 1Y0VA 1CGEA 4PKSA 2X7MA 2X3BA 4PKVA 3LJGA 4GR0A 4L63A 4FVLA 1GKCA 1EUBA 2DDYA 3LIRA 2O3EA 1JAPA 4A7BA 2DW0A 4GF1A 2YB9A 2OW0A 1BKCA 2ERPA 2D1OA 1BUVM 5D7WA 3F15A 5I43A 1XFYA 1XFVA 2J83A 1YQYA 2WO9A 2HU6A 3AYUA 4A3WA 3RTTA 1G12A 1AYKA 1R54A 1KBCA 3DTEA 5L7FA 2JSDA 4ZR5A 1ATLA 2W15A 4JIJA 1ZS0A 1OO9A 2YIGA 1G9KA 1TVIA 4WKEA 1BQQM 1G05A 3K7LA 3F19A 4R3VA 1OM7A 2OXWA 1XFZA 4DF9A 3LMCA 1BZSA 1JAQA 3B8ZA 2N8RA 3KMEA 2DDFA 3DWBA 3B92A 3LILA 1GE5A 1CIZA 2K2GA 4H76A 1K7QA 2EROA 4GWNA 2Y6CA 3I7GA 1D8FA 3DPFA 1YP1A 1ZTQA 1GKDA 1H71P 1MNCA 1RMZA 2XS4A 3F17A 5B5OA 4ILWD 1SATA 5CXAA 3EHYA 2JNPA 5I12A 4HMAA 2X3CA 4XM7A 1QJIA 3UVCA 3DPEA 1PWWA 5D1UA 3AYKA 5BOYA 1CGLA 1ZXVA 1XM5A 1B8YA 1SLNA 1Y93A 3KRYA 2W14A 2POJA 3HY9A 1O0TA 3WV2A 3USNA 3LIKA 1ZVXA 1I1IP 2CLTA 3TVCA 5LABA 3L0VA 3EDIA 5I4OA 3KEKA 3SHIA 3HYGA 3VTGA 1BM6A 4AIGA 1SMPA 3F1AA 4H30A 3HDBA 3LQ0A 1XFUA 3EDHA 1OMJA 1MMPA 1J7NA 1ROSA 4JQGA 2ERQA 1XFXA 1KAPP 1QIBA 1IAAA 2OW9A 4PKRA 4CTHA 3LKAA 5I0LA 1FM1A 1MMRA 3Q2HA 2FV5A 1SLMA 3EDZA 4XM6A 1HOVA 1B3DA 4XBHA 1IAGA 3LUMA 2OY2A 4H49A 1CQRA 1BSWA 4IUWA 1BKCI 2DW1A 1ZXCA 1D7XA 1HFCA 2YUFA 1XFWA 3KECA 1UMTA 1XAXA 1YOUA 5I3MA 2JT6A 2V4BA 4PKQA 2USNA 2W0DA 3I7IA 4G9LA 3F16A 1RM8A 2KRJA 1DMTA 2I47A 2MLSA 2X3AA 2XS3A 1YCMA 2MLRA 5CZMA 2MZEA 4GR3A 1DTHA 3KHIA 3LEAA 1Y8JA 3GBOA
chains in the Genus database with same CATH topology
4IJOA 3EWJA 1PWVA 3N2VA 3HBUP 5BPAA 1JH1A 3LJTA 2MZHA 1R1HA 4H82A 1OM6A 1PWUA 3V96B 4J4MA 1QIAA 3WV1A 1R1IA 3TS4A 1JIWP 1AKLA 1SRPA 1HTDA 4EFSA 1L6JA 1KUFA 1CAQA 1S4BP 5B5PA 4GWMA 5D3CA 3F18A 4Q1LA 4H2EA 3ZUKA 1FBLA 2OW1A 2QPJA 1UTTA 2W13A 4AXQA 4FXYP 4GQLA 3TT4A 4IN9A 3L0TA 4PKTA 4G0DA 1EAKA 4DPEA 1HV5A 2OXUA 1PWQA 2D1NA 2OY4A 3DNGA 1CK7A 1HFSA 2OW2A 3LGPA 1WNIA 4AYKA 1KUKA 4H84A 4PKUA 456CA 4L6TA 1PWPA 5CUHA 1ND1A 4WF6A 2E3XA 4HX3A 2CKIA 1A85A 3DTIA 3EDGA 5D2BA 3ELMA 3HB2P 1C8TA 2E2DA 3LE9A 1BUDA 3KWVC 4L7AA 4XCTA 1USNA 3LK8A 1XUDA 1GO8P 3AIGA 1UTZA 1OM8A 2RJQA 2L0RA 1KUHA 1AF0A 5I2ZA 3O2XA 1IAEA 4FU4A 3G5CA 3LQBA 1JAOA 4JPAA 1I73A 830CA 1D5JA 1QJJA 3Q2GA 4QKZA 1ZP5A 1R1JA 1K7IA 3TSKA 1GO7P 1Q3AA 3OHOA 3U1RA 2AYKA 2OVXA 2Z2DA 1GE6A 966CA 4I03A 2O36A 3LUNA 1MMQA 1GXDA 2Y6DA 2WO8A 3EHXA 5H8XA 2OI0A 4JA1A 4H3XA 1G4KA 1UMSA 1IABA 2OZRA 4WKIA 3MA2A 4I35A 1CXVA 4GR8A 3ZVSA 3N2UA 2J0TA 2K9CA 3DL1A 2JIHA 1SU3A 3ZXHA 1BIWA 1D8MA 1Z3JA 3WV3A 1QICA 1FLSA 2WOAA 1XURA 1K7GA 2TCLA 1C7KA 2AIGP 3P24A 4DD8A 1EB6A 1A86A 1IADA 4JP4A 3VI1A 1ASTA 1G49A 1BKCE 1OS2A 1O0QA 1C3IA 1JIZA 3DSLA 4GUYA 5BOTA 3HBVP 2SRTA 3P1VA 2DW2A 1IACA 2FV9A 1JKYA 4WZVA 1MMBA 5D1SA 3CKIA 1JANA 3HDAP 3O64A 2MZIA 1UEAA 2OXZA 3HY7A 1GE7A 3BA0A 4AUOA 3DTKA 1JJ9A 4DV8A 4WK7A 5JMYA 2W12A 1R55A 3KEJA 4FXQA 1CGFA 5L79A 1KUIA 1BQOA 1JK3A 1XUCA 3E8RA 3OHLA 2PJTA 3NX7A 2JT5A 3G42A 3RTSA 2RJPA 1KUGA 4PKWA 4XM8A 4ON1A 1OS9A 1I76A 5D1TA 1HY7A 2A8HA 3LJZA 3KMCA 4L19A 1QUAA 2OVZA 3K7NA 4H1QA 3B2ZA 1Y0VA 1CGEA 4PKSA 2X7MA 2X3BA 4PKVA 3LJGA 4GR0A 4L63A 4FVLA 1GKCA 1EUBA 2DDYA 3LIRA 2O3EA 1JAPA 4A7BA 2DW0A 4GF1A 2YB9A 2OW0A 1BKCA 2ERPA 2D1OA 1BUVM 5D7WA 3F15A 5I43A 1XFYA 1XFVA 2J83A 1YQYA 2WO9A 2HU6A 3AYUA 4A3WA 3RTTA 1G12A 1AYKA 1R54A 1KBCA 3DTEA 5L7FA 2JSDA 4ZR5A 1ATLA 2W15A 4JIJA 1ZS0A 1OO9A 2YIGA 1G9KA 4WKEA 1BQQM 1G05A 3K7LA 3F19A 4R3VA 1OM7A 2OXWA 1XFZA 4DF9A 3LMCA 1BZSA 1JAQA 3B8ZA 2N8RA 3KMEA 2DDFA 3DWBA 3B92A 3LILA 1GE5A 1CIZA 2K2GA 4H76A 1K7QA 2EROA 4GWNA 2Y6CA 3I7GA 1D8FA 3DPFA 1YP1A 1ZTQA 1GKDA 1H71P 1MNCA 1RMZA 2XS4A 3F17A 5B5OA 4ILWD 1SATA 5CXAA 3EHYA 2JNPA 5I12A 4HMAA 2X3CA 4XM7A 1QJIA 3UVCA 3DPEA 1PWWA 5D1UA 3AYKA 5BOYA 1CGLA 1ZXVA 1B8YA 1SLNA 1Y93A 3KRYA 2W14A 2POJA 3HY9A 1O0TA 3WV2A 3USNA 3LIKA 1ZVXA 1I1IP 2CLTA 3TVCA 5LABA 3L0VA 3EDIA 5I4OA 3KEKA 3SHIA 3HYGA 3VTGA 1BM6A 4AIGA 1SMPA 3F1AA 4H30A 3HDBA 3LQ0A 1XFUA 3EDHA 1OMJA 1MMPA 1J7NA 1ROSA 4JQGA 2ERQA 1XFXA 1KAPP 1QIBA 1IAAA 2OW9A 4PKRA 4CTHA 3LKAA 5I0LA 1FM1A 1MMRA 3Q2HA 2FV5A 1SLMA 3EDZA 4XM6A 1HOVA 1B3DA 4XBHA 1IAGA 3LUMA 2OY2A 4H49A 1CQRA 1BSWA 4IUWA 1BKCI 2DW1A 1ZXCA 1D7XA 1HFCA 2YUFA 1XFWA 3KECA 1UMTA 1YOUA 5I3MA 2JT6A 2V4BA 4PKQA 2USNA 2W0DA 3I7IA 4G9LA 3F16A 1RM8A 2KRJA 1DMTA 2I47A 2MLSA 2X3AA 2XS3A 1YCMA 2MLRA 5CZMA 2MZEA 4GR3A 1DTHA 3KHIA 3LEAA 1Y8JA 3GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJO A;  3EWJ A;  1PWV A;  3N2V A;  3HBU P;  5BPA A;  1JH1 A;  3LJT A;  2MZH A;  1R1H A;  4H82 A;  1OM6 A;  1PWU A;  3V96 B;  4J4M A;  1QIA A;  3WV1 A;  1R1I A;  3TS4 A;  1JIW P;  1AKL A;  1SRP A;  1HTD A;  4EFS A;  1L6J A;  1KUF A;  1CAQ A;  1S4B P;  5B5P A;  4GWM A;  5D3C A;  3F18 A;  4Q1L A;  4H2E A;  3ZUK A;  1FBL A;  2OW1 A;  2QPJ A;  1UTT A;  2W13 A;  4AXQ A;  4FXY P;  4GQL A;  3TT4 A;  4IN9 A;  3L0T A;  4PKT A;  4G0D A;  1EAK A;  4DPE A;  1HV5 A;  2OXU A;  1PWQ A;  2D1N A;  2OY4 A;  3DNG A;  1CK7 A;  1HFS A;  2OW2 A;  3LGP A;  1WNI A;  4AYK A;  1KUK A;  4H84 A;  4PKU A;  456C A;  4L6T A;  1PWP A;  5CUH A;  1ND1 A;  4WF6 A;  2E3X A;  4HX3 A;  2CKI A;  1A85 A;  3EDG A;  5D2B A;  3ELM A;  3HB2 P;  1C8T A;  2E2D A;  3LE9 A;  1BUD A;  3KWV C;  4XCT A;  1USN A;  3LK8 A;  1XUD A;  1GO8 P;  3AIG A;  1UTZ A;  1OM8 A;  2RJQ A;  2L0R A;  1KUH A;  1AF0 A;  5I2Z A;  3O2X A;  1IAE A;  4FU4 A;  3G5C A;  3LQB A;  1JAO A;  4JPA A;  1I73 A;  830C A;  1D5J A;  1QJJ A;  3Q2G A;  4QKZ A;  1ZP5 A;  1R1J A;  1K7I A;  3TSK A;  1GO7 P;  1Q3A A;  3OHO A;  3U1R A;  2AYK A;  2OVX A;  2Z2D A;  1GE6 A;  966C A;  4I03 A;  2O36 A;  3LUN A;  1MMQ A;  1GXD A;  2Y6D A;  2WO8 A;  3EHX A;  5H8X A;  2OI0 A;  4JA1 A;  4H3X A;  1G4K A;  1UMS A;  1IAB A;  2OZR A;  4WKI A;  3MA2 A;  4I35 A;  1CXV A;  4GR8 A;  3ZVS A;  3N2U A;  2J0T A;  2K9C A;  3DL1 A;  2JIH A;  1SU3 A;  3ZXH A;  1BIW A;  1D8M A;  1Z3J A;  3WV3 A;  1QIC A;  1FLS A;  2WOA A;  1XUR A;  1K7G A;  2TCL A;  1C7K A;  2AIG P;  3P24 A;  4DD8 A;  1EB6 A;  1A86 A;  1IAD A;  4JP4 A;  3VI1 A;  1AST A;  1G49 A;  1BKC E;  1OS2 A;  1O0Q A;  1C3I A;  1JIZ A;  3DSL A;  4GUY A;  5BOT A;  3HBV P;  2SRT A;  3P1V A;  2DW2 A;  1IAC A;  2FV9 A;  1JKY A;  4WZV A;  1MMB A;  5D1S A;  3CKI A;  1JAN A;  3HDA P;  3O64 A;  2MZI A;  1UEA A;  2OXZ A;  3HY7 A;  1GE7 A;  3BA0 A;  4AUO A;  1JJ9 A;  4DV8 A;  4WK7 A;  5JMY A;  2W12 A;  1R55 A;  3KEJ A;  4FXQ A;  1CGF A;  5L79 A;  1KUI A;  1BQO A;  1JK3 A;  1XUC A;  3E8R A;  3OHL A;  2PJT A;  3NX7 A;  2JT5 A;  3G42 A;  3RTS A;  2RJP A;  1KUG A;  4PKW A;  4XM8 A;  4ON1 A;  1OS9 A;  1I76 A;  5D1T A;  1HY7 A;  2A8H A;  3LJZ A;  3KMC A;  4L19 A;  1QUA A;  2OVZ A;  3K7N A;  4H1Q A;  3B2Z A;  1Y0V A;  1CGE A;  4PKS A;  2X7M A;  2X3B A;  4PKV A;  3LJG A;  4GR0 A;  4L63 A;  4FVL A;  1GKC A;  1EUB A;  2DDY A;  3LIR A;  2O3E A;  1JAP A;  4A7B A;  2DW0 A;  4GF1 A;  2YB9 A;  2OW0 A;  1BKC A;  2ERP A;  2D1O A;  1BUV M;  5D7W A;  3F15 A;  5I43 A;  1XFY A;  1XFV A;  2J83 A;  1YQY A;  2WO9 A;  2HU6 A;  3AYU A;  4A3W A;  3RTT A;  1G12 A;  1AYK A;  1R54 A;  1KBC A;  5L7F A;  2JSD A;  4ZR5 A;  1ATL A;  2W15 A;  4JIJ A;  1ZS0 A;  1OO9 A;  2YIG A;  1G9K A;  4WKE A;  1BQQ M;  1G05 A;  3K7L A;  3F19 A;  4R3V A;  1OM7 A;  2OXW A;  1XFZ A;  4DF9 A;  3LMC A;  1BZS A;  1JAQ A;  3B8Z A;  2N8R A;  3KME A;  2DDF A;  3DWB A;  3B92 A;  3LIL A;  1GE5 A;  1CIZ A;  2K2G A;  4H76 A;  1K7Q A;  2ERO A;  4GWN A;  2Y6C A;  3I7G A;  1D8F A;  3DPF A;  1YP1 A;  1ZTQ A;  1GKD A;  1H71 P;  1MNC A;  1RMZ A;  2XS4 A;  3F17 A;  5B5O A;  4ILW D;  1SAT A;  5CXA A;  3EHY A;  2JNP A;  5I12 A;  4HMA A;  2X3C A;  4XM7 A;  1QJI A;  3UVC A;  3DPE A;  1PWW A;  5D1U A;  3AYK A;  5BOY A;  1CGL A;  1ZXV A;  1B8Y A;  1SLN A;  1Y93 A;  3KRY A;  2W14 A;  2POJ A;  3HY9 A;  1O0T A;  3WV2 A;  3USN A;  3LIK A;  1ZVX A;  1I1I P;  2CLT A;  3TVC A;  5LAB A;  3L0V A;  3EDI A;  5I4O A;  3KEK A;  3SHI A;  3HYG A;  3VTG A;  1BM6 A;  4AIG A;  1SMP A;  3F1A A;  4H30 A;  3HDB A;  3LQ0 A;  1XFU A;  3EDH A;  1OMJ A;  1MMP A;  1J7N A;  1ROS A;  4JQG A;  2ERQ A;  1XFX A;  1KAP P;  1QIB A;  1IAA A;  2OW9 A;  4PKR A;  4CTH A;  3LKA A;  5I0L A;  1FM1 A;  1MMR A;  3Q2H A;  2FV5 A;  1SLM A;  3EDZ A;  4XM6 A;  1HOV A;  1B3D A;  4XBH A;  1IAG A;  3LUM A;  2OY2 A;  4H49 A;  1CQR A;  1BSW A;  4IUW A;  1BKC I;  2DW1 A;  1ZXC A;  1D7X A;  1HFC A;  1XFW A;  3KEC A;  1UMT A;  1YOU A;  5I3M A;  2JT6 A;  2V4B A;  4PKQ A;  2USN A;  2W0D A;  3I7I A;  4G9L A;  3F16 A;  1RM8 A;  2KRJ A;  1DMT A;  2I47 A;  2MLS A;  2X3A A;  2XS3 A;  1YCM A;  2MLR A;  5CZM A;  2MZE A;  4GR3 A;  1DTH A;  3KHI A;  3LEA A;  1Y8J A;  3GBO A; 
#chains in the Genus database with same CATH topology
 4IJO A;  3EWJ A;  1PWV A;  3N2V A;  3HBU P;  5BPA A;  1JH1 A;  3LJT A;  2MZH A;  1R1H A;  4H82 A;  1OM6 A;  1PWU A;  3V96 B;  4J4M A;  1QIA A;  3WV1 A;  1R1I A;  3TS4 A;  1JIW P;  1AKL A;  1SRP A;  1HTD A;  4EFS A;  1L6J A;  1KUF A;  1CAQ A;  1S4B P;  5B5P A;  4GWM A;  5D3C A;  3F18 A;  4Q1L A;  4H2E A;  3ZUK A;  1FBL A;  2OW1 A;  2QPJ A;  1UTT A;  2W13 A;  4AXQ A;  4FXY P;  4GQL A;  3TT4 A;  4IN9 A;  3L0T A;  4PKT A;  4G0D A;  1EAK A;  4DPE A;  1HV5 A;  2OXU A;  1PWQ A;  2D1N A;  2OY4 A;  3DNG A;  1CK7 A;  1HFS A;  2OW2 A;  3LGP A;  1WNI A;  4AYK A;  1KUK A;  4H84 A;  4PKU A;  456C A;  4L6T A;  1PWP A;  5CUH A;  1ND1 A;  4WF6 A;  2E3X A;  4HX3 A;  2CKI A;  1A85 A;  3DTI A;  3EDG A;  5D2B A;  3ELM A;  3HB2 P;  1C8T A;  2E2D A;  3LE9 A;  1BUD A;  3KWV C;  4L7A A;  4XCT A;  1USN A;  3LK8 A;  1XUD A;  1GO8 P;  3AIG A;  1UTZ A;  1OM8 A;  2RJQ A;  2L0R A;  1KUH A;  1AF0 A;  5I2Z A;  3O2X A;  1IAE A;  4FU4 A;  3G5C A;  3LQB A;  1JAO A;  4JPA A;  1I73 A;  830C A;  1D5J A;  1QJJ A;  3Q2G A;  4QKZ A;  1ZP5 A;  1R1J A;  1K7I A;  3TSK A;  1GO7 P;  1Q3A A;  3OHO A;  3U1R A;  2AYK A;  2OVX A;  2Z2D A;  1GE6 A;  966C A;  4I03 A;  2O36 A;  3LUN A;  1MMQ A;  1GXD A;  2Y6D A;  2WO8 A;  3EHX A;  5H8X A;  2OI0 A;  4JA1 A;  4H3X A;  1G4K A;  1UMS A;  1IAB A;  2OZR A;  4WKI A;  3MA2 A;  4I35 A;  1CXV A;  4GR8 A;  3ZVS A;  3N2U A;  2J0T A;  2K9C A;  3DL1 A;  2JIH A;  1SU3 A;  1OZ9 A;  3ZXH A;  1BIW A;  1D8M A;  1Z3J A;  3WV3 A;  1QIC A;  1FLS A;  2WOA A;  1XUR A;  1K7G A;  2TCL A;  1C7K A;  2AIG P;  3P24 A;  4DD8 A;  1EB6 A;  1A86 A;  1IAD A;  4JP4 A;  3VI1 A;  1AST A;  1G49 A;  1BKC E;  1OS2 A;  1O0Q A;  1C3I A;  1JIZ A;  3DSL A;  4GUY A;  5BOT A;  3HBV P;  2SRT A;  3P1V A;  2DW2 A;  1IAC A;  2FV9 A;  1JKY A;  4WZV A;  1MMB A;  5D1S A;  3CKI A;  1JAN A;  3HDA P;  3O64 A;  2MZI A;  1UEA A;  2OXZ A;  3HY7 A;  1GE7 A;  3BA0 A;  4AUO A;  3DTK A;  1JJ9 A;  4DV8 A;  4WK7 A;  5JMY A;  2W12 A;  1R55 A;  3KEJ A;  4FXQ A;  1CGF A;  5L79 A;  1KUI A;  1BQO A;  1JK3 A;  1XUC A;  3E8R A;  3OHL A;  2PJT A;  3NX7 A;  2JT5 A;  3G42 A;  3RTS A;  2RJP A;  1KUG A;  4PKW A;  4XM8 A;  4ON1 A;  1OS9 A;  1I76 A;  5D1T A;  1HY7 A;  2A8H A;  3LJZ A;  3KMC A;  4L19 A;  1QUA A;  2OVZ A;  3K7N A;  4H1Q A;  3B2Z A;  1Y0V A;  1CGE A;  4PKS A;  2X7M A;  2X3B A;  4PKV A;  3LJG A;  4GR0 A;  4L63 A;  4FVL A;  1GKC A;  1EUB A;  2DDY A;  3LIR A;  2O3E A;  1JAP A;  4A7B A;  2DW0 A;  4GF1 A;  2YB9 A;  2OW0 A;  1BKC A;  2ERP A;  2D1O A;  1BUV M;  5D7W A;  3F15 A;  5I43 A;  1XFY A;  1XFV A;  2J83 A;  1YQY A;  2WO9 A;  2HU6 A;  3AYU A;  4A3W A;  3RTT A;  1G12 A;  1AYK A;  1R54 A;  1KBC A;  3DTE A;  5L7F A;  2JSD A;  4ZR5 A;  1ATL A;  2W15 A;  4JIJ A;  1ZS0 A;  1OO9 A;  2YIG A;  1G9K A;  1TVI A;  4WKE A;  1BQQ M;  1G05 A;  3K7L A;  3F19 A;  4R3V A;  1OM7 A;  2OXW A;  1XFZ A;  4DF9 A;  3LMC A;  1BZS A;  1JAQ A;  3B8Z A;  2N8R A;  3KME A;  2DDF A;  3DWB A;  3B92 A;  3LIL A;  1GE5 A;  1CIZ A;  2K2G A;  4H76 A;  1K7Q A;  2ERO A;  4GWN A;  2Y6C A;  3I7G A;  1D8F A;  3DPF A;  1YP1 A;  1ZTQ A;  1GKD A;  1H71 P;  1MNC A;  1RMZ A;  2XS4 A;  3F17 A;  5B5O A;  4ILW D;  1SAT A;  5CXA A;  3EHY A;  2JNP A;  5I12 A;  4HMA A;  2X3C A;  4XM7 A;  1QJI A;  3UVC A;  3DPE A;  1PWW A;  5D1U A;  3AYK A;  5BOY A;  1CGL A;  1ZXV A;  1XM5 A;  1B8Y A;  1SLN A;  1Y93 A;  3KRY A;  2W14 A;  2POJ A;  3HY9 A;  1O0T A;  3WV2 A;  3USN A;  3LIK A;  1ZVX A;  1I1I P;  2CLT A;  3TVC A;  5LAB A;  3L0V A;  3EDI A;  5I4O A;  3KEK A;  3SHI A;  3HYG A;  3VTG A;  1BM6 A;  4AIG A;  1SMP A;  3F1A A;  4H30 A;  3HDB A;  3LQ0 A;  1XFU A;  3EDH A;  1OMJ A;  1MMP A;  1J7N A;  1ROS A;  4JQG A;  2ERQ A;  1XFX A;  1KAP P;  1QIB A;  1IAA A;  2OW9 A;  4PKR A;  4CTH A;  3LKA A;  5I0L A;  1FM1 A;  1MMR A;  3Q2H A;  2FV5 A;  1SLM A;  3EDZ A;  4XM6 A;  1HOV A;  1B3D A;  4XBH A;  1IAG A;  3LUM A;  2OY2 A;  4H49 A;  1CQR A;  1BSW A;  4IUW A;  1BKC I;  2DW1 A;  1ZXC A;  1D7X A;  1HFC A;  2YUF A;  1XFW A;  3KEC A;  1UMT A;  1XAX A;  1YOU A;  5I3M A;  2JT6 A;  2V4B A;  4PKQ A;  2USN A;  2W0D A;  3I7I A;  4G9L A;  3F16 A;  1RM8 A;  2KRJ A;  1DMT A;  2I47 A;  2MLS A;  2X3A A;  2XS3 A;  1YCM A;  2MLR A;  5CZM A;  2MZE A;  4GR3 A;  1DTH A;  3KHI A;  3LEA A;  1Y8J A;  3GBO A; 
#chains in the Genus database with same CATH homology
 4IJO A;  3EWJ A;  1PWV A;  3N2V A;  3HBU P;  5BPA A;  1JH1 A;  3LJT A;  2MZH A;  1R1H A;  4H82 A;  1OM6 A;  1PWU A;  3V96 B;  4J4M A;  1QIA A;  3WV1 A;  1R1I A;  3TS4 A;  1JIW P;  1AKL A;  1SRP A;  1HTD A;  4EFS A;  1L6J A;  1KUF A;  1CAQ A;  1S4B P;  5B5P A;  4GWM A;  5D3C A;  3F18 A;  4Q1L A;  4H2E A;  3ZUK A;  1FBL A;  2OW1 A;  2QPJ A;  1UTT A;  2W13 A;  4AXQ A;  4FXY P;  4GQL A;  3TT4 A;  4IN9 A;  3L0T A;  4PKT A;  4G0D A;  1EAK A;  4DPE A;  1HV5 A;  2OXU A;  1PWQ A;  2D1N A;  2OY4 A;  3DNG A;  1CK7 A;  1HFS A;  2OW2 A;  3LGP A;  1WNI A;  4AYK A;  1KUK A;  4H84 A;  4PKU A;  456C A;  4L6T A;  1PWP A;  5CUH A;  1ND1 A;  4WF6 A;  2E3X A;  4HX3 A;  2CKI A;  1A85 A;  3DTI A;  3EDG A;  5D2B A;  3ELM A;  3HB2 P;  1C8T A;  2E2D A;  3LE9 A;  1BUD A;  3KWV C;  4L7A A;  4XCT A;  1USN A;  3LK8 A;  1XUD A;  1GO8 P;  3AIG A;  1UTZ A;  1OM8 A;  2RJQ A;  2L0R A;  1KUH A;  1AF0 A;  5I2Z A;  3O2X A;  1IAE A;  4FU4 A;  3G5C A;  3LQB A;  1JAO A;  4JPA A;  1I73 A;  830C A;  1D5J A;  1QJJ A;  3Q2G A;  4QKZ A;  1ZP5 A;  1R1J A;  1K7I A;  3TSK A;  1GO7 P;  1Q3A A;  3OHO A;  3U1R A;  2AYK A;  2OVX A;  2Z2D A;  1GE6 A;  966C A;  4I03 A;  2O36 A;  3LUN A;  1MMQ A;  1GXD A;  2Y6D A;  2WO8 A;  3EHX A;  5H8X A;  2OI0 A;  4JA1 A;  4H3X A;  1G4K A;  1UMS A;  1IAB A;  2OZR A;  4WKI A;  3MA2 A;  4I35 A;  1CXV A;  4GR8 A;  3ZVS A;  3N2U A;  2J0T A;  2K9C A;  3DL1 A;  2JIH A;  1SU3 A;  3ZXH A;  1BIW A;  1D8M A;  1Z3J A;  3WV3 A;  1QIC A;  1FLS A;  2WOA A;  1XUR A;  1K7G A;  2TCL A;  1C7K A;  2AIG P;  3P24 A;  4DD8 A;  1EB6 A;  1A86 A;  1IAD A;  4JP4 A;  3VI1 A;  1AST A;  1G49 A;  1BKC E;  1OS2 A;  1O0Q A;  1C3I A;  1JIZ A;  3DSL A;  4GUY A;  5BOT A;  3HBV P;  2SRT A;  3P1V A;  2DW2 A;  1IAC A;  2FV9 A;  1JKY A;  4WZV A;  1MMB A;  5D1S A;  3CKI A;  1JAN A;  3HDA P;  3O64 A;  2MZI A;  1UEA A;  2OXZ A;  3HY7 A;  1GE7 A;  3BA0 A;  4AUO A;  3DTK A;  1JJ9 A;  4DV8 A;  4WK7 A;  5JMY A;  2W12 A;  1R55 A;  3KEJ A;  4FXQ A;  1CGF A;  5L79 A;  1KUI A;  1BQO A;  1JK3 A;  1XUC A;  3E8R A;  3OHL A;  2PJT A;  3NX7 A;  2JT5 A;  3G42 A;  3RTS A;  2RJP A;  1KUG A;  4PKW A;  4XM8 A;  4ON1 A;  1OS9 A;  1I76 A;  5D1T A;  1HY7 A;  2A8H A;  3LJZ A;  3KMC A;  4L19 A;  1QUA A;  2OVZ A;  3K7N A;  4H1Q A;  3B2Z A;  1Y0V A;  1CGE A;  4PKS A;  2X7M A;  2X3B A;  4PKV A;  3LJG A;  4GR0 A;  4L63 A;  4FVL A;  1GKC A;  1EUB A;  2DDY A;  3LIR A;  2O3E A;  1JAP A;  4A7B A;  2DW0 A;  4GF1 A;  2YB9 A;  2OW0 A;  1BKC A;  2ERP A;  2D1O A;  1BUV M;  5D7W A;  3F15 A;  5I43 A;  1XFY A;  1XFV A;  2J83 A;  1YQY A;  2WO9 A;  2HU6 A;  3AYU A;  4A3W A;  3RTT A;  1G12 A;  1AYK A;  1R54 A;  1KBC A;  3DTE A;  5L7F A;  2JSD A;  4ZR5 A;  1ATL A;  2W15 A;  4JIJ A;  1ZS0 A;  1OO9 A;  2YIG A;  1G9K A;  4WKE A;  1BQQ M;  1G05 A;  3K7L A;  3F19 A;  4R3V A;  1OM7 A;  2OXW A;  1XFZ A;  4DF9 A;  3LMC A;  1BZS A;  1JAQ A;  3B8Z A;  2N8R A;  3KME A;  2DDF A;  3DWB A;  3B92 A;  3LIL A;  1GE5 A;  1CIZ A;  2K2G A;  4H76 A;  1K7Q A;  2ERO A;  4GWN A;  2Y6C A;  3I7G A;  1D8F A;  3DPF A;  1YP1 A;  1ZTQ A;  1GKD A;  1H71 P;  1MNC A;  1RMZ A;  2XS4 A;  3F17 A;  5B5O A;  4ILW D;  1SAT A;  5CXA A;  3EHY A;  2JNP A;  5I12 A;  4HMA A;  2X3C A;  4XM7 A;  1QJI A;  3UVC A;  3DPE A;  1PWW A;  5D1U A;  3AYK A;  5BOY A;  1CGL A;  1ZXV A;  1B8Y A;  1SLN A;  1Y93 A;  3KRY A;  2W14 A;  2POJ A;  3HY9 A;  1O0T A;  3WV2 A;  3USN A;  3LIK A;  1ZVX A;  1I1I P;  2CLT A;  3TVC A;  5LAB A;  3L0V A;  3EDI A;  5I4O A;  3KEK A;  3SHI A;  3HYG A;  3VTG A;  1BM6 A;  4AIG A;  1SMP A;  3F1A A;  4H30 A;  3HDB A;  3LQ0 A;  1XFU A;  3EDH A;  1OMJ A;  1MMP A;  1J7N A;  1ROS A;  4JQG A;  2ERQ A;  1XFX A;  1KAP P;  1QIB A;  1IAA A;  2OW9 A;  4PKR A;  4CTH A;  3LKA A;  5I0L A;  1FM1 A;  1MMR A;  3Q2H A;  2FV5 A;  1SLM A;  3EDZ A;  4XM6 A;  1HOV A;  1B3D A;  4XBH A;  1IAG A;  3LUM A;  2OY2 A;  4H49 A;  1CQR A;  1BSW A;  4IUW A;  1BKC I;  2DW1 A;  1ZXC A;  1D7X A;  1HFC A;  2YUF A;  1XFW A;  3KEC A;  1UMT A;  1YOU A;  5I3M A;  2JT6 A;  2V4B A;  4PKQ A;  2USN A;  2W0D A;  3I7I A;  4G9L A;  3F16 A;  1RM8 A;  2KRJ A;  1DMT A;  2I47 A;  2MLS A;  2X3A A;  2XS3 A;  1YCM A;  2MLR A;  5CZM A;  2MZE A;  4GR3 A;  1DTH A;  3KHI A;  3LEA A;  1Y8J A;  3GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...