3EDIA

Crystal structure of tolloid-like protease 1 (tll-1) protease domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
201
structure length
195
Chain Sequence
b'AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRCSYVGRRGNGPQAISINCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tolloid-like protein 1
publication title Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 195
sequence length 201
ec nomenclature ec 3.4.24.-:
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ediA00
1JAPA 1QUAA 3TSKA 5I43A 1BZSA 2K2GA 2D1NA 3O64A 1USNA 1ZP5A 4GQLA 2OZRA 1A86A 3VTGA 2TCLA 3VI1A 2OY2A 1BKCI 1C7KA 4DPEA 4JA1A 1CQRA 1ZVXA 1CGFA 1ZTQA 1XUDA 1AKLA 2MZEA 2JSDA 4IUWA 1XURA 2OW1A 3RTSA 1GE6A 1D5JA 2OW0A 4DV8A 3LUMA 1HFSA 3N2VA 4ILWD 5CUHA 2CLTA 1DMTA 1KBCA 4H49A 1OM7A 1UTTA 5LABA 4WK7A 1Y8JA 2N8RA 2FV5A 3KMCA 1IAEA 1OO9A 1CAQA 4J4MA 1XFXA 2I47A 3EHYA 4L63A 3EDZA 1SLNA 1R54A 4H3XA 4DF9A 3KEJA 1XFZA 3HBUP 2JT6A 3LJZA 5L79A 2ERPA 2DDYA 5I3MA 1S4BP 3KWVC 5CZMA 3TVCA 1ND1A 4H1QA 1SU3A 3DWBA 1GKCA 4HMAA 4AUOA 1BSWA 1O0TA 1XFYA 1YOUA 1H71P 4H84A 2DW1A 3GBOA 2DW0A 3EDIA 1HOVA 3U1RA 2O36A 4JIJA 3UVCA 456CA 1YQYA 1OS2A 1AYKA 1C3IA 3KHIA 3HDBA 2E3XA 1HTDA 1O0QA 1K7QA 1JIZA 3WV3A 1GO7P 1BIWA 3F16A 2OXWA 3LJTA 3ELMA 3P24A 1PWQA 1BQOA 1JIWP 3HBVP 2X3BA 1HV5A 5D3CA 1I1IP 3AYUA 3KRYA 2W13A 1GKDA 3N2UA 2Z2DA 1MMBA 2WO8A 4HX3A 3LJGA 1BQQM 4XCTA 3BA0A 3LMCA 5JMYA 1FBLA 2E2DA 1BKCE 4ON1A 2OW2A 1QIBA 1MMRA 3DL1A 4JPAA 1IADA 5B5PA 966CA 1SATA 2DW2A 4H2EA 4XM8A 3LE9A 1D8MA 1IAAA 2K9CA 4G9LA 4Q1LA 1EB6A 1JANA 3HDAP 5BPAA 2AYKA 1I73A 1EUBA 1A85A 1PWWA 3HB2P 1CIZA 3AIGA 3Q2HA 3F17A 1JKYA 2RJQA 3EWJA 1OM6A 3RTTA 2X7MA 3F1AA 4EFSA 1SLMA 5D7WA 4AYKA 1IABA 1SRPA 3DNGA 5D1TA 4GR0A 3TT4A 4L19A 1RMZA 2OVXA 2YIGA 2O3EA 4CTHA 1ROSA 4WZVA 1CXVA 4GF1A 1D8FA 3EDGA 4FVLA 2A8HA 2OY4A 1OM8A 2D1OA 3DSLA 5L7FA 4PKTA 3B2ZA 1XFWA 1XFUA 1L6JA 2MLRA 4DD8A 3ZVSA 2WO9A 2POJA 2X3AA 4WF6A 1MNCA 1C8TA 5I2ZA 4QKZA 1GE7A 1KUHA 2RJPA 1UMSA 2OI0A 2KRJA 4FXQA 1JAOA 3LEAA 4XM7A 3KEKA 2OVZA 2EROA 4WKEA 4PKUA 2OXZA 3OHOA 2L0RA 1QJIA 2OXUA 3WV1A 4GR3A 2YB9A 1G12A 1XUCA 3USNA 1BUDA 1R55A 1PWUA 3EHXA 1OMJA 2W12A 1Y93A 2DDFA 3V96B 2XS4A 2MZIA 2MLSA 2JT5A 1R1HA 4L6TA 4H82A 3K7LA 1QIAA 5I12A 1YCMA 1SMPA 1K7GA 1J7NA 1UMTA 4XBHA 4G0DA 1B3DA 4GWNA 1MMQA 3ZXHA 3B8ZA 2J0TA 1RM8A 1YP1A 3OHLA 5CXAA 2HU6A 3L0TA 1Y0VA 1QJJA 1IACA 3WV2A 4AXQA 2W0DA 3AYKA 3LIKA 1R1JA 3LQBA 1GXDA 4XM6A 1WNIA 3F15A 3I7GA 1R1IA 4H76A 3F19A 1KUGA 3DPEA 3EDHA 3B92A 4PKRA 5D2BA 4FU4A 1Z3JA 2FV9A 1ATLA 5D1UA 1KUFA 3Q2GA 3LKAA 4JP4A 3I7IA 4PKVA 1I76A 1JH1A 3F18A 1DTHA 4R3VA 3HY9A 1PWPA 1BKCA 1PWVA 1ZS0A 1K7IA 2CKIA 1IAGA 4ZR5A 830CA 4GUYA 1D7XA 1KUIA 1G49A 5H8XA 1KAPP 4IJOA 3NX7A 1JJ9A 1XFVA 1G05A 3SHIA 2USNA 3G42A 5BOYA 3LILA 3K7NA 3KMEA 1FM1A 1KUKA 2MZHA 4GR8A 1EAKA 5I0LA 3HYGA 3LGPA 3MA2A 1G4KA 4I03A 3O2XA 1BUVM 4PKWA 1ASTA 3HY7A 2SRTA 4AIGA 2WOAA 2JNPA 2AIGP 1ZXCA 2J83A 5I4OA 4JQGA 2XS3A 1UTZA 1HFCA 3TS4A 4PKQA 1FLSA 1ZXVA 3KECA 5B5OA 2V4BA 3P1VA 1JAQA 1UEAA 1GO8P 3LQ0A 4IN9A 3LIRA 3CKIA 3DPFA 3E8RA 2Y6CA 2PJTA 4A3WA 1JK3A 3LUNA 4I35A 1HY7A 2ERQA 1GE5A 5BOTA 1BM6A 1CGLA 1MMPA 2Y6DA 3L0VA 4WKIA 1CK7A 1G9KA 5D1SA 4GWMA 4PKSA 1Q3AA 3ZUKA 1B8YA 4A7BA 1OS9A 2QPJA 2OW9A 2JIHA 2W15A 3LK8A 4H30A 1CGEA 1QICA 1AF0A 2W14A 4FXYP 2X3CA 3G5CA
chains in the Genus database with same CATH superfamily
1JAPA 1QUAA 3TSKA 5I43A 1BZSA 2K2GA 2D1NA 3O64A 3DTKA 1USNA 1ZP5A 4GQLA 2OZRA 1A86A 3VTGA 2TCLA 3VI1A 2OY2A 1BKCI 1C7KA 4DPEA 4JA1A 1CQRA 1ZVXA 1CGFA 1ZTQA 1XUDA 1AKLA 2MZEA 2JSDA 4IUWA 1XURA 2OW1A 3RTSA 1GE6A 1D5JA 2OW0A 4DV8A 3LUMA 1HFSA 3N2VA 4ILWD 5CUHA 2CLTA 1DMTA 1KBCA 4H49A 1OM7A 1UTTA 5LABA 4WK7A 1Y8JA 2N8RA 2FV5A 3KMCA 1IAEA 1OO9A 1CAQA 4J4MA 1XFXA 2I47A 3EHYA 4L63A 3EDZA 1SLNA 1R54A 4H3XA 4DF9A 3KEJA 1XFZA 3HBUP 2JT6A 3LJZA 5L79A 2ERPA 2DDYA 5I3MA 1S4BP 3KWVC 5CZMA 3TVCA 1ND1A 4H1QA 1SU3A 3DWBA 1GKCA 4HMAA 4AUOA 1BSWA 1O0TA 1XFYA 1YOUA 2YUFA 1H71P 4H84A 2DW1A 3GBOA 2DW0A 3EDIA 1HOVA 3U1RA 2O36A 4JIJA 3UVCA 456CA 1YQYA 1OS2A 1AYKA 1C3IA 3KHIA 3HDBA 2E3XA 1HTDA 1O0QA 1K7QA 1JIZA 3WV3A 1GO7P 1BIWA 3F16A 2OXWA 3DTEA 1XM5A 3LJTA 3ELMA 3P24A 1XAXA 1PWQA 1BQOA 1JIWP 3HBVP 2X3BA 1HV5A 5D3CA 1I1IP 3AYUA 3KRYA 2W13A 1GKDA 3N2UA 2Z2DA 1MMBA 2WO8A 4HX3A 3LJGA 1BQQM 4XCTA 3BA0A 3LMCA 5JMYA 1FBLA 2E2DA 1BKCE 4ON1A 2OW2A 1QIBA 1MMRA 3DL1A 4JPAA 1IADA 5B5PA 966CA 1SATA 2DW2A 4H2EA 4XM8A 3LE9A 1D8MA 1IAAA 2K9CA 4G9LA 4Q1LA 1EB6A 1JANA 3HDAP 5BPAA 2AYKA 1I73A 1EUBA 1A85A 1PWWA 3HB2P 1CIZA 3AIGA 3Q2HA 3F17A 1JKYA 2RJQA 3EWJA 1OM6A 3RTTA 2X7MA 3F1AA 4EFSA 1SLMA 5D7WA 4AYKA 1IABA 1SRPA 3DNGA 5D1TA 4GR0A 3TT4A 4L19A 1RMZA 2OVXA 2YIGA 2O3EA 4CTHA 1ROSA 4WZVA 1CXVA 4GF1A 1D8FA 3EDGA 4FVLA 2A8HA 2OY4A 1OM8A 2D1OA 3DSLA 5L7FA 4PKTA 3B2ZA 1XFWA 1XFUA 1L6JA 2MLRA 4DD8A 3ZVSA 2WO9A 2POJA 2X3AA 4WF6A 1MNCA 1C8TA 5I2ZA 4QKZA 1GE7A 1KUHA 2RJPA 1UMSA 2OI0A 2KRJA 4FXQA 1JAOA 3LEAA 4XM7A 3KEKA 2OVZA 2EROA 4WKEA 4PKUA 2OXZA 3OHOA 2L0RA 1QJIA 2OXUA 3WV1A 4GR3A 2YB9A 1G12A 1XUCA 3USNA 1BUDA 1R55A 1PWUA 3EHXA 1OMJA 2W12A 1Y93A 2DDFA 3V96B 2XS4A 2MZIA 2MLSA 2JT5A 1R1HA 4L6TA 4H82A 3K7LA 1QIAA 5I12A 1YCMA 1SMPA 1K7GA 1J7NA 1UMTA 4XBHA 4G0DA 1B3DA 4GWNA 1MMQA 3ZXHA 3B8ZA 2J0TA 1RM8A 1YP1A 3OHLA 5CXAA 2HU6A 3L0TA 1Y0VA 1QJJA 1IACA 3WV2A 4AXQA 2W0DA 3AYKA 3LIKA 1R1JA 3LQBA 1GXDA 4XM6A 1WNIA 3F15A 3I7GA 1R1IA 4H76A 3F19A 1KUGA 3DPEA 3EDHA 3B92A 1TVIA 4PKRA 5D2BA 4FU4A 1Z3JA 2FV9A 1ATLA 5D1UA 1KUFA 3Q2GA 3LKAA 4JP4A 3I7IA 4PKVA 1I76A 1JH1A 3F18A 1DTHA 4R3VA 3HY9A 1PWPA 1BKCA 1PWVA 1ZS0A 1K7IA 2CKIA 1IAGA 4ZR5A 830CA 4GUYA 1D7XA 1KUIA 3DTIA 1G49A 5H8XA 1KAPP 4IJOA 3NX7A 1JJ9A 1XFVA 1G05A 3SHIA 2USNA 3G42A 5BOYA 3LILA 3K7NA 3KMEA 1FM1A 1KUKA 2MZHA 4GR8A 1EAKA 5I0LA 3HYGA 3LGPA 3MA2A 1G4KA 4I03A 3O2XA 1BUVM 4PKWA 1ASTA 3HY7A 2SRTA 4AIGA 2WOAA 2JNPA 2AIGP 1ZXCA 2J83A 5I4OA 4JQGA 2XS3A 1UTZA 1HFCA 3TS4A 4PKQA 1FLSA 1ZXVA 3KECA 5B5OA 2V4BA 3P1VA 1JAQA 1UEAA 1GO8P 3LQ0A 4IN9A 3LIRA 3CKIA 3DPFA 3E8RA 2Y6CA 2PJTA 4A3WA 1JK3A 3LUNA 4I35A 1HY7A 2ERQA 1GE5A 5BOTA 1BM6A 1CGLA 1MMPA 2Y6DA 3L0VA 4WKIA 1CK7A 1G9KA 5D1SA 4GWMA 4PKSA 1Q3AA 3ZUKA 1B8YA 4A7BA 1OS9A 2QPJA 2OW9A 4L7AA 2JIHA 2W15A 3LK8A 4H30A 1CGEA 1QICA 1AF0A 1OZ9A 2W14A 4FXYP 2X3CA 3G5CA
chains in the Genus database with same CATH topology
1JAPA 1QUAA 3TSKA 5I43A 1BZSA 2K2GA 2D1NA 3O64A 3DTKA 1USNA 1ZP5A 4GQLA 2OZRA 1A86A 3VTGA 2TCLA 3VI1A 2OY2A 1BKCI 1C7KA 4DPEA 4JA1A 1CQRA 1ZVXA 1CGFA 1ZTQA 1XUDA 1AKLA 2MZEA 2JSDA 4IUWA 1XURA 2OW1A 3RTSA 1GE6A 1D5JA 2OW0A 4DV8A 3LUMA 1HFSA 3N2VA 4ILWD 5CUHA 2CLTA 1DMTA 1KBCA 4H49A 1OM7A 1UTTA 5LABA 4WK7A 1Y8JA 2N8RA 2FV5A 3KMCA 1IAEA 1OO9A 1CAQA 4J4MA 1XFXA 2I47A 3EHYA 4L63A 3EDZA 1SLNA 1R54A 4H3XA 4DF9A 3KEJA 1XFZA 3HBUP 2JT6A 3LJZA 5L79A 2ERPA 2DDYA 5I3MA 1S4BP 3KWVC 5CZMA 3TVCA 1ND1A 4H1QA 1SU3A 3DWBA 1GKCA 4HMAA 4AUOA 1BSWA 1O0TA 1XFYA 1YOUA 2YUFA 1H71P 4H84A 2DW1A 3GBOA 2DW0A 3EDIA 1HOVA 3U1RA 2O36A 4JIJA 3UVCA 456CA 1YQYA 1OS2A 1AYKA 1C3IA 3KHIA 3HDBA 2E3XA 1HTDA 1O0QA 1K7QA 1JIZA 3WV3A 1GO7P 1BIWA 3F16A 2OXWA 3DTEA 3LJTA 3ELMA 3P24A 1PWQA 1BQOA 1JIWP 3HBVP 2X3BA 1HV5A 5D3CA 1I1IP 3AYUA 3KRYA 2W13A 1GKDA 3N2UA 2Z2DA 1MMBA 2WO8A 4HX3A 3LJGA 1BQQM 4XCTA 3BA0A 3LMCA 5JMYA 1FBLA 2E2DA 1BKCE 4ON1A 2OW2A 1QIBA 1MMRA 3DL1A 4JPAA 1IADA 5B5PA 966CA 1SATA 2DW2A 4H2EA 4XM8A 3LE9A 1D8MA 1IAAA 2K9CA 4G9LA 4Q1LA 1EB6A 1JANA 3HDAP 5BPAA 2AYKA 1I73A 1EUBA 1A85A 1PWWA 3HB2P 1CIZA 3AIGA 3Q2HA 3F17A 1JKYA 2RJQA 3EWJA 1OM6A 3RTTA 2X7MA 3F1AA 4EFSA 1SLMA 5D7WA 4AYKA 1IABA 1SRPA 3DNGA 5D1TA 4GR0A 3TT4A 4L19A 1RMZA 2OVXA 2YIGA 2O3EA 4CTHA 1ROSA 4WZVA 1CXVA 4GF1A 1D8FA 3EDGA 4FVLA 2A8HA 2OY4A 1OM8A 2D1OA 3DSLA 5L7FA 4PKTA 3B2ZA 1XFWA 1XFUA 1L6JA 2MLRA 4DD8A 3ZVSA 2WO9A 2POJA 2X3AA 4WF6A 1MNCA 1C8TA 5I2ZA 4QKZA 1GE7A 1KUHA 2RJPA 1UMSA 2OI0A 2KRJA 4FXQA 1JAOA 3LEAA 4XM7A 3KEKA 2OVZA 2EROA 4WKEA 4PKUA 2OXZA 3OHOA 2L0RA 1QJIA 2OXUA 3WV1A 4GR3A 2YB9A 1G12A 1XUCA 3USNA 1BUDA 1R55A 1PWUA 3EHXA 1OMJA 2W12A 1Y93A 2DDFA 3V96B 2XS4A 2MZIA 2MLSA 2JT5A 1R1HA 4L6TA 4H82A 3K7LA 1QIAA 5I12A 1YCMA 1SMPA 1K7GA 1J7NA 1UMTA 4XBHA 4G0DA 1B3DA 4GWNA 1MMQA 3ZXHA 3B8ZA 2J0TA 1RM8A 1YP1A 3OHLA 5CXAA 2HU6A 3L0TA 1Y0VA 1QJJA 1IACA 3WV2A 4AXQA 2W0DA 3AYKA 3LIKA 1R1JA 3LQBA 1GXDA 4XM6A 1WNIA 3F15A 3I7GA 1R1IA 4H76A 3F19A 1KUGA 3DPEA 3EDHA 3B92A 4PKRA 5D2BA 4FU4A 1Z3JA 2FV9A 1ATLA 5D1UA 1KUFA 3Q2GA 3LKAA 4JP4A 3I7IA 4PKVA 1I76A 1JH1A 3F18A 1DTHA 4R3VA 3HY9A 1PWPA 1BKCA 1PWVA 1ZS0A 1K7IA 2CKIA 1IAGA 4ZR5A 830CA 4GUYA 1D7XA 1KUIA 3DTIA 1G49A 5H8XA 1KAPP 4IJOA 3NX7A 1JJ9A 1XFVA 1G05A 3SHIA 2USNA 3G42A 5BOYA 3LILA 3K7NA 3KMEA 1FM1A 1KUKA 2MZHA 4GR8A 1EAKA 5I0LA 3HYGA 3LGPA 3MA2A 1G4KA 4I03A 3O2XA 1BUVM 4PKWA 1ASTA 3HY7A 2SRTA 4AIGA 2WOAA 2JNPA 2AIGP 1ZXCA 2J83A 5I4OA 4JQGA 2XS3A 1UTZA 1HFCA 3TS4A 4PKQA 1FLSA 1ZXVA 3KECA 5B5OA 2V4BA 3P1VA 1JAQA 1UEAA 1GO8P 3LQ0A 4IN9A 3LIRA 3CKIA 3DPFA 3E8RA 2Y6CA 2PJTA 4A3WA 1JK3A 3LUNA 4I35A 1HY7A 2ERQA 1GE5A 5BOTA 1BM6A 1CGLA 1MMPA 2Y6DA 3L0VA 4WKIA 1CK7A 1G9KA 5D1SA 4GWMA 4PKSA 1Q3AA 3ZUKA 1B8YA 4A7BA 1OS9A 2QPJA 2OW9A 4L7AA 2JIHA 2W15A 3LK8A 4H30A 1CGEA 1QICA 1AF0A 2W14A 4FXYP 2X3CA 3G5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAP A;  1QUA A;  3TSK A;  5I43 A;  1BZS A;  2K2G A;  2D1N A;  3O64 A;  1USN A;  1ZP5 A;  4GQL A;  2OZR A;  1A86 A;  3VTG A;  2TCL A;  3VI1 A;  2OY2 A;  1BKC I;  1C7K A;  4DPE A;  4JA1 A;  1CQR A;  1ZVX A;  1CGF A;  1ZTQ A;  1XUD A;  1AKL A;  2MZE A;  2JSD A;  4IUW A;  1XUR A;  2OW1 A;  3RTS A;  1GE6 A;  1D5J A;  2OW0 A;  4DV8 A;  3LUM A;  1HFS A;  3N2V A;  4ILW D;  5CUH A;  2CLT A;  1DMT A;  1KBC A;  4H49 A;  1OM7 A;  1UTT A;  5LAB A;  4WK7 A;  1Y8J A;  2N8R A;  2FV5 A;  3KMC A;  1IAE A;  1OO9 A;  1CAQ A;  4J4M A;  1XFX A;  2I47 A;  3EHY A;  4L63 A;  3EDZ A;  1SLN A;  1R54 A;  4H3X A;  4DF9 A;  3KEJ A;  1XFZ A;  3HBU P;  2JT6 A;  3LJZ A;  5L79 A;  2ERP A;  2DDY A;  5I3M A;  1S4B P;  3KWV C;  5CZM A;  3TVC A;  1ND1 A;  4H1Q A;  1SU3 A;  3DWB A;  1GKC A;  4HMA A;  4AUO A;  1BSW A;  1O0T A;  1XFY A;  1YOU A;  1H71 P;  4H84 A;  2DW1 A;  3GBO A;  2DW0 A;  3EDI A;  1HOV A;  3U1R A;  2O36 A;  4JIJ A;  3UVC A;  456C A;  1YQY A;  1OS2 A;  1AYK A;  1C3I A;  3KHI A;  3HDB A;  2E3X A;  1HTD A;  1O0Q A;  1K7Q A;  1JIZ A;  3WV3 A;  1GO7 P;  1BIW A;  3F16 A;  2OXW A;  3LJT A;  3ELM A;  3P24 A;  1PWQ A;  1BQO A;  1JIW P;  3HBV P;  2X3B A;  1HV5 A;  5D3C A;  1I1I P;  3AYU A;  3KRY A;  2W13 A;  1GKD A;  3N2U A;  2Z2D A;  1MMB A;  2WO8 A;  4HX3 A;  3LJG A;  1BQQ M;  4XCT A;  3BA0 A;  3LMC A;  5JMY A;  1FBL A;  2E2D A;  1BKC E;  4ON1 A;  2OW2 A;  1QIB A;  1MMR A;  3DL1 A;  4JPA A;  1IAD A;  5B5P A;  966C A;  1SAT A;  2DW2 A;  4H2E A;  4XM8 A;  3LE9 A;  1D8M A;  1IAA A;  2K9C A;  4G9L A;  4Q1L A;  1EB6 A;  1JAN A;  3HDA P;  5BPA A;  2AYK A;  1I73 A;  1EUB A;  1A85 A;  1PWW A;  3HB2 P;  1CIZ A;  3AIG A;  3Q2H A;  3F17 A;  1JKY A;  2RJQ A;  3EWJ A;  1OM6 A;  3RTT A;  2X7M A;  3F1A A;  4EFS A;  1SLM A;  5D7W A;  4AYK A;  1IAB A;  1SRP A;  3DNG A;  5D1T A;  4GR0 A;  3TT4 A;  4L19 A;  1RMZ A;  2OVX A;  2YIG A;  2O3E A;  4CTH A;  1ROS A;  4WZV A;  1CXV A;  4GF1 A;  1D8F A;  3EDG A;  4FVL A;  2A8H A;  2OY4 A;  1OM8 A;  2D1O A;  3DSL A;  5L7F A;  4PKT A;  3B2Z A;  1XFW A;  1XFU A;  1L6J A;  2MLR A;  4DD8 A;  3ZVS A;  2WO9 A;  2POJ A;  2X3A A;  4WF6 A;  1MNC A;  1C8T A;  5I2Z A;  4QKZ A;  1GE7 A;  1KUH A;  2RJP A;  1UMS A;  2OI0 A;  2KRJ A;  4FXQ A;  1JAO A;  3LEA A;  4XM7 A;  3KEK A;  2OVZ A;  2ERO A;  4WKE A;  4PKU A;  2OXZ A;  3OHO A;  2L0R A;  1QJI A;  2OXU A;  3WV1 A;  4GR3 A;  2YB9 A;  1G12 A;  1XUC A;  3USN A;  1BUD A;  1R55 A;  1PWU A;  3EHX A;  1OMJ A;  2W12 A;  1Y93 A;  2DDF A;  3V96 B;  2XS4 A;  2MZI A;  2MLS A;  2JT5 A;  1R1H A;  4L6T A;  4H82 A;  3K7L A;  1QIA A;  5I12 A;  1YCM A;  1SMP A;  1K7G A;  1J7N A;  1UMT A;  4XBH A;  4G0D A;  1B3D A;  4GWN A;  1MMQ A;  3ZXH A;  3B8Z A;  2J0T A;  1RM8 A;  1YP1 A;  3OHL A;  5CXA A;  2HU6 A;  3L0T A;  1Y0V A;  1QJJ A;  1IAC A;  3WV2 A;  4AXQ A;  2W0D A;  3AYK A;  3LIK A;  1R1J A;  3LQB A;  1GXD A;  4XM6 A;  1WNI A;  3F15 A;  3I7G A;  1R1I A;  4H76 A;  3F19 A;  1KUG A;  3DPE A;  3EDH A;  3B92 A;  4PKR A;  5D2B A;  4FU4 A;  1Z3J A;  2FV9 A;  1ATL A;  5D1U A;  1KUF A;  3Q2G A;  3LKA A;  4JP4 A;  3I7I A;  4PKV A;  1I76 A;  1JH1 A;  3F18 A;  1DTH A;  4R3V A;  3HY9 A;  1PWP A;  1BKC A;  1PWV A;  1ZS0 A;  1K7I A;  2CKI A;  1IAG A;  4ZR5 A;  830C A;  4GUY A;  1D7X A;  1KUI A;  1G49 A;  5H8X A;  1KAP P;  4IJO A;  3NX7 A;  1JJ9 A;  1XFV A;  1G05 A;  3SHI A;  2USN A;  3G42 A;  5BOY A;  3LIL A;  3K7N A;  3KME A;  1FM1 A;  1KUK A;  2MZH A;  4GR8 A;  1EAK A;  5I0L A;  3HYG A;  3LGP A;  3MA2 A;  1G4K A;  4I03 A;  3O2X A;  1BUV M;  4PKW A;  1AST A;  3HY7 A;  2SRT A;  4AIG A;  2WOA A;  2JNP A;  2AIG P;  1ZXC A;  2J83 A;  5I4O A;  4JQG A;  2XS3 A;  1UTZ A;  1HFC A;  3TS4 A;  4PKQ A;  1FLS A;  1ZXV A;  3KEC A;  5B5O A;  2V4B A;  3P1V A;  1JAQ A;  1UEA A;  1GO8 P;  3LQ0 A;  4IN9 A;  3LIR A;  3CKI A;  3DPF A;  3E8R A;  2Y6C A;  2PJT A;  4A3W A;  1JK3 A;  3LUN A;  4I35 A;  1HY7 A;  2ERQ A;  1GE5 A;  5BOT A;  1BM6 A;  1CGL A;  1MMP A;  2Y6D A;  3L0V A;  4WKI A;  1CK7 A;  1G9K A;  5D1S A;  4GWM A;  4PKS A;  1Q3A A;  3ZUK A;  1B8Y A;  4A7B A;  1OS9 A;  2QPJ A;  2OW9 A;  2JIH A;  2W15 A;  3LK8 A;  4H30 A;  1CGE A;  1QIC A;  1AF0 A;  2W14 A;  4FXY P;  2X3C A;  3G5C A; 
#chains in the Genus database with same CATH topology
 1JAP A;  1QUA A;  3TSK A;  5I43 A;  1BZS A;  2K2G A;  2D1N A;  3O64 A;  3DTK A;  1USN A;  1ZP5 A;  4GQL A;  2OZR A;  1A86 A;  3VTG A;  2TCL A;  3VI1 A;  2OY2 A;  1BKC I;  1C7K A;  4DPE A;  4JA1 A;  1CQR A;  1ZVX A;  1CGF A;  1ZTQ A;  1XUD A;  1AKL A;  2MZE A;  2JSD A;  4IUW A;  1XUR A;  2OW1 A;  3RTS A;  1GE6 A;  1D5J A;  2OW0 A;  4DV8 A;  3LUM A;  1HFS A;  3N2V A;  4ILW D;  5CUH A;  2CLT A;  1DMT A;  1KBC A;  4H49 A;  1OM7 A;  1UTT A;  5LAB A;  4WK7 A;  1Y8J A;  2N8R A;  2FV5 A;  3KMC A;  1IAE A;  1OO9 A;  1CAQ A;  4J4M A;  1XFX A;  2I47 A;  3EHY A;  4L63 A;  3EDZ A;  1SLN A;  1R54 A;  4H3X A;  4DF9 A;  3KEJ A;  1XFZ A;  3HBU P;  2JT6 A;  3LJZ A;  5L79 A;  2ERP A;  2DDY A;  5I3M A;  1S4B P;  3KWV C;  5CZM A;  3TVC A;  1ND1 A;  4H1Q A;  1SU3 A;  3DWB A;  1GKC A;  4HMA A;  4AUO A;  1BSW A;  1O0T A;  1XFY A;  1YOU A;  2YUF A;  1H71 P;  4H84 A;  2DW1 A;  3GBO A;  2DW0 A;  3EDI A;  1HOV A;  3U1R A;  2O36 A;  4JIJ A;  3UVC A;  456C A;  1YQY A;  1OS2 A;  1AYK A;  1C3I A;  3KHI A;  3HDB A;  2E3X A;  1HTD A;  1O0Q A;  1K7Q A;  1JIZ A;  3WV3 A;  1GO7 P;  1BIW A;  3F16 A;  2OXW A;  3DTE A;  1XM5 A;  3LJT A;  3ELM A;  3P24 A;  1XAX A;  1PWQ A;  1BQO A;  1JIW P;  3HBV P;  2X3B A;  1HV5 A;  5D3C A;  1I1I P;  3AYU A;  3KRY A;  2W13 A;  1GKD A;  3N2U A;  2Z2D A;  1MMB A;  2WO8 A;  4HX3 A;  3LJG A;  1BQQ M;  4XCT A;  3BA0 A;  3LMC A;  5JMY A;  1FBL A;  2E2D A;  1BKC E;  4ON1 A;  2OW2 A;  1QIB A;  1MMR A;  3DL1 A;  4JPA A;  1IAD A;  5B5P A;  966C A;  1SAT A;  2DW2 A;  4H2E A;  4XM8 A;  3LE9 A;  1D8M A;  1IAA A;  2K9C A;  4G9L A;  4Q1L A;  1EB6 A;  1JAN A;  3HDA P;  5BPA A;  2AYK A;  1I73 A;  1EUB A;  1A85 A;  1PWW A;  3HB2 P;  1CIZ A;  3AIG A;  3Q2H A;  3F17 A;  1JKY A;  2RJQ A;  3EWJ A;  1OM6 A;  3RTT A;  2X7M A;  3F1A A;  4EFS A;  1SLM A;  5D7W A;  4AYK A;  1IAB A;  1SRP A;  3DNG A;  5D1T A;  4GR0 A;  3TT4 A;  4L19 A;  1RMZ A;  2OVX A;  2YIG A;  2O3E A;  4CTH A;  1ROS A;  4WZV A;  1CXV A;  4GF1 A;  1D8F A;  3EDG A;  4FVL A;  2A8H A;  2OY4 A;  1OM8 A;  2D1O A;  3DSL A;  5L7F A;  4PKT A;  3B2Z A;  1XFW A;  1XFU A;  1L6J A;  2MLR A;  4DD8 A;  3ZVS A;  2WO9 A;  2POJ A;  2X3A A;  4WF6 A;  1MNC A;  1C8T A;  5I2Z A;  4QKZ A;  1GE7 A;  1KUH A;  2RJP A;  1UMS A;  2OI0 A;  2KRJ A;  4FXQ A;  1JAO A;  3LEA A;  4XM7 A;  3KEK A;  2OVZ A;  2ERO A;  4WKE A;  4PKU A;  2OXZ A;  3OHO A;  2L0R A;  1QJI A;  2OXU A;  3WV1 A;  4GR3 A;  2YB9 A;  1G12 A;  1XUC A;  3USN A;  1BUD A;  1R55 A;  1PWU A;  3EHX A;  1OMJ A;  2W12 A;  1Y93 A;  2DDF A;  3V96 B;  2XS4 A;  2MZI A;  2MLS A;  2JT5 A;  1R1H A;  4L6T A;  4H82 A;  3K7L A;  1QIA A;  5I12 A;  1YCM A;  1SMP A;  1K7G A;  1J7N A;  1UMT A;  4XBH A;  4G0D A;  1B3D A;  4GWN A;  1MMQ A;  3ZXH A;  3B8Z A;  2J0T A;  1RM8 A;  1YP1 A;  3OHL A;  5CXA A;  2HU6 A;  3L0T A;  1Y0V A;  1QJJ A;  1IAC A;  3WV2 A;  4AXQ A;  2W0D A;  3AYK A;  3LIK A;  1R1J A;  3LQB A;  1GXD A;  4XM6 A;  1WNI A;  3F15 A;  3I7G A;  1R1I A;  4H76 A;  3F19 A;  1KUG A;  3DPE A;  3EDH A;  3B92 A;  1TVI A;  4PKR A;  5D2B A;  4FU4 A;  1Z3J A;  2FV9 A;  1ATL A;  5D1U A;  1KUF A;  3Q2G A;  3LKA A;  4JP4 A;  3I7I A;  4PKV A;  1I76 A;  1JH1 A;  3F18 A;  1DTH A;  4R3V A;  3HY9 A;  1PWP A;  1BKC A;  1PWV A;  1ZS0 A;  1K7I A;  2CKI A;  1IAG A;  4ZR5 A;  830C A;  4GUY A;  1D7X A;  1KUI A;  3DTI A;  1G49 A;  5H8X A;  1KAP P;  4IJO A;  3NX7 A;  1JJ9 A;  1XFV A;  1G05 A;  3SHI A;  2USN A;  3G42 A;  5BOY A;  3LIL A;  3K7N A;  3KME A;  1FM1 A;  1KUK A;  2MZH A;  4GR8 A;  1EAK A;  5I0L A;  3HYG A;  3LGP A;  3MA2 A;  1G4K A;  4I03 A;  3O2X A;  1BUV M;  4PKW A;  1AST A;  3HY7 A;  2SRT A;  4AIG A;  2WOA A;  2JNP A;  2AIG P;  1ZXC A;  2J83 A;  5I4O A;  4JQG A;  2XS3 A;  1UTZ A;  1HFC A;  3TS4 A;  4PKQ A;  1FLS A;  1ZXV A;  3KEC A;  5B5O A;  2V4B A;  3P1V A;  1JAQ A;  1UEA A;  1GO8 P;  3LQ0 A;  4IN9 A;  3LIR A;  3CKI A;  3DPF A;  3E8R A;  2Y6C A;  2PJT A;  4A3W A;  1JK3 A;  3LUN A;  4I35 A;  1HY7 A;  2ERQ A;  1GE5 A;  5BOT A;  1BM6 A;  1CGL A;  1MMP A;  2Y6D A;  3L0V A;  4WKI A;  1CK7 A;  1G9K A;  5D1S A;  4GWM A;  4PKS A;  1Q3A A;  3ZUK A;  1B8Y A;  4A7B A;  1OS9 A;  2QPJ A;  2OW9 A;  4L7A A;  2JIH A;  2W15 A;  3LK8 A;  4H30 A;  1CGE A;  1QIC A;  1AF0 A;  1OZ9 A;  2W14 A;  4FXY P;  2X3C A;  3G5C A; 
#chains in the Genus database with same CATH homology
 1JAP A;  1QUA A;  3TSK A;  5I43 A;  1BZS A;  2K2G A;  2D1N A;  3O64 A;  3DTK A;  1USN A;  1ZP5 A;  4GQL A;  2OZR A;  1A86 A;  3VTG A;  2TCL A;  3VI1 A;  2OY2 A;  1BKC I;  1C7K A;  4DPE A;  4JA1 A;  1CQR A;  1ZVX A;  1CGF A;  1ZTQ A;  1XUD A;  1AKL A;  2MZE A;  2JSD A;  4IUW A;  1XUR A;  2OW1 A;  3RTS A;  1GE6 A;  1D5J A;  2OW0 A;  4DV8 A;  3LUM A;  1HFS A;  3N2V A;  4ILW D;  5CUH A;  2CLT A;  1DMT A;  1KBC A;  4H49 A;  1OM7 A;  1UTT A;  5LAB A;  4WK7 A;  1Y8J A;  2N8R A;  2FV5 A;  3KMC A;  1IAE A;  1OO9 A;  1CAQ A;  4J4M A;  1XFX A;  2I47 A;  3EHY A;  4L63 A;  3EDZ A;  1SLN A;  1R54 A;  4H3X A;  4DF9 A;  3KEJ A;  1XFZ A;  3HBU P;  2JT6 A;  3LJZ A;  5L79 A;  2ERP A;  2DDY A;  5I3M A;  1S4B P;  3KWV C;  5CZM A;  3TVC A;  1ND1 A;  4H1Q A;  1SU3 A;  3DWB A;  1GKC A;  4HMA A;  4AUO A;  1BSW A;  1O0T A;  1XFY A;  1YOU A;  2YUF A;  1H71 P;  4H84 A;  2DW1 A;  3GBO A;  2DW0 A;  3EDI A;  1HOV A;  3U1R A;  2O36 A;  4JIJ A;  3UVC A;  456C A;  1YQY A;  1OS2 A;  1AYK A;  1C3I A;  3KHI A;  3HDB A;  2E3X A;  1HTD A;  1O0Q A;  1K7Q A;  1JIZ A;  3WV3 A;  1GO7 P;  1BIW A;  3F16 A;  2OXW A;  3DTE A;  3LJT A;  3ELM A;  3P24 A;  1PWQ A;  1BQO A;  1JIW P;  3HBV P;  2X3B A;  1HV5 A;  5D3C A;  1I1I P;  3AYU A;  3KRY A;  2W13 A;  1GKD A;  3N2U A;  2Z2D A;  1MMB A;  2WO8 A;  4HX3 A;  3LJG A;  1BQQ M;  4XCT A;  3BA0 A;  3LMC A;  5JMY A;  1FBL A;  2E2D A;  1BKC E;  4ON1 A;  2OW2 A;  1QIB A;  1MMR A;  3DL1 A;  4JPA A;  1IAD A;  5B5P A;  966C A;  1SAT A;  2DW2 A;  4H2E A;  4XM8 A;  3LE9 A;  1D8M A;  1IAA A;  2K9C A;  4G9L A;  4Q1L A;  1EB6 A;  1JAN A;  3HDA P;  5BPA A;  2AYK A;  1I73 A;  1EUB A;  1A85 A;  1PWW A;  3HB2 P;  1CIZ A;  3AIG A;  3Q2H A;  3F17 A;  1JKY A;  2RJQ A;  3EWJ A;  1OM6 A;  3RTT A;  2X7M A;  3F1A A;  4EFS A;  1SLM A;  5D7W A;  4AYK A;  1IAB A;  1SRP A;  3DNG A;  5D1T A;  4GR0 A;  3TT4 A;  4L19 A;  1RMZ A;  2OVX A;  2YIG A;  2O3E A;  4CTH A;  1ROS A;  4WZV A;  1CXV A;  4GF1 A;  1D8F A;  3EDG A;  4FVL A;  2A8H A;  2OY4 A;  1OM8 A;  2D1O A;  3DSL A;  5L7F A;  4PKT A;  3B2Z A;  1XFW A;  1XFU A;  1L6J A;  2MLR A;  4DD8 A;  3ZVS A;  2WO9 A;  2POJ A;  2X3A A;  4WF6 A;  1MNC A;  1C8T A;  5I2Z A;  4QKZ A;  1GE7 A;  1KUH A;  2RJP A;  1UMS A;  2OI0 A;  2KRJ A;  4FXQ A;  1JAO A;  3LEA A;  4XM7 A;  3KEK A;  2OVZ A;  2ERO A;  4WKE A;  4PKU A;  2OXZ A;  3OHO A;  2L0R A;  1QJI A;  2OXU A;  3WV1 A;  4GR3 A;  2YB9 A;  1G12 A;  1XUC A;  3USN A;  1BUD A;  1R55 A;  1PWU A;  3EHX A;  1OMJ A;  2W12 A;  1Y93 A;  2DDF A;  3V96 B;  2XS4 A;  2MZI A;  2MLS A;  2JT5 A;  1R1H A;  4L6T A;  4H82 A;  3K7L A;  1QIA A;  5I12 A;  1YCM A;  1SMP A;  1K7G A;  1J7N A;  1UMT A;  4XBH A;  4G0D A;  1B3D A;  4GWN A;  1MMQ A;  3ZXH A;  3B8Z A;  2J0T A;  1RM8 A;  1YP1 A;  3OHL A;  5CXA A;  2HU6 A;  3L0T A;  1Y0V A;  1QJJ A;  1IAC A;  3WV2 A;  4AXQ A;  2W0D A;  3AYK A;  3LIK A;  1R1J A;  3LQB A;  1GXD A;  4XM6 A;  1WNI A;  3F15 A;  3I7G A;  1R1I A;  4H76 A;  3F19 A;  1KUG A;  3DPE A;  3EDH A;  3B92 A;  4PKR A;  5D2B A;  4FU4 A;  1Z3J A;  2FV9 A;  1ATL A;  5D1U A;  1KUF A;  3Q2G A;  3LKA A;  4JP4 A;  3I7I A;  4PKV A;  1I76 A;  1JH1 A;  3F18 A;  1DTH A;  4R3V A;  3HY9 A;  1PWP A;  1BKC A;  1PWV A;  1ZS0 A;  1K7I A;  2CKI A;  1IAG A;  4ZR5 A;  830C A;  4GUY A;  1D7X A;  1KUI A;  3DTI A;  1G49 A;  5H8X A;  1KAP P;  4IJO A;  3NX7 A;  1JJ9 A;  1XFV A;  1G05 A;  3SHI A;  2USN A;  3G42 A;  5BOY A;  3LIL A;  3K7N A;  3KME A;  1FM1 A;  1KUK A;  2MZH A;  4GR8 A;  1EAK A;  5I0L A;  3HYG A;  3LGP A;  3MA2 A;  1G4K A;  4I03 A;  3O2X A;  1BUV M;  4PKW A;  1AST A;  3HY7 A;  2SRT A;  4AIG A;  2WOA A;  2JNP A;  2AIG P;  1ZXC A;  2J83 A;  5I4O A;  4JQG A;  2XS3 A;  1UTZ A;  1HFC A;  3TS4 A;  4PKQ A;  1FLS A;  1ZXV A;  3KEC A;  5B5O A;  2V4B A;  3P1V A;  1JAQ A;  1UEA A;  1GO8 P;  3LQ0 A;  4IN9 A;  3LIR A;  3CKI A;  3DPF A;  3E8R A;  2Y6C A;  2PJT A;  4A3W A;  1JK3 A;  3LUN A;  4I35 A;  1HY7 A;  2ERQ A;  1GE5 A;  5BOT A;  1BM6 A;  1CGL A;  1MMP A;  2Y6D A;  3L0V A;  4WKI A;  1CK7 A;  1G9K A;  5D1S A;  4GWM A;  4PKS A;  1Q3A A;  3ZUK A;  1B8Y A;  4A7B A;  1OS9 A;  2QPJ A;  2OW9 A;  4L7A A;  2JIH A;  2W15 A;  3LK8 A;  4H30 A;  1CGE A;  1QIC A;  1AF0 A;  2W14 A;  4FXY P;  2X3C A;  3G5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...