4WZVA

Crystal structure of a hydroxamate based inhibitor en140 in complex with the mmp-9 catalytic domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrix metalloproteinase-9,Matrix metalloproteinase-9
publication title N-O-Isopropyl Sulfonamido-Based Hydroxamates as Matrix Metalloproteinase Inhibitors: Hit Selection and in Vivo Antiangiogenic Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4wzvA00
1UTZA 4GR3A 2YIGA 1EUBA 4JA1A 3V96B 3AYKA 1ASTA 1SU3A 1GKDA 1Y8JA 3WV3A 1PWWA 2W14A 2X7MA 1AYKA 2D1OA 2Y6DA 1K7QA 3HYGA 3DWBA 1HY7A 1IACA 1CK7A 1HFSA 5LABA 2JT5A 4JIJA 4H30A 1SLNA 4PKSA 2O36A 4GWMA 2DW0A 3GBOA 3KMCA 3F17A 1BM6A 3HB2P 4ON1A 1PWPA 1OM6A 5B5OA 4J4MA 3LJGA 1XUDA 1HOVA 2O3EA 1XFWA 3EWJA 1USNA 4GR8A 3LQBA 3LJZA 3G5CA 1KUIA 5B5PA 1BKCI 2OXWA 3USNA 1C3IA 1RMZA 2HU6A 1A85A 1MMQA 1GE5A 4XM8A 1R1HA 1GKCA 3LILA 1G49A 3LMCA 2W0DA 3SHIA 3AIGA 3UVCA 5CXAA 4GQLA 3U1RA 3DPFA 2J83A 1ND1A 4DV8A 4R3VA 2POJA 1GXDA 5BOYA 1G05A 2OXUA 4AUOA 1K7IA 1HFCA 1JAPA 1SRPA 4G0DA 1IAEA 5D1SA 1IADA 4A7BA 1QJIA 5D2BA 2OI0A 2X3AA 4EFSA 2USNA 1B8YA 1SMPA 2I47A 3B92A 3KWVC 4PKRA 4H84A 5I3MA 4GUYA 1XFVA 4AYKA 3L0TA 5I2ZA 3VI1A 1Z3JA 4PKWA 2FV5A 2MLRA 5I43A 4WKIA 4AXQA 1PWQA 5CZMA 4L63A 3VTGA 3KMEA 2V4BA 1OO9A 4FU4A 1R54A 4AIGA 2MLSA 456CA 3F18A 1GO7P 3B2ZA 1R55A 1FM1A 4WZVA 2CKIA 2ERQA 3P24A 3TSKA 5D1TA 5BOTA 4HX3A 1BZSA 1MNCA 4XBHA 1PWVA 4H3XA 1O0TA 1FBLA 2OW9A 1ZS0A 2SRTA 4PKQA 1C8TA 1XFXA 1KUFA 3LGPA 2AIGP 1BQOA 4HMAA 1ATLA 1OS2A 3EDIA 1Y0VA 3EDHA 2DDYA 2FV9A 3EDGA 3EHYA 1G9KA 4CTHA 1O0QA 1R1IA 1D8MA 2DW1A 4JQGA 1XFYA 2K2GA 830CA 2JT6A 3O2XA 3TT4A 3DL1A 3KHIA 2OZRA 4GWNA 1KBCA 1OM7A 4H82A 2OVZA 1QJJA 4JP4A 1JAQA 5I12A 3HY9A 4ILWD 3TVCA 2YB9A 4QKZA 1B3DA 1Y93A 4PKTA 3TS4A 1D8FA 1IAGA 1BKCA 2E3XA 1JH1A 2A8HA 1BIWA 2MZHA 1BSWA 1JIZA 1JANA 1OM8A 3O64A 3WV1A 1UEAA 2W15A 1WNIA 1OMJA 2XS3A 1MMRA 3KEJA 3Q2GA 1C7KA 4H76A 4ZR5A 1YP1A 5H8XA 1QUAA 2DDFA 1I1IP 4G9LA 1JAOA 2OY2A 3BA0A 1I76A 1ROSA 1KUKA 1QICA 1ZXCA 2ERPA 4XM7A 3LUNA 1XFUA 1H71P 3WV2A 3DPEA 3MA2A 1UMSA 3L0VA 5D3CA 2L0RA 4IN9A 1BKCE 2WO9A 1YOUA 5L7FA 4I03A 2RJQA 1CIZA 2EROA 1OS9A 1XURA 966CA 3OHOA 4WF6A 1GE6A 3LQ0A 1CGLA 2JSDA 2OW0A 4Q1LA 3HDAP 3LEAA 4WK7A 1CXVA 1DMTA 2X3CA 1GO8P 1PWUA 2OW1A 2MZIA 2K9CA 3P1VA 1AF0A 1CAQA 2RJPA 2TCLA 3RTSA 1CGEA 3N2VA 3EDZA 2D1NA 1GE7A 3F19A 4FXQA 4JPAA 2QPJA 1BUVM 2Z2DA 3CKIA 1FLSA 2OW2A 3LIKA 5I0LA 4GF1A 4FVLA 1MMPA 3F15A 3ZVSA 1ZVXA 1KAPP 1I73A 3I7GA 3HBUP 3KECA 2W12A 2X3BA 1K7GA 1G12A 5D7WA 2N8RA 1JIWP 1ZP5A 1Q3AA 1HV5A 1IABA 2OXZA 1UMTA 3OHLA 5L79A 4L19A 1JK3A 2CLTA 4DF9A 5I4OA 3G42A 1JJ9A 3F16A 3LKAA 3ZXHA 1KUHA 3NX7A 3KEKA 2Y6CA 2PJTA 3N2UA 4DPEA 3K7LA 1KUGA 4A3WA 1SATA 2KRJA 3LIRA 4H49A 1S4BP 2JIHA 3B8ZA 2AYKA 1IAAA 1BQQM 5D1UA 1G4KA 1EAKA 1DTHA 4PKVA 1CQRA 5JMYA 1CGFA 2JNPA 1D5JA 1UTTA 5CUHA 1EB6A 3E8RA 3K7NA 1YQYA 2DW2A 3DNGA 4PKUA 4L6TA 4WKEA 3AYUA 1L6JA 3KRYA 4IJOA 3LUMA 1SLMA 4IUWA 3LE9A 2J0TA 4H2EA 3RTTA 4FXYP 1XFZA 1XUCA 3F1AA 3HDBA 3HBVP 3Q2HA 3ELMA 2WO8A 2E2DA 2XS4A 1QIAA 1A86A 3I7IA 5BPAA 2W13A 1MMBA 3EHXA 1BUDA 4I35A 2OVXA 1J7NA 3DSLA 3HY7A 4H1QA 3LJTA 4XM6A 1RM8A 2MZEA 3ZUKA 1D7XA 1R1JA 1JKYA 2WOAA 1ZTQA 4DD8A 1YCMA 4XCTA 1HTDA 1QIBA 3LK8A 1ZXVA 4GR0A 1AKLA 2OY4A
chains in the Genus database with same CATH superfamily
1UTZA 4GR3A 2YIGA 1EUBA 4JA1A 3V96B 3AYKA 1ASTA 1SU3A 1GKDA 1Y8JA 3WV3A 1PWWA 2W14A 2X7MA 1AYKA 2D1OA 2Y6DA 1K7QA 3HYGA 3DWBA 1HY7A 1IACA 1CK7A 1HFSA 5LABA 2JT5A 4JIJA 4H30A 1SLNA 4PKSA 2O36A 4GWMA 2DW0A 3GBOA 3KMCA 3F17A 1BM6A 3HB2P 4ON1A 1PWPA 1OM6A 5B5OA 4J4MA 3LJGA 1XUDA 1HOVA 2O3EA 1XFWA 3EWJA 1USNA 4GR8A 3LQBA 3LJZA 3DTIA 3G5CA 1KUIA 5B5PA 1BKCI 2OXWA 3USNA 1C3IA 1RMZA 2HU6A 1A85A 1MMQA 1GE5A 4XM8A 1R1HA 1GKCA 3LILA 1G49A 3LMCA 2W0DA 3SHIA 3AIGA 3UVCA 5CXAA 4GQLA 3U1RA 3DPFA 2J83A 1ND1A 4DV8A 4R3VA 2POJA 1GXDA 5BOYA 1G05A 2OXUA 4AUOA 1XAXA 1K7IA 1HFCA 1JAPA 1SRPA 4G0DA 1IAEA 5D1SA 1IADA 4A7BA 1QJIA 5D2BA 2OI0A 2X3AA 4EFSA 2USNA 1B8YA 1SMPA 2I47A 3B92A 3KWVC 4PKRA 4H84A 5I3MA 4GUYA 1XFVA 4AYKA 3L0TA 5I2ZA 3VI1A 1Z3JA 4PKWA 2FV5A 2MLRA 5I43A 4WKIA 4AXQA 1PWQA 5CZMA 4L63A 3VTGA 3KMEA 2V4BA 1OO9A 4FU4A 1R54A 4AIGA 2MLSA 456CA 3F18A 1GO7P 3B2ZA 1R55A 1FM1A 4WZVA 2CKIA 2ERQA 3P24A 3TSKA 5D1TA 5BOTA 4HX3A 1BZSA 1MNCA 4XBHA 1PWVA 4H3XA 1O0TA 1FBLA 2OW9A 1ZS0A 2SRTA 4PKQA 1C8TA 1XFXA 1KUFA 3LGPA 2AIGP 1BQOA 4HMAA 1ATLA 1OS2A 3EDIA 1Y0VA 3EDHA 2DDYA 2FV9A 3EDGA 3EHYA 1G9KA 4CTHA 1O0QA 1R1IA 1D8MA 2DW1A 4JQGA 1XFYA 2K2GA 830CA 2JT6A 3O2XA 3TT4A 3DL1A 3KHIA 2OZRA 4GWNA 1KBCA 1OM7A 4H82A 2OVZA 1QJJA 4JP4A 1JAQA 5I12A 3HY9A 4ILWD 3TVCA 1XM5A 2YB9A 4QKZA 1B3DA 1Y93A 4PKTA 3TS4A 1D8FA 1IAGA 1BKCA 2E3XA 1JH1A 2A8HA 1BIWA 2MZHA 1BSWA 1JIZA 1JANA 3DTKA 1OM8A 3O64A 3WV1A 1UEAA 2W15A 1WNIA 1OMJA 2XS3A 1MMRA 3KEJA 3Q2GA 1C7KA 4H76A 4ZR5A 1YP1A 5H8XA 1QUAA 2DDFA 1I1IP 4G9LA 1JAOA 2OY2A 3BA0A 1I76A 1ROSA 1KUKA 1QICA 1ZXCA 2ERPA 4XM7A 3LUNA 1XFUA 1H71P 3WV2A 3DPEA 3MA2A 1UMSA 3L0VA 5D3CA 2L0RA 4IN9A 1BKCE 2WO9A 1YOUA 5L7FA 4I03A 2RJQA 1CIZA 2EROA 1OS9A 1XURA 966CA 3OHOA 4WF6A 1GE6A 3LQ0A 1CGLA 2JSDA 2OW0A 4Q1LA 3HDAP 3LEAA 4WK7A 1CXVA 1DMTA 2X3CA 1GO8P 1PWUA 2OW1A 2MZIA 2K9CA 3P1VA 1AF0A 1CAQA 2RJPA 2TCLA 3RTSA 1CGEA 3N2VA 3EDZA 2D1NA 1GE7A 3F19A 4FXQA 4JPAA 2QPJA 1BUVM 2Z2DA 3CKIA 1FLSA 2OW2A 3LIKA 5I0LA 4GF1A 4FVLA 1MMPA 3F15A 3ZVSA 1ZVXA 1KAPP 1I73A 3I7GA 3HBUP 3KECA 2W12A 2X3BA 1K7GA 3DTEA 1G12A 5D7WA 2N8RA 1JIWP 1ZP5A 1Q3AA 1HV5A 1IABA 2OXZA 1UMTA 3OHLA 5L79A 4L19A 1JK3A 2CLTA 4DF9A 5I4OA 3G42A 1JJ9A 3F16A 3LKAA 3ZXHA 1KUHA 3NX7A 3KEKA 2Y6CA 2PJTA 3N2UA 4DPEA 3K7LA 1KUGA 4A3WA 1SATA 2KRJA 3LIRA 4H49A 1S4BP 2JIHA 3B8ZA 1OZ9A 2AYKA 1IAAA 1BQQM 5D1UA 1G4KA 1EAKA 1DTHA 4PKVA 1CQRA 5JMYA 1CGFA 2JNPA 1D5JA 1UTTA 5CUHA 1EB6A 3E8RA 1TVIA 3K7NA 1YQYA 2DW2A 3DNGA 4PKUA 4L6TA 4WKEA 3AYUA 1L6JA 3KRYA 4IJOA 3LUMA 1SLMA 4IUWA 3LE9A 2J0TA 4H2EA 3RTTA 4FXYP 1XFZA 1XUCA 3F1AA 3HDBA 3HBVP 3Q2HA 3ELMA 2WO8A 2E2DA 2XS4A 1QIAA 1A86A 3I7IA 5BPAA 2W13A 1MMBA 3EHXA 1BUDA 4I35A 2OVXA 1J7NA 3DSLA 3HY7A 4H1QA 3LJTA 4XM6A 1RM8A 2MZEA 3ZUKA 1D7XA 1R1JA 1JKYA 2WOAA 1ZTQA 4DD8A 1YCMA 4XCTA 1HTDA 1QIBA 2YUFA 3LK8A 1ZXVA 4GR0A 1AKLA 2OY4A 4L7AA
chains in the Genus database with same CATH topology
1UTZA 4GR3A 2YIGA 1EUBA 4JA1A 3V96B 3AYKA 1ASTA 1SU3A 1GKDA 1Y8JA 3WV3A 1PWWA 2W14A 2X7MA 1AYKA 2D1OA 2Y6DA 1K7QA 3HYGA 3DWBA 1HY7A 1IACA 1CK7A 1HFSA 5LABA 2JT5A 4JIJA 4H30A 1SLNA 4PKSA 2O36A 4GWMA 2DW0A 3GBOA 3KMCA 3F17A 1BM6A 3HB2P 4ON1A 1PWPA 1OM6A 5B5OA 4J4MA 3LJGA 1XUDA 1HOVA 2O3EA 1XFWA 3EWJA 1USNA 4GR8A 3LQBA 3LJZA 3DTIA 3G5CA 1KUIA 5B5PA 1BKCI 2OXWA 3USNA 1C3IA 1RMZA 2HU6A 1A85A 1MMQA 1GE5A 4XM8A 1R1HA 1GKCA 3LILA 1G49A 3LMCA 2W0DA 3SHIA 3AIGA 3UVCA 5CXAA 4GQLA 3U1RA 3DPFA 2J83A 1ND1A 4DV8A 4R3VA 2POJA 1GXDA 5BOYA 1G05A 2OXUA 4AUOA 1K7IA 1HFCA 1JAPA 1SRPA 4G0DA 1IAEA 5D1SA 1IADA 4A7BA 1QJIA 5D2BA 2OI0A 2X3AA 4EFSA 2USNA 1B8YA 1SMPA 2I47A 3B92A 3KWVC 4PKRA 4H84A 5I3MA 4GUYA 1XFVA 4AYKA 3L0TA 5I2ZA 3VI1A 1Z3JA 4PKWA 2FV5A 2MLRA 5I43A 4WKIA 4AXQA 1PWQA 5CZMA 4L63A 3VTGA 3KMEA 2V4BA 1OO9A 4FU4A 1R54A 4AIGA 2MLSA 456CA 3F18A 1GO7P 3B2ZA 1R55A 1FM1A 4WZVA 2CKIA 2ERQA 3P24A 3TSKA 5D1TA 5BOTA 4HX3A 1BZSA 1MNCA 4XBHA 1PWVA 4H3XA 1O0TA 1FBLA 2OW9A 1ZS0A 2SRTA 4PKQA 1C8TA 1XFXA 1KUFA 3LGPA 2AIGP 1BQOA 4HMAA 1ATLA 1OS2A 3EDIA 1Y0VA 3EDHA 2DDYA 2FV9A 3EDGA 3EHYA 1G9KA 4CTHA 1O0QA 1R1IA 1D8MA 2DW1A 4JQGA 1XFYA 2K2GA 830CA 2JT6A 3O2XA 3TT4A 3DL1A 3KHIA 2OZRA 4GWNA 1KBCA 1OM7A 4H82A 2OVZA 1QJJA 4JP4A 1JAQA 5I12A 3HY9A 4ILWD 3TVCA 2YB9A 4QKZA 1B3DA 1Y93A 4PKTA 3TS4A 1D8FA 1IAGA 1BKCA 2E3XA 1JH1A 2A8HA 1BIWA 2MZHA 1BSWA 1JIZA 1JANA 3DTKA 1OM8A 3O64A 3WV1A 1UEAA 2W15A 1WNIA 1OMJA 2XS3A 1MMRA 3KEJA 3Q2GA 1C7KA 4H76A 4ZR5A 1YP1A 5H8XA 1QUAA 2DDFA 1I1IP 4G9LA 1JAOA 2OY2A 3BA0A 1I76A 1ROSA 1KUKA 1QICA 1ZXCA 2ERPA 4XM7A 3LUNA 1XFUA 1H71P 3WV2A 3DPEA 3MA2A 1UMSA 3L0VA 5D3CA 2L0RA 4IN9A 1BKCE 2WO9A 1YOUA 5L7FA 4I03A 2RJQA 1CIZA 2EROA 1OS9A 1XURA 966CA 3OHOA 4WF6A 1GE6A 3LQ0A 1CGLA 2JSDA 2OW0A 4Q1LA 3HDAP 3LEAA 4WK7A 1CXVA 1DMTA 2X3CA 1GO8P 1PWUA 2OW1A 2MZIA 2K9CA 3P1VA 1AF0A 1CAQA 2RJPA 2TCLA 3RTSA 1CGEA 3N2VA 3EDZA 2D1NA 1GE7A 3F19A 4FXQA 4JPAA 2QPJA 1BUVM 2Z2DA 3CKIA 1FLSA 2OW2A 3LIKA 5I0LA 4GF1A 4FVLA 1MMPA 3F15A 3ZVSA 1ZVXA 1KAPP 1I73A 3I7GA 3HBUP 3KECA 2W12A 2X3BA 1K7GA 3DTEA 1G12A 5D7WA 2N8RA 1JIWP 1ZP5A 1Q3AA 1HV5A 1IABA 2OXZA 1UMTA 3OHLA 5L79A 4L19A 1JK3A 2CLTA 4DF9A 5I4OA 3G42A 1JJ9A 3F16A 3LKAA 3ZXHA 1KUHA 3NX7A 3KEKA 2Y6CA 2PJTA 3N2UA 4DPEA 3K7LA 1KUGA 4A3WA 1SATA 2KRJA 3LIRA 4H49A 1S4BP 2JIHA 3B8ZA 2AYKA 1IAAA 1BQQM 5D1UA 1G4KA 1EAKA 1DTHA 4PKVA 1CQRA 5JMYA 1CGFA 2JNPA 1D5JA 1UTTA 5CUHA 1EB6A 3E8RA 3K7NA 1YQYA 2DW2A 3DNGA 4PKUA 4L6TA 4WKEA 3AYUA 1L6JA 3KRYA 4IJOA 3LUMA 1SLMA 4IUWA 3LE9A 2J0TA 4H2EA 3RTTA 4FXYP 1XFZA 1XUCA 3F1AA 3HDBA 3HBVP 3Q2HA 3ELMA 2WO8A 2E2DA 2XS4A 1QIAA 1A86A 3I7IA 5BPAA 2W13A 1MMBA 3EHXA 1BUDA 4I35A 2OVXA 1J7NA 3DSLA 3HY7A 4H1QA 3LJTA 4XM6A 1RM8A 2MZEA 3ZUKA 1D7XA 1R1JA 1JKYA 2WOAA 1ZTQA 4DD8A 1YCMA 4XCTA 1HTDA 1QIBA 2YUFA 3LK8A 1ZXVA 4GR0A 1AKLA 2OY4A 4L7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTZ A;  4GR3 A;  2YIG A;  1EUB A;  4JA1 A;  3V96 B;  3AYK A;  1AST A;  1SU3 A;  1GKD A;  1Y8J A;  3WV3 A;  1PWW A;  2W14 A;  2X7M A;  1AYK A;  2D1O A;  2Y6D A;  1K7Q A;  3HYG A;  3DWB A;  1HY7 A;  1IAC A;  1CK7 A;  1HFS A;  5LAB A;  2JT5 A;  4JIJ A;  4H30 A;  1SLN A;  4PKS A;  2O36 A;  4GWM A;  2DW0 A;  3GBO A;  3KMC A;  3F17 A;  1BM6 A;  3HB2 P;  4ON1 A;  1PWP A;  1OM6 A;  5B5O A;  4J4M A;  3LJG A;  1XUD A;  1HOV A;  2O3E A;  1XFW A;  3EWJ A;  1USN A;  4GR8 A;  3LQB A;  3LJZ A;  3G5C A;  1KUI A;  5B5P A;  1BKC I;  2OXW A;  3USN A;  1C3I A;  1RMZ A;  2HU6 A;  1A85 A;  1MMQ A;  1GE5 A;  4XM8 A;  1R1H A;  1GKC A;  3LIL A;  1G49 A;  3LMC A;  2W0D A;  3SHI A;  3AIG A;  3UVC A;  5CXA A;  4GQL A;  3U1R A;  3DPF A;  2J83 A;  1ND1 A;  4DV8 A;  4R3V A;  2POJ A;  1GXD A;  5BOY A;  1G05 A;  2OXU A;  4AUO A;  1K7I A;  1HFC A;  1JAP A;  1SRP A;  4G0D A;  1IAE A;  5D1S A;  1IAD A;  4A7B A;  1QJI A;  5D2B A;  2OI0 A;  2X3A A;  4EFS A;  2USN A;  1B8Y A;  1SMP A;  2I47 A;  3B92 A;  3KWV C;  4PKR A;  4H84 A;  5I3M A;  4GUY A;  1XFV A;  4AYK A;  3L0T A;  5I2Z A;  3VI1 A;  1Z3J A;  4PKW A;  2FV5 A;  2MLR A;  5I43 A;  4WKI A;  4AXQ A;  1PWQ A;  5CZM A;  4L63 A;  3VTG A;  3KME A;  2V4B A;  1OO9 A;  4FU4 A;  1R54 A;  4AIG A;  2MLS A;  456C A;  3F18 A;  1GO7 P;  3B2Z A;  1R55 A;  1FM1 A;  4WZV A;  2CKI A;  2ERQ A;  3P24 A;  3TSK A;  5D1T A;  5BOT A;  4HX3 A;  1BZS A;  1MNC A;  4XBH A;  1PWV A;  4H3X A;  1O0T A;  1FBL A;  2OW9 A;  1ZS0 A;  2SRT A;  4PKQ A;  1C8T A;  1XFX A;  1KUF A;  3LGP A;  2AIG P;  1BQO A;  4HMA A;  1ATL A;  1OS2 A;  3EDI A;  1Y0V A;  3EDH A;  2DDY A;  2FV9 A;  3EDG A;  3EHY A;  1G9K A;  4CTH A;  1O0Q A;  1R1I A;  1D8M A;  2DW1 A;  4JQG A;  1XFY A;  2K2G A;  830C A;  2JT6 A;  3O2X A;  3TT4 A;  3DL1 A;  3KHI A;  2OZR A;  4GWN A;  1KBC A;  1OM7 A;  4H82 A;  2OVZ A;  1QJJ A;  4JP4 A;  1JAQ A;  5I12 A;  3HY9 A;  4ILW D;  3TVC A;  2YB9 A;  4QKZ A;  1B3D A;  1Y93 A;  4PKT A;  3TS4 A;  1D8F A;  1IAG A;  1BKC A;  2E3X A;  1JH1 A;  2A8H A;  1BIW A;  2MZH A;  1BSW A;  1JIZ A;  1JAN A;  1OM8 A;  3O64 A;  3WV1 A;  1UEA A;  2W15 A;  1WNI A;  1OMJ A;  2XS3 A;  1MMR A;  3KEJ A;  3Q2G A;  1C7K A;  4H76 A;  4ZR5 A;  1YP1 A;  5H8X A;  1QUA A;  2DDF A;  1I1I P;  4G9L A;  1JAO A;  2OY2 A;  3BA0 A;  1I76 A;  1ROS A;  1KUK A;  1QIC A;  1ZXC A;  2ERP A;  4XM7 A;  3LUN A;  1XFU A;  1H71 P;  3WV2 A;  3DPE A;  3MA2 A;  1UMS A;  3L0V A;  5D3C A;  2L0R A;  4IN9 A;  1BKC E;  2WO9 A;  1YOU A;  5L7F A;  4I03 A;  2RJQ A;  1CIZ A;  2ERO A;  1OS9 A;  1XUR A;  966C A;  3OHO A;  4WF6 A;  1GE6 A;  3LQ0 A;  1CGL A;  2JSD A;  2OW0 A;  4Q1L A;  3HDA P;  3LEA A;  4WK7 A;  1CXV A;  1DMT A;  2X3C A;  1GO8 P;  1PWU A;  2OW1 A;  2MZI A;  2K9C A;  3P1V A;  1AF0 A;  1CAQ A;  2RJP A;  2TCL A;  3RTS A;  1CGE A;  3N2V A;  3EDZ A;  2D1N A;  1GE7 A;  3F19 A;  4FXQ A;  4JPA A;  2QPJ A;  1BUV M;  2Z2D A;  3CKI A;  1FLS A;  2OW2 A;  3LIK A;  5I0L A;  4GF1 A;  4FVL A;  1MMP A;  3F15 A;  3ZVS A;  1ZVX A;  1KAP P;  1I73 A;  3I7G A;  3HBU P;  3KEC A;  2W12 A;  2X3B A;  1K7G A;  1G12 A;  5D7W A;  2N8R A;  1JIW P;  1ZP5 A;  1Q3A A;  1HV5 A;  1IAB A;  2OXZ A;  1UMT A;  3OHL A;  5L79 A;  4L19 A;  1JK3 A;  2CLT A;  4DF9 A;  5I4O A;  3G42 A;  1JJ9 A;  3F16 A;  3LKA A;  3ZXH A;  1KUH A;  3NX7 A;  3KEK A;  2Y6C A;  2PJT A;  3N2U A;  4DPE A;  3K7L A;  1KUG A;  4A3W A;  1SAT A;  2KRJ A;  3LIR A;  4H49 A;  1S4B P;  2JIH A;  3B8Z A;  2AYK A;  1IAA A;  1BQQ M;  5D1U A;  1G4K A;  1EAK A;  1DTH A;  4PKV A;  1CQR A;  5JMY A;  1CGF A;  2JNP A;  1D5J A;  1UTT A;  5CUH A;  1EB6 A;  3E8R A;  3K7N A;  1YQY A;  2DW2 A;  3DNG A;  4PKU A;  4L6T A;  4WKE A;  3AYU A;  1L6J A;  3KRY A;  4IJO A;  3LUM A;  1SLM A;  4IUW A;  3LE9 A;  2J0T A;  4H2E A;  3RTT A;  4FXY P;  1XFZ A;  1XUC A;  3F1A A;  3HDB A;  3HBV P;  3Q2H A;  3ELM A;  2WO8 A;  2E2D A;  2XS4 A;  1QIA A;  1A86 A;  3I7I A;  5BPA A;  2W13 A;  1MMB A;  3EHX A;  1BUD A;  4I35 A;  2OVX A;  1J7N A;  3DSL A;  3HY7 A;  4H1Q A;  3LJT A;  4XM6 A;  1RM8 A;  2MZE A;  3ZUK A;  1D7X A;  1R1J A;  1JKY A;  2WOA A;  1ZTQ A;  4DD8 A;  1YCM A;  4XCT A;  1HTD A;  1QIB A;  3LK8 A;  1ZXV A;  4GR0 A;  1AKL A;  2OY4 A; 
#chains in the Genus database with same CATH topology
 1UTZ A;  4GR3 A;  2YIG A;  1EUB A;  4JA1 A;  3V96 B;  3AYK A;  1AST A;  1SU3 A;  1GKD A;  1Y8J A;  3WV3 A;  1PWW A;  2W14 A;  2X7M A;  1AYK A;  2D1O A;  2Y6D A;  1K7Q A;  3HYG A;  3DWB A;  1HY7 A;  1IAC A;  1CK7 A;  1HFS A;  5LAB A;  2JT5 A;  4JIJ A;  4H30 A;  1SLN A;  4PKS A;  2O36 A;  4GWM A;  2DW0 A;  3GBO A;  3KMC A;  3F17 A;  1BM6 A;  3HB2 P;  4ON1 A;  1PWP A;  1OM6 A;  5B5O A;  4J4M A;  3LJG A;  1XUD A;  1HOV A;  2O3E A;  1XFW A;  3EWJ A;  1USN A;  4GR8 A;  3LQB A;  3LJZ A;  3DTI A;  3G5C A;  1KUI A;  5B5P A;  1BKC I;  2OXW A;  3USN A;  1C3I A;  1RMZ A;  2HU6 A;  1A85 A;  1MMQ A;  1GE5 A;  4XM8 A;  1R1H A;  1GKC A;  3LIL A;  1G49 A;  3LMC A;  2W0D A;  3SHI A;  3AIG A;  3UVC A;  5CXA A;  4GQL A;  3U1R A;  3DPF A;  2J83 A;  1ND1 A;  4DV8 A;  4R3V A;  2POJ A;  1GXD A;  5BOY A;  1G05 A;  2OXU A;  4AUO A;  1XAX A;  1K7I A;  1HFC A;  1JAP A;  1SRP A;  4G0D A;  1IAE A;  5D1S A;  1IAD A;  4A7B A;  1QJI A;  5D2B A;  2OI0 A;  2X3A A;  4EFS A;  2USN A;  1B8Y A;  1SMP A;  2I47 A;  3B92 A;  3KWV C;  4PKR A;  4H84 A;  5I3M A;  4GUY A;  1XFV A;  4AYK A;  3L0T A;  5I2Z A;  3VI1 A;  1Z3J A;  4PKW A;  2FV5 A;  2MLR A;  5I43 A;  4WKI A;  4AXQ A;  1PWQ A;  5CZM A;  4L63 A;  3VTG A;  3KME A;  2V4B A;  1OO9 A;  4FU4 A;  1R54 A;  4AIG A;  2MLS A;  456C A;  3F18 A;  1GO7 P;  3B2Z A;  1R55 A;  1FM1 A;  4WZV A;  2CKI A;  2ERQ A;  3P24 A;  3TSK A;  5D1T A;  5BOT A;  4HX3 A;  1BZS A;  1MNC A;  4XBH A;  1PWV A;  4H3X A;  1O0T A;  1FBL A;  2OW9 A;  1ZS0 A;  2SRT A;  4PKQ A;  1C8T A;  1XFX A;  1KUF A;  3LGP A;  2AIG P;  1BQO A;  4HMA A;  1ATL A;  1OS2 A;  3EDI A;  1Y0V A;  3EDH A;  2DDY A;  2FV9 A;  3EDG A;  3EHY A;  1G9K A;  4CTH A;  1O0Q A;  1R1I A;  1D8M A;  2DW1 A;  4JQG A;  1XFY A;  2K2G A;  830C A;  2JT6 A;  3O2X A;  3TT4 A;  3DL1 A;  3KHI A;  2OZR A;  4GWN A;  1KBC A;  1OM7 A;  4H82 A;  2OVZ A;  1QJJ A;  4JP4 A;  1JAQ A;  5I12 A;  3HY9 A;  4ILW D;  3TVC A;  1XM5 A;  2YB9 A;  4QKZ A;  1B3D A;  1Y93 A;  4PKT A;  3TS4 A;  1D8F A;  1IAG A;  1BKC A;  2E3X A;  1JH1 A;  2A8H A;  1BIW A;  2MZH A;  1BSW A;  1JIZ A;  1JAN A;  3DTK A;  1OM8 A;  3O64 A;  3WV1 A;  1UEA A;  2W15 A;  1WNI A;  1OMJ A;  2XS3 A;  1MMR A;  3KEJ A;  3Q2G A;  1C7K A;  4H76 A;  4ZR5 A;  1YP1 A;  5H8X A;  1QUA A;  2DDF A;  1I1I P;  4G9L A;  1JAO A;  2OY2 A;  3BA0 A;  1I76 A;  1ROS A;  1KUK A;  1QIC A;  1ZXC A;  2ERP A;  4XM7 A;  3LUN A;  1XFU A;  1H71 P;  3WV2 A;  3DPE A;  3MA2 A;  1UMS A;  3L0V A;  5D3C A;  2L0R A;  4IN9 A;  1BKC E;  2WO9 A;  1YOU A;  5L7F A;  4I03 A;  2RJQ A;  1CIZ A;  2ERO A;  1OS9 A;  1XUR A;  966C A;  3OHO A;  4WF6 A;  1GE6 A;  3LQ0 A;  1CGL A;  2JSD A;  2OW0 A;  4Q1L A;  3HDA P;  3LEA A;  4WK7 A;  1CXV A;  1DMT A;  2X3C A;  1GO8 P;  1PWU A;  2OW1 A;  2MZI A;  2K9C A;  3P1V A;  1AF0 A;  1CAQ A;  2RJP A;  2TCL A;  3RTS A;  1CGE A;  3N2V A;  3EDZ A;  2D1N A;  1GE7 A;  3F19 A;  4FXQ A;  4JPA A;  2QPJ A;  1BUV M;  2Z2D A;  3CKI A;  1FLS A;  2OW2 A;  3LIK A;  5I0L A;  4GF1 A;  4FVL A;  1MMP A;  3F15 A;  3ZVS A;  1ZVX A;  1KAP P;  1I73 A;  3I7G A;  3HBU P;  3KEC A;  2W12 A;  2X3B A;  1K7G A;  3DTE A;  1G12 A;  5D7W A;  2N8R A;  1JIW P;  1ZP5 A;  1Q3A A;  1HV5 A;  1IAB A;  2OXZ A;  1UMT A;  3OHL A;  5L79 A;  4L19 A;  1JK3 A;  2CLT A;  4DF9 A;  5I4O A;  3G42 A;  1JJ9 A;  3F16 A;  3LKA A;  3ZXH A;  1KUH A;  3NX7 A;  3KEK A;  2Y6C A;  2PJT A;  3N2U A;  4DPE A;  3K7L A;  1KUG A;  4A3W A;  1SAT A;  2KRJ A;  3LIR A;  4H49 A;  1S4B P;  2JIH A;  3B8Z A;  1OZ9 A;  2AYK A;  1IAA A;  1BQQ M;  5D1U A;  1G4K A;  1EAK A;  1DTH A;  4PKV A;  1CQR A;  5JMY A;  1CGF A;  2JNP A;  1D5J A;  1UTT A;  5CUH A;  1EB6 A;  3E8R A;  1TVI A;  3K7N A;  1YQY A;  2DW2 A;  3DNG A;  4PKU A;  4L6T A;  4WKE A;  3AYU A;  1L6J A;  3KRY A;  4IJO A;  3LUM A;  1SLM A;  4IUW A;  3LE9 A;  2J0T A;  4H2E A;  3RTT A;  4FXY P;  1XFZ A;  1XUC A;  3F1A A;  3HDB A;  3HBV P;  3Q2H A;  3ELM A;  2WO8 A;  2E2D A;  2XS4 A;  1QIA A;  1A86 A;  3I7I A;  5BPA A;  2W13 A;  1MMB A;  3EHX A;  1BUD A;  4I35 A;  2OVX A;  1J7N A;  3DSL A;  3HY7 A;  4H1Q A;  3LJT A;  4XM6 A;  1RM8 A;  2MZE A;  3ZUK A;  1D7X A;  1R1J A;  1JKY A;  2WOA A;  1ZTQ A;  4DD8 A;  1YCM A;  4XCT A;  1HTD A;  1QIB A;  2YUF A;  3LK8 A;  1ZXV A;  4GR0 A;  1AKL A;  2OY4 A;  4L7A A; 
#chains in the Genus database with same CATH homology
 1UTZ A;  4GR3 A;  2YIG A;  1EUB A;  4JA1 A;  3V96 B;  3AYK A;  1AST A;  1SU3 A;  1GKD A;  1Y8J A;  3WV3 A;  1PWW A;  2W14 A;  2X7M A;  1AYK A;  2D1O A;  2Y6D A;  1K7Q A;  3HYG A;  3DWB A;  1HY7 A;  1IAC A;  1CK7 A;  1HFS A;  5LAB A;  2JT5 A;  4JIJ A;  4H30 A;  1SLN A;  4PKS A;  2O36 A;  4GWM A;  2DW0 A;  3GBO A;  3KMC A;  3F17 A;  1BM6 A;  3HB2 P;  4ON1 A;  1PWP A;  1OM6 A;  5B5O A;  4J4M A;  3LJG A;  1XUD A;  1HOV A;  2O3E A;  1XFW A;  3EWJ A;  1USN A;  4GR8 A;  3LQB A;  3LJZ A;  3DTI A;  3G5C A;  1KUI A;  5B5P A;  1BKC I;  2OXW A;  3USN A;  1C3I A;  1RMZ A;  2HU6 A;  1A85 A;  1MMQ A;  1GE5 A;  4XM8 A;  1R1H A;  1GKC A;  3LIL A;  1G49 A;  3LMC A;  2W0D A;  3SHI A;  3AIG A;  3UVC A;  5CXA A;  4GQL A;  3U1R A;  3DPF A;  2J83 A;  1ND1 A;  4DV8 A;  4R3V A;  2POJ A;  1GXD A;  5BOY A;  1G05 A;  2OXU A;  4AUO A;  1K7I A;  1HFC A;  1JAP A;  1SRP A;  4G0D A;  1IAE A;  5D1S A;  1IAD A;  4A7B A;  1QJI A;  5D2B A;  2OI0 A;  2X3A A;  4EFS A;  2USN A;  1B8Y A;  1SMP A;  2I47 A;  3B92 A;  3KWV C;  4PKR A;  4H84 A;  5I3M A;  4GUY A;  1XFV A;  4AYK A;  3L0T A;  5I2Z A;  3VI1 A;  1Z3J A;  4PKW A;  2FV5 A;  2MLR A;  5I43 A;  4WKI A;  4AXQ A;  1PWQ A;  5CZM A;  4L63 A;  3VTG A;  3KME A;  2V4B A;  1OO9 A;  4FU4 A;  1R54 A;  4AIG A;  2MLS A;  456C A;  3F18 A;  1GO7 P;  3B2Z A;  1R55 A;  1FM1 A;  4WZV A;  2CKI A;  2ERQ A;  3P24 A;  3TSK A;  5D1T A;  5BOT A;  4HX3 A;  1BZS A;  1MNC A;  4XBH A;  1PWV A;  4H3X A;  1O0T A;  1FBL A;  2OW9 A;  1ZS0 A;  2SRT A;  4PKQ A;  1C8T A;  1XFX A;  1KUF A;  3LGP A;  2AIG P;  1BQO A;  4HMA A;  1ATL A;  1OS2 A;  3EDI A;  1Y0V A;  3EDH A;  2DDY A;  2FV9 A;  3EDG A;  3EHY A;  1G9K A;  4CTH A;  1O0Q A;  1R1I A;  1D8M A;  2DW1 A;  4JQG A;  1XFY A;  2K2G A;  830C A;  2JT6 A;  3O2X A;  3TT4 A;  3DL1 A;  3KHI A;  2OZR A;  4GWN A;  1KBC A;  1OM7 A;  4H82 A;  2OVZ A;  1QJJ A;  4JP4 A;  1JAQ A;  5I12 A;  3HY9 A;  4ILW D;  3TVC A;  2YB9 A;  4QKZ A;  1B3D A;  1Y93 A;  4PKT A;  3TS4 A;  1D8F A;  1IAG A;  1BKC A;  2E3X A;  1JH1 A;  2A8H A;  1BIW A;  2MZH A;  1BSW A;  1JIZ A;  1JAN A;  3DTK A;  1OM8 A;  3O64 A;  3WV1 A;  1UEA A;  2W15 A;  1WNI A;  1OMJ A;  2XS3 A;  1MMR A;  3KEJ A;  3Q2G A;  1C7K A;  4H76 A;  4ZR5 A;  1YP1 A;  5H8X A;  1QUA A;  2DDF A;  1I1I P;  4G9L A;  1JAO A;  2OY2 A;  3BA0 A;  1I76 A;  1ROS A;  1KUK A;  1QIC A;  1ZXC A;  2ERP A;  4XM7 A;  3LUN A;  1XFU A;  1H71 P;  3WV2 A;  3DPE A;  3MA2 A;  1UMS A;  3L0V A;  5D3C A;  2L0R A;  4IN9 A;  1BKC E;  2WO9 A;  1YOU A;  5L7F A;  4I03 A;  2RJQ A;  1CIZ A;  2ERO A;  1OS9 A;  1XUR A;  966C A;  3OHO A;  4WF6 A;  1GE6 A;  3LQ0 A;  1CGL A;  2JSD A;  2OW0 A;  4Q1L A;  3HDA P;  3LEA A;  4WK7 A;  1CXV A;  1DMT A;  2X3C A;  1GO8 P;  1PWU A;  2OW1 A;  2MZI A;  2K9C A;  3P1V A;  1AF0 A;  1CAQ A;  2RJP A;  2TCL A;  3RTS A;  1CGE A;  3N2V A;  3EDZ A;  2D1N A;  1GE7 A;  3F19 A;  4FXQ A;  4JPA A;  2QPJ A;  1BUV M;  2Z2D A;  3CKI A;  1FLS A;  2OW2 A;  3LIK A;  5I0L A;  4GF1 A;  4FVL A;  1MMP A;  3F15 A;  3ZVS A;  1ZVX A;  1KAP P;  1I73 A;  3I7G A;  3HBU P;  3KEC A;  2W12 A;  2X3B A;  1K7G A;  3DTE A;  1G12 A;  5D7W A;  2N8R A;  1JIW P;  1ZP5 A;  1Q3A A;  1HV5 A;  1IAB A;  2OXZ A;  1UMT A;  3OHL A;  5L79 A;  4L19 A;  1JK3 A;  2CLT A;  4DF9 A;  5I4O A;  3G42 A;  1JJ9 A;  3F16 A;  3LKA A;  3ZXH A;  1KUH A;  3NX7 A;  3KEK A;  2Y6C A;  2PJT A;  3N2U A;  4DPE A;  3K7L A;  1KUG A;  4A3W A;  1SAT A;  2KRJ A;  3LIR A;  4H49 A;  1S4B P;  2JIH A;  3B8Z A;  2AYK A;  1IAA A;  1BQQ M;  5D1U A;  1G4K A;  1EAK A;  1DTH A;  4PKV A;  1CQR A;  5JMY A;  1CGF A;  2JNP A;  1D5J A;  1UTT A;  5CUH A;  1EB6 A;  3E8R A;  3K7N A;  1YQY A;  2DW2 A;  3DNG A;  4PKU A;  4L6T A;  4WKE A;  3AYU A;  1L6J A;  3KRY A;  4IJO A;  3LUM A;  1SLM A;  4IUW A;  3LE9 A;  2J0T A;  4H2E A;  3RTT A;  4FXY P;  1XFZ A;  1XUC A;  3F1A A;  3HDB A;  3HBV P;  3Q2H A;  3ELM A;  2WO8 A;  2E2D A;  2XS4 A;  1QIA A;  1A86 A;  3I7I A;  5BPA A;  2W13 A;  1MMB A;  3EHX A;  1BUD A;  4I35 A;  2OVX A;  1J7N A;  3DSL A;  3HY7 A;  4H1Q A;  3LJT A;  4XM6 A;  1RM8 A;  2MZE A;  3ZUK A;  1D7X A;  1R1J A;  1JKY A;  2WOA A;  1ZTQ A;  4DD8 A;  1YCM A;  4XCT A;  1HTD A;  1QIB A;  2YUF A;  3LK8 A;  1ZXV A;  4GR0 A;  1AKL A;  2OY4 A;  4L7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...