4WZVA

Crystal structure of a hydroxamate based inhibitor en140 in complex with the mmp-9 catalytic domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9,Matrix metalloproteinase-9
publication title N-O-Isopropyl Sulfonamido-Based Hydroxamates as Matrix Metalloproteinase Inhibitors: Hit Selection and in Vivo Antiangiogenic Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4wzvA00
5B5OA 1K7QA 3F15A 2OW9A 3KECA 2MLRA 3LUNA 1HFSA 2POJA 2X7MA 4J4MA 2MZHA 3I7GA 3F19A 1OS9A 1JAPA 3VTGA 1GO8P 3ZVSA 1G49A 1CIZA 1MMPA 1AF0A 4L63A 2CKIA 2D1NA 2KRJA 2X3AA 4DF9A 1GE6A 3LJZA 4H1QA 2J83A 2D1OA 5CXAA 1B3DA 1SATA 1KUIA 1JH1A 1ZTQA 4GR0A 1RMZA 3KWVC 1KAPP 1JJ9A 4PKTA 1USNA 3KRYA 2JIHA 1Y93A 3WV1A 3HB2P 3AIGA 1XFUA 1R1IA 3Q2GA 1ROSA 1BSWA 3F16A 1BUVM 4L19A 1ND1A 2JT6A 5D2BA 2WOAA 1QUAA 1OM8A 2JSDA 4H3XA 4H49A 1OMJA 2USNA 3B8ZA 1L6JA 1UEAA 1ZXCA 5I4OA 2OVZA 1ZP5A 1XFZA 1OM7A 1A86A 2K2GA 1HOVA 5L79A 2MLSA 1MMQA 3EDIA 2YIGA 3LIKA 2OW0A 1GKDA 1UTZA 2ERQA 4FVLA 5D1SA 2DDFA 4FU4A 4GR8A 5I3MA 4A7BA 4H30A 4G0DA 4AIGA 3HBUP 1XUCA 1JANA 1D8FA 2YB9A 3P24A 2OVXA 4AXQA 1QIAA 3V96B 1AKLA 2OY2A 1BQQM 3DL1A 1QJJA 1ZVXA 1MMBA 3BA0A 1GE7A 4XM7A 1G9KA 4AYKA 2L0RA 3HDAP 3EDZA 1D5JA 2W12A 1JK3A 3USNA 1KBCA 2E3XA 2RJQA 3WV3A 3L0TA 4H76A 1D7XA 4WKEA 2K9CA 3N2UA 1MMRA 3NX7A 5BOTA 1GKCA 4XCTA 3LKAA 1HTDA 1AYKA 1QIBA 1RM8A 1XFVA 3O64A 1YP1A 4AUOA 1KUHA 2Y6DA 2DW0A 1H71P 2HU6A 3KMCA 3RTTA 2Z2DA 1XFXA 2MZEA 3EHXA 1JAOA 1GE5A 2AYKA 1SLNA 3OHOA 5D7WA 2XS4A 4GF1A 4H2EA 4PKRA 1JIWP 3LIRA 1A85A 3EHYA 2MZIA 3DPFA 1MNCA 4XM6A 4DD8A 5I43A 1R1HA 1YCMA 1O0TA 1UTTA 3TSKA 4WKIA 1I1IP 1IAGA 1FBLA 3LJTA 4PKWA 3EDHA 3DNGA 1GXDA 1UMTA 3DPEA 2V4BA 1Y0VA 2Y6CA 1ATLA 3U1RA 5H8XA 1PWPA 1R1JA 1DTHA 1OO9A 1BM6A 2OW2A 3HBVP 1K7GA 1C8TA 1G05A 3EDGA 1EUBA 1BZSA 1IABA 1BUDA 4Q1LA 5CZMA 3SHIA 1B8YA 1KUGA 2EROA 2W0DA 3HDBA 2FV9A 2DW1A 3E8RA 3VI1A 5D1TA 3LQBA 2OXZA 2X3CA 1Z3JA 3B2ZA 1EAKA 1K7IA 3LUMA 1CXVA 1FM1A 4XM8A 3GBOA 2X3BA 2ERPA 3AYKA 3KHIA 5LABA 2SRTA 1XFWA 3KMEA 1BKCI 2DW2A 2QPJA 4PKUA 1YQYA 4JPAA 5B5PA 5I0LA 1C7KA 4IN9A 1I76A 2W14A 1D8MA 4H84A 2J0TA 1BIWA 4H82A 4PKVA 4GQLA 456CA 4GUYA 3KEKA 5D1UA 3G42A 3HYGA 3K7LA 1XFYA 3LQ0A 3LJGA 3MA2A 4WZVA 3EWJA 1ZXVA 3F1AA 3AYUA 1IAAA 1CAQA 4ON1A 4XBHA 1FLSA 2N8RA 4WK7A 3LMCA 830CA 2JT5A 1JIZA 2OXWA 1C3IA 1I73A 1BKCA 2JNPA 2OI0A 4QKZA 3N2VA 2AIGP 1HV5A 1IADA 1O0QA 1KUKA 1CQRA 3OHLA 3KEJA 3G5CA 3LE9A 2CLTA 1SLMA 1CK7A 4DPEA 4IUWA 4I35A 3DWBA 2I47A 3I7IA 1CGFA 3ZXHA 3HY9A 2O36A 4GWNA 1Y8JA 4DV8A 5JMYA 1HFCA 1EB6A 3DSLA 2E2DA 3HY7A 1R55A 2OY4A 4PKSA 4G9LA 4ZR5A 2WO8A 4HX3A 2OZRA 1JAQA 4EFSA 5I12A 2A8HA 4A3WA 4R3VA 1PWWA 2OW1A 2FV5A 4JQGA 2O3EA 1S4BP 3F17A 4I03A 4IJOA 1R54A 2OXUA 1GO7P 4CTHA 4FXQA 1PWVA 4PKQA 4GWMA 1YOUA 1ZS0A 3UVCA 4ILWD 1DMTA 3LILA 3Q2HA 2XS3A 4JP4A 1ASTA 1Q3AA 3ELMA 1SRPA 1BQOA 1G12A 2PJTA 3LEAA 5D3CA 3RTSA 2RJPA 2TCLA 1HY7A 3K7NA 1UMSA 2W15A 1BKCE 1JKYA 2W13A 3P1VA 3CKIA 966CA 3LK8A 2DDYA 3F18A 1KUFA 1CGLA 4WF6A 5L7FA 3LGPA 4L6TA 2WO9A 1PWUA 1XURA 1WNIA 1QJIA 5BPAA 4FXYP 1IAEA 3B92A 1OM6A 1PWQA 3TT4A 4JA1A 1SU3A 1SMPA 1XUDA 1QICA 5BOYA 1IACA 3TVCA 3ZUKA 4JIJA 1G4KA 3O2XA 4HMAA 3L0VA 1CGEA 1OS2A 4GR3A 3TS4A 3WV2A 5CUHA 5I2ZA 1J7NA
chains in the Genus database with same CATH superfamily
5B5OA 1K7QA 3F15A 2OW9A 3KECA 2MLRA 3LUNA 1HFSA 2POJA 2X7MA 4J4MA 2MZHA 3I7GA 3F19A 1OS9A 1JAPA 3VTGA 1GO8P 3ZVSA 1G49A 1CIZA 1MMPA 1AF0A 4L63A 2CKIA 2D1NA 2KRJA 2X3AA 4DF9A 1GE6A 3LJZA 4H1QA 2J83A 2D1OA 5CXAA 1B3DA 1SATA 1KUIA 1JH1A 1ZTQA 3DTKA 1RMZA 3KWVC 4GR0A 1KAPP 1JJ9A 4PKTA 1USNA 3KRYA 2JIHA 1Y93A 3WV1A 3HB2P 3AIGA 1XFUA 3DTEA 1R1IA 3Q2GA 1ROSA 1BSWA 3F16A 1BUVM 4L19A 1XAXA 1ND1A 2JT6A 5D2BA 2WOAA 1QUAA 1OM8A 2JSDA 4H3XA 4H49A 1OMJA 2USNA 3B8ZA 1L6JA 1UEAA 1ZXCA 5I4OA 2OVZA 1ZP5A 1XFZA 1OM7A 1A86A 2K2GA 1HOVA 5L79A 1OZ9A 2MLSA 1MMQA 3EDIA 2YIGA 3LIKA 2OW0A 1GKDA 1UTZA 2ERQA 4FVLA 5D1SA 2DDFA 4FU4A 4GR8A 5I3MA 4A7BA 4H30A 4G0DA 4AIGA 3HBUP 1XUCA 1JANA 1D8FA 2YB9A 3P24A 2OVXA 4AXQA 1QIAA 3V96B 1AKLA 2OY2A 1BQQM 3DL1A 1QJJA 1ZVXA 1MMBA 3BA0A 1GE7A 4XM7A 3DTIA 1G9KA 4AYKA 2L0RA 3HDAP 3EDZA 1D5JA 2W12A 1JK3A 3USNA 1KBCA 2E3XA 2RJQA 3WV3A 3L0TA 4H76A 1D7XA 4WKEA 2K9CA 3N2UA 1MMRA 3NX7A 5BOTA 1GKCA 4XCTA 3LKAA 1HTDA 1AYKA 1QIBA 1RM8A 1XFVA 3O64A 1YP1A 4AUOA 1KUHA 2Y6DA 2DW0A 1H71P 2HU6A 3KMCA 3RTTA 2Z2DA 1XFXA 2MZEA 3EHXA 1JAOA 1GE5A 2AYKA 1SLNA 3OHOA 5D7WA 2XS4A 4GF1A 4H2EA 4PKRA 1JIWP 3LIRA 1A85A 3EHYA 2MZIA 3DPFA 1MNCA 4XM6A 4DD8A 5I43A 1R1HA 1YCMA 1O0TA 1UTTA 3TSKA 4WKIA 1I1IP 1IAGA 1FBLA 3LJTA 4PKWA 3EDHA 3DNGA 1GXDA 1UMTA 3DPEA 2V4BA 1Y0VA 2Y6CA 1ATLA 3U1RA 5H8XA 1PWPA 1R1JA 1DTHA 1OO9A 2YUFA 1BM6A 2OW2A 3HBVP 1K7GA 1C8TA 1G05A 3EDGA 1EUBA 1BZSA 1IABA 1BUDA 4Q1LA 5CZMA 3SHIA 1B8YA 1KUGA 2EROA 2W0DA 3HDBA 2FV9A 2DW1A 3E8RA 3VI1A 5D1TA 3LQBA 2OXZA 2X3CA 1Z3JA 3B2ZA 1EAKA 1K7IA 3LUMA 1CXVA 1FM1A 4XM8A 3GBOA 2X3BA 2ERPA 3AYKA 3KHIA 5LABA 2SRTA 1XFWA 3KMEA 1BKCI 2DW2A 2QPJA 4PKUA 1YQYA 4JPAA 5B5PA 5I0LA 1C7KA 4IN9A 1I76A 2W14A 1D8MA 4H84A 2J0TA 1BIWA 4H82A 4PKVA 4GQLA 456CA 4GUYA 3KEKA 5D1UA 3G42A 3HYGA 3K7LA 1XFYA 3LQ0A 3LJGA 3MA2A 4WZVA 3EWJA 1ZXVA 3F1AA 3AYUA 1IAAA 1CAQA 4ON1A 4XBHA 1FLSA 2N8RA 4WK7A 1TVIA 3LMCA 830CA 2JT5A 1JIZA 1XM5A 2OXWA 1C3IA 1I73A 1BKCA 2JNPA 2OI0A 4QKZA 3N2VA 2AIGP 1HV5A 1IADA 1O0QA 1KUKA 1CQRA 3OHLA 3KEJA 3G5CA 3LE9A 2CLTA 1SLMA 1CK7A 4DPEA 4IUWA 4I35A 3DWBA 2I47A 3I7IA 1CGFA 3ZXHA 3HY9A 2O36A 4GWNA 1Y8JA 4DV8A 5JMYA 1HFCA 1EB6A 3DSLA 2E2DA 3HY7A 1R55A 2OY4A 4PKSA 4G9LA 4ZR5A 2WO8A 4HX3A 2OZRA 1JAQA 4EFSA 5I12A 2A8HA 4A3WA 4R3VA 1PWWA 2OW1A 2FV5A 4JQGA 2O3EA 1S4BP 3F17A 4I03A 4IJOA 1R54A 2OXUA 1GO7P 4CTHA 4FXQA 1PWVA 4PKQA 4GWMA 1YOUA 1ZS0A 3UVCA 4ILWD 1DMTA 3LILA 3Q2HA 2XS3A 4JP4A 1ASTA 1Q3AA 3ELMA 1SRPA 1BQOA 1G12A 2PJTA 3LEAA 5D3CA 3RTSA 2RJPA 2TCLA 1HY7A 3K7NA 1UMSA 2W15A 1BKCE 1JKYA 2W13A 3P1VA 3CKIA 966CA 3LK8A 2DDYA 3F18A 4L7AA 1KUFA 1CGLA 4WF6A 5L7FA 3LGPA 4L6TA 2WO9A 1PWUA 1XURA 1WNIA 1QJIA 5BPAA 4FXYP 1IAEA 3B92A 1OM6A 1PWQA 3TT4A 4JA1A 1SU3A 1SMPA 1XUDA 1QICA 5BOYA 1IACA 3TVCA 3ZUKA 4JIJA 1G4KA 3O2XA 4HMAA 3L0VA 1CGEA 1OS2A 4GR3A 3TS4A 3WV2A 5CUHA 5I2ZA 1J7NA
chains in the Genus database with same CATH topology
5B5OA 1K7QA 3F15A 2OW9A 3KECA 2MLRA 3LUNA 1HFSA 2POJA 2X7MA 4J4MA 2MZHA 3I7GA 3F19A 1OS9A 1JAPA 3VTGA 1GO8P 3ZVSA 1G49A 1CIZA 1MMPA 1AF0A 4L63A 2CKIA 2D1NA 2KRJA 2X3AA 4DF9A 1GE6A 3LJZA 4H1QA 2J83A 2D1OA 5CXAA 1B3DA 1SATA 1KUIA 1JH1A 1ZTQA 3DTKA 1RMZA 3KWVC 4GR0A 1KAPP 1JJ9A 4PKTA 1USNA 3KRYA 2JIHA 1Y93A 3WV1A 3HB2P 3AIGA 1XFUA 3DTEA 1R1IA 3Q2GA 1ROSA 1BSWA 3F16A 1BUVM 4L19A 1ND1A 2JT6A 5D2BA 2WOAA 1QUAA 1OM8A 2JSDA 4H3XA 4H49A 1OMJA 2USNA 3B8ZA 1L6JA 1UEAA 1ZXCA 5I4OA 2OVZA 1ZP5A 1XFZA 1OM7A 1A86A 2K2GA 1HOVA 5L79A 2MLSA 1MMQA 3EDIA 2YIGA 3LIKA 2OW0A 1GKDA 1UTZA 2ERQA 4FVLA 5D1SA 2DDFA 4FU4A 4GR8A 5I3MA 4A7BA 4H30A 4G0DA 4AIGA 3HBUP 1XUCA 1JANA 1D8FA 2YB9A 3P24A 2OVXA 4AXQA 1QIAA 3V96B 1AKLA 2OY2A 1BQQM 3DL1A 1QJJA 1ZVXA 1MMBA 3BA0A 1GE7A 4XM7A 3DTIA 1G9KA 4AYKA 2L0RA 3HDAP 3EDZA 1D5JA 2W12A 1JK3A 3USNA 1KBCA 2E3XA 2RJQA 3WV3A 3L0TA 4H76A 1D7XA 4WKEA 2K9CA 3N2UA 1MMRA 3NX7A 5BOTA 1GKCA 4XCTA 3LKAA 1HTDA 1AYKA 1QIBA 1RM8A 1XFVA 3O64A 1YP1A 4AUOA 1KUHA 2Y6DA 2DW0A 1H71P 2HU6A 3KMCA 3RTTA 2Z2DA 1XFXA 2MZEA 3EHXA 1JAOA 1GE5A 2AYKA 1SLNA 3OHOA 5D7WA 2XS4A 4GF1A 4H2EA 4PKRA 1JIWP 3LIRA 1A85A 3EHYA 2MZIA 3DPFA 1MNCA 4XM6A 4DD8A 5I43A 1R1HA 1YCMA 1O0TA 1UTTA 3TSKA 4WKIA 1I1IP 1IAGA 1FBLA 3LJTA 4PKWA 3EDHA 3DNGA 1GXDA 1UMTA 3DPEA 2V4BA 1Y0VA 2Y6CA 1ATLA 3U1RA 5H8XA 1PWPA 1R1JA 1DTHA 1OO9A 2YUFA 1BM6A 2OW2A 3HBVP 1K7GA 1C8TA 1G05A 3EDGA 1EUBA 1BZSA 1IABA 1BUDA 4Q1LA 5CZMA 3SHIA 1B8YA 1KUGA 2EROA 2W0DA 3HDBA 2FV9A 2DW1A 3E8RA 3VI1A 5D1TA 3LQBA 2OXZA 2X3CA 1Z3JA 3B2ZA 1EAKA 1K7IA 3LUMA 1CXVA 1FM1A 4XM8A 3GBOA 2X3BA 2ERPA 3AYKA 3KHIA 5LABA 2SRTA 1XFWA 3KMEA 1BKCI 2DW2A 2QPJA 4PKUA 1YQYA 4JPAA 5B5PA 5I0LA 1C7KA 4IN9A 1I76A 2W14A 1D8MA 4H84A 2J0TA 1BIWA 4H82A 4PKVA 4GQLA 456CA 4GUYA 3KEKA 5D1UA 3G42A 3HYGA 3K7LA 1XFYA 3LQ0A 3LJGA 3MA2A 4WZVA 3EWJA 1ZXVA 3F1AA 3AYUA 1IAAA 1CAQA 4ON1A 4XBHA 1FLSA 2N8RA 4WK7A 3LMCA 830CA 2JT5A 1JIZA 2OXWA 1C3IA 1I73A 1BKCA 2JNPA 2OI0A 4QKZA 3N2VA 2AIGP 1HV5A 1IADA 1O0QA 1KUKA 1CQRA 3OHLA 3KEJA 3G5CA 3LE9A 2CLTA 1SLMA 1CK7A 4DPEA 4IUWA 4I35A 3DWBA 2I47A 3I7IA 1CGFA 3ZXHA 3HY9A 2O36A 4GWNA 1Y8JA 4DV8A 5JMYA 1HFCA 1EB6A 3DSLA 2E2DA 3HY7A 1R55A 2OY4A 4PKSA 4G9LA 4ZR5A 2WO8A 4HX3A 2OZRA 1JAQA 4EFSA 5I12A 2A8HA 4A3WA 4R3VA 1PWWA 2OW1A 2FV5A 4JQGA 2O3EA 1S4BP 3F17A 4I03A 4IJOA 1R54A 2OXUA 1GO7P 4CTHA 4FXQA 1PWVA 4PKQA 4GWMA 1YOUA 1ZS0A 3UVCA 4ILWD 1DMTA 3LILA 3Q2HA 2XS3A 4JP4A 1ASTA 1Q3AA 3ELMA 1SRPA 1BQOA 1G12A 2PJTA 3LEAA 5D3CA 3RTSA 2RJPA 2TCLA 1HY7A 3K7NA 1UMSA 2W15A 1BKCE 1JKYA 2W13A 3P1VA 3CKIA 966CA 3LK8A 2DDYA 3F18A 4L7AA 1KUFA 1CGLA 4WF6A 5L7FA 3LGPA 4L6TA 2WO9A 1PWUA 1XURA 1WNIA 1QJIA 5BPAA 4FXYP 1IAEA 3B92A 1OM6A 1PWQA 3TT4A 4JA1A 1SU3A 1SMPA 1XUDA 1QICA 5BOYA 1IACA 3TVCA 3ZUKA 4JIJA 1G4KA 3O2XA 4HMAA 3L0VA 1CGEA 1OS2A 4GR3A 3TS4A 3WV2A 5CUHA 5I2ZA 1J7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5O A;  1K7Q A;  3F15 A;  2OW9 A;  3KEC A;  2MLR A;  3LUN A;  1HFS A;  2POJ A;  2X7M A;  4J4M A;  2MZH A;  3I7G A;  3F19 A;  1OS9 A;  1JAP A;  3VTG A;  1GO8 P;  3ZVS A;  1G49 A;  1CIZ A;  1MMP A;  1AF0 A;  4L63 A;  2CKI A;  2D1N A;  2KRJ A;  2X3A A;  4DF9 A;  1GE6 A;  3LJZ A;  4H1Q A;  2J83 A;  2D1O A;  5CXA A;  1B3D A;  1SAT A;  1KUI A;  1JH1 A;  1ZTQ A;  4GR0 A;  1RMZ A;  3KWV C;  1KAP P;  1JJ9 A;  4PKT A;  1USN A;  3KRY A;  2JIH A;  1Y93 A;  3WV1 A;  3HB2 P;  3AIG A;  1XFU A;  1R1I A;  3Q2G A;  1ROS A;  1BSW A;  3F16 A;  1BUV M;  4L19 A;  1ND1 A;  2JT6 A;  5D2B A;  2WOA A;  1QUA A;  1OM8 A;  2JSD A;  4H3X A;  4H49 A;  1OMJ A;  2USN A;  3B8Z A;  1L6J A;  1UEA A;  1ZXC A;  5I4O A;  2OVZ A;  1ZP5 A;  1XFZ A;  1OM7 A;  1A86 A;  2K2G A;  1HOV A;  5L79 A;  2MLS A;  1MMQ A;  3EDI A;  2YIG A;  3LIK A;  2OW0 A;  1GKD A;  1UTZ A;  2ERQ A;  4FVL A;  5D1S A;  2DDF A;  4FU4 A;  4GR8 A;  5I3M A;  4A7B A;  4H30 A;  4G0D A;  4AIG A;  3HBU P;  1XUC A;  1JAN A;  1D8F A;  2YB9 A;  3P24 A;  2OVX A;  4AXQ A;  1QIA A;  3V96 B;  1AKL A;  2OY2 A;  1BQQ M;  3DL1 A;  1QJJ A;  1ZVX A;  1MMB A;  3BA0 A;  1GE7 A;  4XM7 A;  1G9K A;  4AYK A;  2L0R A;  3HDA P;  3EDZ A;  1D5J A;  2W12 A;  1JK3 A;  3USN A;  1KBC A;  2E3X A;  2RJQ A;  3WV3 A;  3L0T A;  4H76 A;  1D7X A;  4WKE A;  2K9C A;  3N2U A;  1MMR A;  3NX7 A;  5BOT A;  1GKC A;  4XCT A;  3LKA A;  1HTD A;  1AYK A;  1QIB A;  1RM8 A;  1XFV A;  3O64 A;  1YP1 A;  4AUO A;  1KUH A;  2Y6D A;  2DW0 A;  1H71 P;  2HU6 A;  3KMC A;  3RTT A;  2Z2D A;  1XFX A;  2MZE A;  3EHX A;  1JAO A;  1GE5 A;  2AYK A;  1SLN A;  3OHO A;  5D7W A;  2XS4 A;  4GF1 A;  4H2E A;  4PKR A;  1JIW P;  3LIR A;  1A85 A;  3EHY A;  2MZI A;  3DPF A;  1MNC A;  4XM6 A;  4DD8 A;  5I43 A;  1R1H A;  1YCM A;  1O0T A;  1UTT A;  3TSK A;  4WKI A;  1I1I P;  1IAG A;  1FBL A;  3LJT A;  4PKW A;  3EDH A;  3DNG A;  1GXD A;  1UMT A;  3DPE A;  2V4B A;  1Y0V A;  2Y6C A;  1ATL A;  3U1R A;  5H8X A;  1PWP A;  1R1J A;  1DTH A;  1OO9 A;  1BM6 A;  2OW2 A;  3HBV P;  1K7G A;  1C8T A;  1G05 A;  3EDG A;  1EUB A;  1BZS A;  1IAB A;  1BUD A;  4Q1L A;  5CZM A;  3SHI A;  1B8Y A;  1KUG A;  2ERO A;  2W0D A;  3HDB A;  2FV9 A;  2DW1 A;  3E8R A;  3VI1 A;  5D1T A;  3LQB A;  2OXZ A;  2X3C A;  1Z3J A;  3B2Z A;  1EAK A;  1K7I A;  3LUM A;  1CXV A;  1FM1 A;  4XM8 A;  3GBO A;  2X3B A;  2ERP A;  3AYK A;  3KHI A;  5LAB A;  2SRT A;  1XFW A;  3KME A;  1BKC I;  2DW2 A;  2QPJ A;  4PKU A;  1YQY A;  4JPA A;  5B5P A;  5I0L A;  1C7K A;  4IN9 A;  1I76 A;  2W14 A;  1D8M A;  4H84 A;  2J0T A;  1BIW A;  4H82 A;  4PKV A;  4GQL A;  456C A;  4GUY A;  3KEK A;  5D1U A;  3G42 A;  3HYG A;  3K7L A;  1XFY A;  3LQ0 A;  3LJG A;  3MA2 A;  4WZV A;  3EWJ A;  1ZXV A;  3F1A A;  3AYU A;  1IAA A;  1CAQ A;  4ON1 A;  4XBH A;  1FLS A;  2N8R A;  4WK7 A;  3LMC A;  830C A;  2JT5 A;  1JIZ A;  2OXW A;  1C3I A;  1I73 A;  1BKC A;  2JNP A;  2OI0 A;  4QKZ A;  3N2V A;  2AIG P;  1HV5 A;  1IAD A;  1O0Q A;  1KUK A;  1CQR A;  3OHL A;  3KEJ A;  3G5C A;  3LE9 A;  2CLT A;  1SLM A;  1CK7 A;  4DPE A;  4IUW A;  4I35 A;  3DWB A;  2I47 A;  3I7I A;  1CGF A;  3ZXH A;  3HY9 A;  2O36 A;  4GWN A;  1Y8J A;  4DV8 A;  5JMY A;  1HFC A;  1EB6 A;  3DSL A;  2E2D A;  3HY7 A;  1R55 A;  2OY4 A;  4PKS A;  4G9L A;  4ZR5 A;  2WO8 A;  4HX3 A;  2OZR A;  1JAQ A;  4EFS A;  5I12 A;  2A8H A;  4A3W A;  4R3V A;  1PWW A;  2OW1 A;  2FV5 A;  4JQG A;  2O3E A;  1S4B P;  3F17 A;  4I03 A;  4IJO A;  1R54 A;  2OXU A;  1GO7 P;  4CTH A;  4FXQ A;  1PWV A;  4PKQ A;  4GWM A;  1YOU A;  1ZS0 A;  3UVC A;  4ILW D;  1DMT A;  3LIL A;  3Q2H A;  2XS3 A;  4JP4 A;  1AST A;  1Q3A A;  3ELM A;  1SRP A;  1BQO A;  1G12 A;  2PJT A;  3LEA A;  5D3C A;  3RTS A;  2RJP A;  2TCL A;  1HY7 A;  3K7N A;  1UMS A;  2W15 A;  1BKC E;  1JKY A;  2W13 A;  3P1V A;  3CKI A;  966C A;  3LK8 A;  2DDY A;  3F18 A;  1KUF A;  1CGL A;  4WF6 A;  5L7F A;  3LGP A;  4L6T A;  2WO9 A;  1PWU A;  1XUR A;  1WNI A;  1QJI A;  5BPA A;  4FXY P;  1IAE A;  3B92 A;  1OM6 A;  1PWQ A;  3TT4 A;  4JA1 A;  1SU3 A;  1SMP A;  1XUD A;  1QIC A;  5BOY A;  1IAC A;  3TVC A;  3ZUK A;  4JIJ A;  1G4K A;  3O2X A;  4HMA A;  3L0V A;  1CGE A;  1OS2 A;  4GR3 A;  3TS4 A;  3WV2 A;  5CUH A;  5I2Z A;  1J7N A; 
#chains in the Genus database with same CATH topology
 5B5O A;  1K7Q A;  3F15 A;  2OW9 A;  3KEC A;  2MLR A;  3LUN A;  1HFS A;  2POJ A;  2X7M A;  4J4M A;  2MZH A;  3I7G A;  3F19 A;  1OS9 A;  1JAP A;  3VTG A;  1GO8 P;  3ZVS A;  1G49 A;  1CIZ A;  1MMP A;  1AF0 A;  4L63 A;  2CKI A;  2D1N A;  2KRJ A;  2X3A A;  4DF9 A;  1GE6 A;  3LJZ A;  4H1Q A;  2J83 A;  2D1O A;  5CXA A;  1B3D A;  1SAT A;  1KUI A;  1JH1 A;  1ZTQ A;  3DTK A;  1RMZ A;  3KWV C;  4GR0 A;  1KAP P;  1JJ9 A;  4PKT A;  1USN A;  3KRY A;  2JIH A;  1Y93 A;  3WV1 A;  3HB2 P;  3AIG A;  1XFU A;  3DTE A;  1R1I A;  3Q2G A;  1ROS A;  1BSW A;  3F16 A;  1BUV M;  4L19 A;  1XAX A;  1ND1 A;  2JT6 A;  5D2B A;  2WOA A;  1QUA A;  1OM8 A;  2JSD A;  4H3X A;  4H49 A;  1OMJ A;  2USN A;  3B8Z A;  1L6J A;  1UEA A;  1ZXC A;  5I4O A;  2OVZ A;  1ZP5 A;  1XFZ A;  1OM7 A;  1A86 A;  2K2G A;  1HOV A;  5L79 A;  1OZ9 A;  2MLS A;  1MMQ A;  3EDI A;  2YIG A;  3LIK A;  2OW0 A;  1GKD A;  1UTZ A;  2ERQ A;  4FVL A;  5D1S A;  2DDF A;  4FU4 A;  4GR8 A;  5I3M A;  4A7B A;  4H30 A;  4G0D A;  4AIG A;  3HBU P;  1XUC A;  1JAN A;  1D8F A;  2YB9 A;  3P24 A;  2OVX A;  4AXQ A;  1QIA A;  3V96 B;  1AKL A;  2OY2 A;  1BQQ M;  3DL1 A;  1QJJ A;  1ZVX A;  1MMB A;  3BA0 A;  1GE7 A;  4XM7 A;  3DTI A;  1G9K A;  4AYK A;  2L0R A;  3HDA P;  3EDZ A;  1D5J A;  2W12 A;  1JK3 A;  3USN A;  1KBC A;  2E3X A;  2RJQ A;  3WV3 A;  3L0T A;  4H76 A;  1D7X A;  4WKE A;  2K9C A;  3N2U A;  1MMR A;  3NX7 A;  5BOT A;  1GKC A;  4XCT A;  3LKA A;  1HTD A;  1AYK A;  1QIB A;  1RM8 A;  1XFV A;  3O64 A;  1YP1 A;  4AUO A;  1KUH A;  2Y6D A;  2DW0 A;  1H71 P;  2HU6 A;  3KMC A;  3RTT A;  2Z2D A;  1XFX A;  2MZE A;  3EHX A;  1JAO A;  1GE5 A;  2AYK A;  1SLN A;  3OHO A;  5D7W A;  2XS4 A;  4GF1 A;  4H2E A;  4PKR A;  1JIW P;  3LIR A;  1A85 A;  3EHY A;  2MZI A;  3DPF A;  1MNC A;  4XM6 A;  4DD8 A;  5I43 A;  1R1H A;  1YCM A;  1O0T A;  1UTT A;  3TSK A;  4WKI A;  1I1I P;  1IAG A;  1FBL A;  3LJT A;  4PKW A;  3EDH A;  3DNG A;  1GXD A;  1UMT A;  3DPE A;  2V4B A;  1Y0V A;  2Y6C A;  1ATL A;  3U1R A;  5H8X A;  1PWP A;  1R1J A;  1DTH A;  1OO9 A;  2YUF A;  1BM6 A;  2OW2 A;  3HBV P;  1K7G A;  1C8T A;  1G05 A;  3EDG A;  1EUB A;  1BZS A;  1IAB A;  1BUD A;  4Q1L A;  5CZM A;  3SHI A;  1B8Y A;  1KUG A;  2ERO A;  2W0D A;  3HDB A;  2FV9 A;  2DW1 A;  3E8R A;  3VI1 A;  5D1T A;  3LQB A;  2OXZ A;  2X3C A;  1Z3J A;  3B2Z A;  1EAK A;  1K7I A;  3LUM A;  1CXV A;  1FM1 A;  4XM8 A;  3GBO A;  2X3B A;  2ERP A;  3AYK A;  3KHI A;  5LAB A;  2SRT A;  1XFW A;  3KME A;  1BKC I;  2DW2 A;  2QPJ A;  4PKU A;  1YQY A;  4JPA A;  5B5P A;  5I0L A;  1C7K A;  4IN9 A;  1I76 A;  2W14 A;  1D8M A;  4H84 A;  2J0T A;  1BIW A;  4H82 A;  4PKV A;  4GQL A;  456C A;  4GUY A;  3KEK A;  5D1U A;  3G42 A;  3HYG A;  3K7L A;  1XFY A;  3LQ0 A;  3LJG A;  3MA2 A;  4WZV A;  3EWJ A;  1ZXV A;  3F1A A;  3AYU A;  1IAA A;  1CAQ A;  4ON1 A;  4XBH A;  1FLS A;  2N8R A;  4WK7 A;  1TVI A;  3LMC A;  830C A;  2JT5 A;  1JIZ A;  1XM5 A;  2OXW A;  1C3I A;  1I73 A;  1BKC A;  2JNP A;  2OI0 A;  4QKZ A;  3N2V A;  2AIG P;  1HV5 A;  1IAD A;  1O0Q A;  1KUK A;  1CQR A;  3OHL A;  3KEJ A;  3G5C A;  3LE9 A;  2CLT A;  1SLM A;  1CK7 A;  4DPE A;  4IUW A;  4I35 A;  3DWB A;  2I47 A;  3I7I A;  1CGF A;  3ZXH A;  3HY9 A;  2O36 A;  4GWN A;  1Y8J A;  4DV8 A;  5JMY A;  1HFC A;  1EB6 A;  3DSL A;  2E2D A;  3HY7 A;  1R55 A;  2OY4 A;  4PKS A;  4G9L A;  4ZR5 A;  2WO8 A;  4HX3 A;  2OZR A;  1JAQ A;  4EFS A;  5I12 A;  2A8H A;  4A3W A;  4R3V A;  1PWW A;  2OW1 A;  2FV5 A;  4JQG A;  2O3E A;  1S4B P;  3F17 A;  4I03 A;  4IJO A;  1R54 A;  2OXU A;  1GO7 P;  4CTH A;  4FXQ A;  1PWV A;  4PKQ A;  4GWM A;  1YOU A;  1ZS0 A;  3UVC A;  4ILW D;  1DMT A;  3LIL A;  3Q2H A;  2XS3 A;  4JP4 A;  1AST A;  1Q3A A;  3ELM A;  1SRP A;  1BQO A;  1G12 A;  2PJT A;  3LEA A;  5D3C A;  3RTS A;  2RJP A;  2TCL A;  1HY7 A;  3K7N A;  1UMS A;  2W15 A;  1BKC E;  1JKY A;  2W13 A;  3P1V A;  3CKI A;  966C A;  3LK8 A;  2DDY A;  3F18 A;  4L7A A;  1KUF A;  1CGL A;  4WF6 A;  5L7F A;  3LGP A;  4L6T A;  2WO9 A;  1PWU A;  1XUR A;  1WNI A;  1QJI A;  5BPA A;  4FXY P;  1IAE A;  3B92 A;  1OM6 A;  1PWQ A;  3TT4 A;  4JA1 A;  1SU3 A;  1SMP A;  1XUD A;  1QIC A;  5BOY A;  1IAC A;  3TVC A;  3ZUK A;  4JIJ A;  1G4K A;  3O2X A;  4HMA A;  3L0V A;  1CGE A;  1OS2 A;  4GR3 A;  3TS4 A;  3WV2 A;  5CUH A;  5I2Z A;  1J7N A; 
#chains in the Genus database with same CATH homology
 5B5O A;  1K7Q A;  3F15 A;  2OW9 A;  3KEC A;  2MLR A;  3LUN A;  1HFS A;  2POJ A;  2X7M A;  4J4M A;  2MZH A;  3I7G A;  3F19 A;  1OS9 A;  1JAP A;  3VTG A;  1GO8 P;  3ZVS A;  1G49 A;  1CIZ A;  1MMP A;  1AF0 A;  4L63 A;  2CKI A;  2D1N A;  2KRJ A;  2X3A A;  4DF9 A;  1GE6 A;  3LJZ A;  4H1Q A;  2J83 A;  2D1O A;  5CXA A;  1B3D A;  1SAT A;  1KUI A;  1JH1 A;  1ZTQ A;  3DTK A;  1RMZ A;  3KWV C;  4GR0 A;  1KAP P;  1JJ9 A;  4PKT A;  1USN A;  3KRY A;  2JIH A;  1Y93 A;  3WV1 A;  3HB2 P;  3AIG A;  1XFU A;  3DTE A;  1R1I A;  3Q2G A;  1ROS A;  1BSW A;  3F16 A;  1BUV M;  4L19 A;  1ND1 A;  2JT6 A;  5D2B A;  2WOA A;  1QUA A;  1OM8 A;  2JSD A;  4H3X A;  4H49 A;  1OMJ A;  2USN A;  3B8Z A;  1L6J A;  1UEA A;  1ZXC A;  5I4O A;  2OVZ A;  1ZP5 A;  1XFZ A;  1OM7 A;  1A86 A;  2K2G A;  1HOV A;  5L79 A;  2MLS A;  1MMQ A;  3EDI A;  2YIG A;  3LIK A;  2OW0 A;  1GKD A;  1UTZ A;  2ERQ A;  4FVL A;  5D1S A;  2DDF A;  4FU4 A;  4GR8 A;  5I3M A;  4A7B A;  4H30 A;  4G0D A;  4AIG A;  3HBU P;  1XUC A;  1JAN A;  1D8F A;  2YB9 A;  3P24 A;  2OVX A;  4AXQ A;  1QIA A;  3V96 B;  1AKL A;  2OY2 A;  1BQQ M;  3DL1 A;  1QJJ A;  1ZVX A;  1MMB A;  3BA0 A;  1GE7 A;  4XM7 A;  3DTI A;  1G9K A;  4AYK A;  2L0R A;  3HDA P;  3EDZ A;  1D5J A;  2W12 A;  1JK3 A;  3USN A;  1KBC A;  2E3X A;  2RJQ A;  3WV3 A;  3L0T A;  4H76 A;  1D7X A;  4WKE A;  2K9C A;  3N2U A;  1MMR A;  3NX7 A;  5BOT A;  1GKC A;  4XCT A;  3LKA A;  1HTD A;  1AYK A;  1QIB A;  1RM8 A;  1XFV A;  3O64 A;  1YP1 A;  4AUO A;  1KUH A;  2Y6D A;  2DW0 A;  1H71 P;  2HU6 A;  3KMC A;  3RTT A;  2Z2D A;  1XFX A;  2MZE A;  3EHX A;  1JAO A;  1GE5 A;  2AYK A;  1SLN A;  3OHO A;  5D7W A;  2XS4 A;  4GF1 A;  4H2E A;  4PKR A;  1JIW P;  3LIR A;  1A85 A;  3EHY A;  2MZI A;  3DPF A;  1MNC A;  4XM6 A;  4DD8 A;  5I43 A;  1R1H A;  1YCM A;  1O0T A;  1UTT A;  3TSK A;  4WKI A;  1I1I P;  1IAG A;  1FBL A;  3LJT A;  4PKW A;  3EDH A;  3DNG A;  1GXD A;  1UMT A;  3DPE A;  2V4B A;  1Y0V A;  2Y6C A;  1ATL A;  3U1R A;  5H8X A;  1PWP A;  1R1J A;  1DTH A;  1OO9 A;  2YUF A;  1BM6 A;  2OW2 A;  3HBV P;  1K7G A;  1C8T A;  1G05 A;  3EDG A;  1EUB A;  1BZS A;  1IAB A;  1BUD A;  4Q1L A;  5CZM A;  3SHI A;  1B8Y A;  1KUG A;  2ERO A;  2W0D A;  3HDB A;  2FV9 A;  2DW1 A;  3E8R A;  3VI1 A;  5D1T A;  3LQB A;  2OXZ A;  2X3C A;  1Z3J A;  3B2Z A;  1EAK A;  1K7I A;  3LUM A;  1CXV A;  1FM1 A;  4XM8 A;  3GBO A;  2X3B A;  2ERP A;  3AYK A;  3KHI A;  5LAB A;  2SRT A;  1XFW A;  3KME A;  1BKC I;  2DW2 A;  2QPJ A;  4PKU A;  1YQY A;  4JPA A;  5B5P A;  5I0L A;  1C7K A;  4IN9 A;  1I76 A;  2W14 A;  1D8M A;  4H84 A;  2J0T A;  1BIW A;  4H82 A;  4PKV A;  4GQL A;  456C A;  4GUY A;  3KEK A;  5D1U A;  3G42 A;  3HYG A;  3K7L A;  1XFY A;  3LQ0 A;  3LJG A;  3MA2 A;  4WZV A;  3EWJ A;  1ZXV A;  3F1A A;  3AYU A;  1IAA A;  1CAQ A;  4ON1 A;  4XBH A;  1FLS A;  2N8R A;  4WK7 A;  3LMC A;  830C A;  2JT5 A;  1JIZ A;  2OXW A;  1C3I A;  1I73 A;  1BKC A;  2JNP A;  2OI0 A;  4QKZ A;  3N2V A;  2AIG P;  1HV5 A;  1IAD A;  1O0Q A;  1KUK A;  1CQR A;  3OHL A;  3KEJ A;  3G5C A;  3LE9 A;  2CLT A;  1SLM A;  1CK7 A;  4DPE A;  4IUW A;  4I35 A;  3DWB A;  2I47 A;  3I7I A;  1CGF A;  3ZXH A;  3HY9 A;  2O36 A;  4GWN A;  1Y8J A;  4DV8 A;  5JMY A;  1HFC A;  1EB6 A;  3DSL A;  2E2D A;  3HY7 A;  1R55 A;  2OY4 A;  4PKS A;  4G9L A;  4ZR5 A;  2WO8 A;  4HX3 A;  2OZR A;  1JAQ A;  4EFS A;  5I12 A;  2A8H A;  4A3W A;  4R3V A;  1PWW A;  2OW1 A;  2FV5 A;  4JQG A;  2O3E A;  1S4B P;  3F17 A;  4I03 A;  4IJO A;  1R54 A;  2OXU A;  1GO7 P;  4CTH A;  4FXQ A;  1PWV A;  4PKQ A;  4GWM A;  1YOU A;  1ZS0 A;  3UVC A;  4ILW D;  1DMT A;  3LIL A;  3Q2H A;  2XS3 A;  4JP4 A;  1AST A;  1Q3A A;  3ELM A;  1SRP A;  1BQO A;  1G12 A;  2PJT A;  3LEA A;  5D3C A;  3RTS A;  2RJP A;  2TCL A;  1HY7 A;  3K7N A;  1UMS A;  2W15 A;  1BKC E;  1JKY A;  2W13 A;  3P1V A;  3CKI A;  966C A;  3LK8 A;  2DDY A;  3F18 A;  4L7A A;  1KUF A;  1CGL A;  4WF6 A;  5L7F A;  3LGP A;  4L6T A;  2WO9 A;  1PWU A;  1XUR A;  1WNI A;  1QJI A;  5BPA A;  4FXY P;  1IAE A;  3B92 A;  1OM6 A;  1PWQ A;  3TT4 A;  4JA1 A;  1SU3 A;  1SMP A;  1XUD A;  1QIC A;  5BOY A;  1IAC A;  3TVC A;  3ZUK A;  4JIJ A;  1G4K A;  3O2X A;  4HMA A;  3L0V A;  1CGE A;  1OS2 A;  4GR3 A;  3TS4 A;  3WV2 A;  5CUH A;  5I2Z A;  1J7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...