2OW2A

Mmp-9 active site mutant with difluoro butanoic acid inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagena
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ow2A00
3TSKA 2WO8A 4DD8A 1ZP5A 3L0TA 2E3XA 1KUGA 5I4OA 3EWJA 3B92A 1OM8A 2OW0A 1HFSA 1BUDA 3ZXHA 2AYKA 3OHOA 1CAQA 4HMAA 2Y6DA 3SHIA 3F16A 4H84A 4DF9A 2MZEA 1GXDA 1ZXVA 1A85A 1PWQA 3DPEA 4WF6A 4G9LA 2DW0A 1GO7P 3AYKA 1HV5A 1XFYA 1XFUA 1C8TA 1OS2A 2OXZA 2FV9A 3F19A 4L63A 4ZR5A 1J7NA 4XCTA 4XM6A 4PKQA 3LILA 2USNA 5B5PA 1OM6A 2ERPA 2I47A 1IABA 1CGEA 4GF1A 2V4BA 3Q2GA 3TVCA 2D1NA 3LJTA 3ELMA 2DW1A 1BIWA 3HYGA 4EFSA 3KWVC 1R54A 1JAPA 1QIBA 3LUMA 3F18A 3MA2A 4L19A 1ASTA 1UEAA 4H1QA 2K9CA 2W13A 1QUAA 2YB9A 1BQQM 1BKCE 2OI0A 3B8ZA 4PKRA 3BA0A 966CA 1BKCA 2E2DA 4H76A 1PWUA 1G12A 1FLSA 1XUCA 1MMRA 4JQGA 1CQRA 1DMTA 1R1IA 1XFVA 1USNA 2OY4A 3N2UA 3ZVSA 1CIZA 1OM7A 3EHYA 2ERQA 4DV8A 1SU3A 2MLSA 2WO9A 3TT4A 3N2VA 3KHIA 5B5OA 1FBLA 2CKIA 4JPAA 3HY9A 5D1UA 3NX7A 1OO9A 1GKCA 2TCLA 2L0RA 1YCMA 1C3IA 3DPFA 2OW9A 4GUYA 2EROA 1I73A 1XFZA 4L6TA 4WK7A 3EDIA 1L6JA 4CTHA 5I2ZA 1GE5A 1OMJA 2OVZA 1IAGA 1G49A 3LJGA 3LQ0A 1XFXA 2RJPA 4PKTA 2O3EA 3KMCA 2XS3A 2D1OA 1YP1A 4AYKA 4PKVA 1H71P 1JK3A 1RMZA 2DDFA 5I43A 3KECA 1JIWP 3HDAP 1UMTA 1YOUA 1A86A 2YIGA 1HTDA 2X3BA 3I7IA 4HX3A 3ZUKA 4GWNA 3Q2HA 4H30A 1PWVA 3EDZA 3DSLA 1CGFA 1KUHA 2JT6A 4JIJA 1BSWA 1I1IP 2W12A 1AF0A 2N8RA 2OZRA 1JJ9A 1HY7A 1ZS0A 1SLNA 3U1RA 1R55A 3DNGA 4WZVA 3GBOA 1QICA 1KUFA 1XURA 2OW2A 1O0TA 2OW1A 4IN9A 3AIGA 1SLMA 1UTZA 1HFCA 1UTTA 4GR8A 5I12A 5CZMA 5BPAA 1ZXCA 5I0LA 4IUWA 4ON1A 4GR3A 5D3CA 1D8MA 3UVCA 1ROSA 1JKYA 1RM8A 1IADA 5BOTA 2KRJA 5CUHA 3CKIA 4XM7A 4H2EA 3HDBA 1PWWA 1JAQA 1C7KA 3E8RA 4WKEA 1BQOA 1XFWA 3L0VA 2J0TA 4ILWD 4A7BA 1D5JA 1ATLA 3LGPA 4PKSA 4R3VA 3RTTA 2FV5A 2JIHA 2OVXA 2X3AA 3EDGA 1JANA 1G05A 2JSDA 3KEKA 1QJJA 4I03A 1D8FA 4H49A 3RTSA 4AIGA 2Z2DA 456CA 1R1JA 3LJZA 4FU4A 2PJTA 1SRPA 1EB6A 5D1TA 3HY7A 1CK7A 3HBVP 4FXQA 5CXAA 4FXYP 4GR0A 2HU6A 1AYKA 1QJIA 5L79A 2Y6CA 1KAPP 2OXWA 3LMCA 1Z3JA 3LQBA 2X7MA 4QKZA 3F15A 4I35A 4JA1A 1OS9A 3DL1A 1Y8JA 2WOAA 3P1VA 3G5CA 2DW2A 1JIZA 1G4KA 2W0DA 2OXUA 5D1SA 3AYUA 2W14A 1GKDA 4GQLA 4AXQA 5JMYA 1CXVA 4XM8A 1JAOA 1B8YA 1HOVA 4AUOA 1ZVXA 2AIGP 2JNPA 3WV3A 1Y93A 2J83A 1GE7A 4G0DA 4Q1LA 3G42A 3HB2P 3EHXA 3LIRA 1R1HA 3LK8A 2MZIA 1XUDA 1KUKA 1FM1A 1SATA 3F17A 1G9KA 1ND1A 2MLRA 2POJA 4FVLA 5LABA 1AKLA 3P24A 4H3XA 3I7GA 5H8XA 4J4MA 4XBHA 1UMSA 1S4BP 3OHLA 1PWPA 1IAEA 2JT5A 4WKIA 1Q3AA 1WNIA 1BUVM 1K7QA 2CLTA 1QIAA 2X3CA 3LUNA 3WV1A 1EUBA 1IACA 3B2ZA 3F1AA 1IAAA 5D7WA 1SMPA 3O64A 1ZTQA 2DDYA 3KMEA 3USNA 3DWBA 3K7LA 1BZSA 2QPJA 1BM6A 2O36A 3LE9A 1MMPA 1GE6A 3V96B 3KEJA 1I76A 1K7IA 2A8HA 3KRYA 2MZHA 3K7NA 1MMQA 5L7FA 1KBCA 1CGLA 4IJOA 1KUIA 830CA 1D7XA 3HBUP 2SRTA 3WV2A 1GO8P 1YQYA 3LEAA 5D2BA 1EAKA 1Y0VA 4DPEA 1DTHA 1MMBA 1K7GA 4JP4A 4PKWA 3TS4A 3VTGA 1O0QA 3EDHA 2W15A 3LKAA 2OY2A 1B3DA 4PKUA 3O2XA 2K2GA 1BKCI 3VI1A 3LIKA 2RJQA 1MNCA 1JH1A 5I3MA 2XS4A 4A3WA 4GWMA 5BOYA 4H82A
chains in the Genus database with same CATH superfamily
3TSKA 2WO8A 4DD8A 1ZP5A 3L0TA 2E3XA 1KUGA 5I4OA 3EWJA 3B92A 1OM8A 2OW0A 1HFSA 1BUDA 3ZXHA 2AYKA 3OHOA 1CAQA 4HMAA 2Y6DA 3SHIA 3F16A 4H84A 4DF9A 2MZEA 1GXDA 1ZXVA 1A85A 1PWQA 3DPEA 4WF6A 4G9LA 1XAXA 2DW0A 1GO7P 3AYKA 1HV5A 1XFYA 1XFUA 1C8TA 1OS2A 2OXZA 2FV9A 3F19A 4L63A 4ZR5A 1J7NA 4XCTA 4XM6A 4PKQA 3LILA 2USNA 5B5PA 1OM6A 1OZ9A 2ERPA 2I47A 1IABA 1CGEA 4GF1A 2V4BA 3Q2GA 3TVCA 2D1NA 3LJTA 3DTKA 3ELMA 2DW1A 1BIWA 3HYGA 4EFSA 3KWVC 1R54A 1JAPA 1QIBA 3LUMA 3F18A 3MA2A 4L19A 1ASTA 1UEAA 2YUFA 4H1QA 2K9CA 2W13A 1QUAA 2YB9A 1BQQM 1BKCE 2OI0A 3B8ZA 4PKRA 3BA0A 966CA 1BKCA 2E2DA 4H76A 1PWUA 1G12A 1FLSA 1XUCA 1MMRA 4JQGA 1CQRA 1DMTA 1R1IA 1XFVA 1USNA 2OY4A 3N2UA 3ZVSA 1CIZA 1OM7A 3EHYA 2ERQA 4DV8A 1SU3A 2MLSA 2WO9A 3TT4A 3N2VA 3KHIA 5B5OA 1FBLA 2CKIA 4JPAA 3HY9A 5D1UA 3NX7A 1OO9A 1GKCA 2TCLA 2L0RA 1YCMA 1C3IA 3DPFA 2OW9A 4GUYA 2EROA 1I73A 1XFZA 4L6TA 4WK7A 3EDIA 1L6JA 4CTHA 5I2ZA 1GE5A 1OMJA 2OVZA 1IAGA 1G49A 3LJGA 3LQ0A 1XFXA 2RJPA 4PKTA 2O3EA 3KMCA 2XS3A 2D1OA 1YP1A 4AYKA 4PKVA 1H71P 1JK3A 1RMZA 2DDFA 5I43A 3KECA 1JIWP 3HDAP 1UMTA 1YOUA 1A86A 2YIGA 1HTDA 2X3BA 3I7IA 4HX3A 3ZUKA 4GWNA 3Q2HA 4H30A 1PWVA 3EDZA 3DSLA 1CGFA 1KUHA 2JT6A 4JIJA 1BSWA 1I1IP 2W12A 1AF0A 2N8RA 2OZRA 1JJ9A 1HY7A 1ZS0A 1SLNA 3U1RA 1R55A 3DNGA 4WZVA 3GBOA 1QICA 1KUFA 1XURA 2OW2A 1O0TA 2OW1A 4IN9A 3AIGA 1SLMA 1UTZA 1HFCA 1UTTA 4GR8A 5I12A 5CZMA 5BPAA 1ZXCA 5I0LA 4IUWA 4ON1A 4GR3A 5D3CA 1D8MA 3UVCA 1ROSA 1JKYA 1RM8A 1IADA 5BOTA 2KRJA 5CUHA 3CKIA 4XM7A 4H2EA 3HDBA 1PWWA 1JAQA 1C7KA 3E8RA 4WKEA 1BQOA 1XFWA 3L0VA 2J0TA 4ILWD 4A7BA 1D5JA 1ATLA 3LGPA 4PKSA 4R3VA 3RTTA 2FV5A 2JIHA 2OVXA 2X3AA 3EDGA 1JANA 4L7AA 1G05A 2JSDA 3KEKA 1QJJA 4I03A 1D8FA 4H49A 1XM5A 3RTSA 4AIGA 2Z2DA 456CA 1R1JA 3LJZA 4FU4A 2PJTA 1SRPA 1EB6A 5D1TA 3HY7A 1CK7A 3HBVP 4FXQA 5CXAA 4FXYP 4GR0A 2HU6A 1AYKA 1QJIA 5L79A 2Y6CA 1KAPP 2OXWA 3LMCA 1Z3JA 3LQBA 2X7MA 4QKZA 3F15A 4I35A 4JA1A 1OS9A 3DL1A 1Y8JA 2WOAA 3P1VA 3G5CA 2DW2A 1JIZA 1G4KA 2W0DA 2OXUA 5D1SA 3AYUA 2W14A 1GKDA 4GQLA 4AXQA 5JMYA 1CXVA 4XM8A 1TVIA 1JAOA 1B8YA 1HOVA 4AUOA 1ZVXA 2AIGP 2JNPA 3WV3A 1Y93A 2J83A 1GE7A 4G0DA 4Q1LA 3G42A 3HB2P 3EHXA 3LIRA 1R1HA 3LK8A 2MZIA 1XUDA 1KUKA 1FM1A 1SATA 3F17A 1G9KA 1ND1A 2MLRA 2POJA 4FVLA 5LABA 1AKLA 3P24A 4H3XA 3I7GA 5H8XA 4J4MA 4XBHA 1UMSA 1S4BP 3OHLA 1PWPA 1IAEA 2JT5A 4WKIA 1Q3AA 1WNIA 1BUVM 1K7QA 2CLTA 1QIAA 2X3CA 3LUNA 3WV1A 1EUBA 1IACA 3B2ZA 3F1AA 1IAAA 5D7WA 1SMPA 3O64A 1ZTQA 2DDYA 3KMEA 3USNA 3DWBA 3K7LA 1BZSA 2QPJA 1BM6A 2O36A 3LE9A 1MMPA 1GE6A 3V96B 3KEJA 1I76A 1K7IA 2A8HA 3KRYA 2MZHA 3K7NA 1MMQA 5L7FA 1KBCA 1CGLA 4IJOA 1KUIA 830CA 1D7XA 3HBUP 2SRTA 3WV2A 1GO8P 1YQYA 3LEAA 5D2BA 1EAKA 3DTIA 1Y0VA 4DPEA 1DTHA 1MMBA 1K7GA 4JP4A 4PKWA 3TS4A 3VTGA 1O0QA 3EDHA 3DTEA 2W15A 2OY2A 3LKAA 1B3DA 4PKUA 3O2XA 2K2GA 1BKCI 3VI1A 3LIKA 2RJQA 1MNCA 1JH1A 5I3MA 2XS4A 4A3WA 4GWMA 5BOYA 4H82A
chains in the Genus database with same CATH topology
3TSKA 2WO8A 4DD8A 1ZP5A 3L0TA 2E3XA 1KUGA 5I4OA 3EWJA 3B92A 1OM8A 2OW0A 1HFSA 1BUDA 3ZXHA 2AYKA 3OHOA 1CAQA 4HMAA 2Y6DA 3SHIA 3F16A 4H84A 4DF9A 2MZEA 1GXDA 1ZXVA 1A85A 1PWQA 3DPEA 4WF6A 4G9LA 2DW0A 1GO7P 3AYKA 1HV5A 1XFYA 1XFUA 1C8TA 1OS2A 2OXZA 2FV9A 3F19A 4L63A 4ZR5A 1J7NA 4XCTA 4XM6A 4PKQA 3LILA 2USNA 5B5PA 1OM6A 2ERPA 2I47A 1IABA 1CGEA 4GF1A 2V4BA 3Q2GA 3TVCA 2D1NA 3LJTA 3DTKA 3ELMA 2DW1A 1BIWA 3HYGA 4EFSA 3KWVC 1R54A 1JAPA 1QIBA 3LUMA 3F18A 3MA2A 4L19A 1ASTA 1UEAA 2YUFA 4H1QA 2K9CA 2W13A 1QUAA 2YB9A 1BQQM 1BKCE 2OI0A 3B8ZA 4PKRA 3BA0A 966CA 1BKCA 2E2DA 4H76A 1PWUA 1G12A 1FLSA 1XUCA 1MMRA 4JQGA 1CQRA 1DMTA 1R1IA 1XFVA 1USNA 2OY4A 3N2UA 3ZVSA 1CIZA 1OM7A 3EHYA 2ERQA 4DV8A 1SU3A 2MLSA 2WO9A 3TT4A 3N2VA 3KHIA 5B5OA 1FBLA 2CKIA 4JPAA 3HY9A 5D1UA 3NX7A 1OO9A 1GKCA 2TCLA 2L0RA 1YCMA 1C3IA 3DPFA 2OW9A 4GUYA 2EROA 1I73A 1XFZA 4L6TA 4WK7A 3EDIA 1L6JA 4CTHA 5I2ZA 1GE5A 1OMJA 2OVZA 1IAGA 1G49A 3LJGA 3LQ0A 1XFXA 2RJPA 4PKTA 2O3EA 3KMCA 2XS3A 2D1OA 1YP1A 4AYKA 4PKVA 1H71P 1JK3A 1RMZA 2DDFA 5I43A 3KECA 1JIWP 3HDAP 1UMTA 1YOUA 1A86A 2YIGA 1HTDA 2X3BA 3I7IA 4HX3A 3ZUKA 4GWNA 3Q2HA 4H30A 1PWVA 3EDZA 3DSLA 1CGFA 1KUHA 2JT6A 4JIJA 1BSWA 1I1IP 2W12A 1AF0A 2N8RA 2OZRA 1JJ9A 1HY7A 1ZS0A 1SLNA 3U1RA 1R55A 3DNGA 4WZVA 3GBOA 1QICA 1KUFA 1XURA 2OW2A 1O0TA 2OW1A 4IN9A 3AIGA 1SLMA 1UTZA 1HFCA 1UTTA 4GR8A 5I12A 5CZMA 5BPAA 1ZXCA 5I0LA 4IUWA 4ON1A 4GR3A 5D3CA 1D8MA 3UVCA 1ROSA 1JKYA 1RM8A 1IADA 5BOTA 2KRJA 5CUHA 3CKIA 4XM7A 4H2EA 3HDBA 1PWWA 1JAQA 1C7KA 3E8RA 4WKEA 1BQOA 1XFWA 3L0VA 2J0TA 4ILWD 4A7BA 1D5JA 1ATLA 3LGPA 4PKSA 4R3VA 3RTTA 2FV5A 2JIHA 2OVXA 2X3AA 3EDGA 1JANA 4L7AA 1G05A 2JSDA 3KEKA 1QJJA 4I03A 1D8FA 4H49A 3RTSA 4AIGA 2Z2DA 456CA 1R1JA 3LJZA 4FU4A 2PJTA 1SRPA 1EB6A 5D1TA 3HY7A 1CK7A 3HBVP 4FXQA 5CXAA 4FXYP 4GR0A 2HU6A 1AYKA 1QJIA 5L79A 2Y6CA 1KAPP 2OXWA 3LMCA 1Z3JA 3LQBA 2X7MA 4QKZA 3F15A 4I35A 4JA1A 1OS9A 3DL1A 1Y8JA 2WOAA 3P1VA 3G5CA 2DW2A 1JIZA 1G4KA 2W0DA 2OXUA 5D1SA 3AYUA 2W14A 1GKDA 4GQLA 4AXQA 5JMYA 1CXVA 4XM8A 1JAOA 1B8YA 1HOVA 4AUOA 1ZVXA 2AIGP 2JNPA 3WV3A 1Y93A 2J83A 1GE7A 4G0DA 4Q1LA 3G42A 3HB2P 3EHXA 3LIRA 1R1HA 3LK8A 2MZIA 1XUDA 1KUKA 1FM1A 1SATA 3F17A 1G9KA 1ND1A 2MLRA 2POJA 4FVLA 5LABA 1AKLA 3P24A 4H3XA 3I7GA 5H8XA 4J4MA 4XBHA 1UMSA 1S4BP 3OHLA 1PWPA 1IAEA 2JT5A 4WKIA 1Q3AA 1WNIA 1BUVM 1K7QA 2CLTA 1QIAA 2X3CA 3LUNA 3WV1A 1EUBA 1IACA 3B2ZA 3F1AA 1IAAA 5D7WA 1SMPA 3O64A 1ZTQA 2DDYA 3KMEA 3USNA 3DWBA 3K7LA 1BZSA 2QPJA 1BM6A 2O36A 3LE9A 1MMPA 1GE6A 3V96B 3KEJA 1I76A 1K7IA 2A8HA 3KRYA 2MZHA 3K7NA 1MMQA 5L7FA 1KBCA 1CGLA 4IJOA 1KUIA 830CA 1D7XA 3HBUP 2SRTA 3WV2A 1GO8P 1YQYA 3LEAA 5D2BA 1EAKA 3DTIA 1Y0VA 4DPEA 1DTHA 1MMBA 1K7GA 4JP4A 4PKWA 3TS4A 3VTGA 1O0QA 3EDHA 3DTEA 2W15A 2OY2A 3LKAA 1B3DA 4PKUA 3O2XA 2K2GA 1BKCI 3VI1A 3LIKA 2RJQA 1MNCA 1JH1A 5I3MA 2XS4A 4A3WA 4GWMA 5BOYA 4H82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSK A;  2WO8 A;  4DD8 A;  1ZP5 A;  3L0T A;  2E3X A;  1KUG A;  5I4O A;  3EWJ A;  3B92 A;  1OM8 A;  2OW0 A;  1HFS A;  1BUD A;  3ZXH A;  2AYK A;  3OHO A;  1CAQ A;  4HMA A;  2Y6D A;  3SHI A;  3F16 A;  4H84 A;  4DF9 A;  2MZE A;  1GXD A;  1ZXV A;  1A85 A;  1PWQ A;  3DPE A;  4WF6 A;  4G9L A;  2DW0 A;  1GO7 P;  3AYK A;  1HV5 A;  1XFY A;  1XFU A;  1C8T A;  1OS2 A;  2OXZ A;  2FV9 A;  3F19 A;  4L63 A;  4ZR5 A;  1J7N A;  4XCT A;  4XM6 A;  4PKQ A;  3LIL A;  2USN A;  5B5P A;  1OM6 A;  2ERP A;  2I47 A;  1IAB A;  1CGE A;  4GF1 A;  2V4B A;  3Q2G A;  3TVC A;  2D1N A;  3LJT A;  3ELM A;  2DW1 A;  1BIW A;  3HYG A;  4EFS A;  3KWV C;  1R54 A;  1JAP A;  1QIB A;  3LUM A;  3F18 A;  3MA2 A;  4L19 A;  1AST A;  1UEA A;  4H1Q A;  2K9C A;  2W13 A;  1QUA A;  2YB9 A;  1BQQ M;  1BKC E;  2OI0 A;  3B8Z A;  4PKR A;  3BA0 A;  966C A;  1BKC A;  2E2D A;  4H76 A;  1PWU A;  1G12 A;  1FLS A;  1XUC A;  1MMR A;  4JQG A;  1CQR A;  1DMT A;  1R1I A;  1XFV A;  1USN A;  2OY4 A;  3N2U A;  3ZVS A;  1CIZ A;  1OM7 A;  3EHY A;  2ERQ A;  4DV8 A;  1SU3 A;  2MLS A;  2WO9 A;  3TT4 A;  3N2V A;  3KHI A;  5B5O A;  1FBL A;  2CKI A;  4JPA A;  3HY9 A;  5D1U A;  3NX7 A;  1OO9 A;  1GKC A;  2TCL A;  2L0R A;  1YCM A;  1C3I A;  3DPF A;  2OW9 A;  4GUY A;  2ERO A;  1I73 A;  1XFZ A;  4L6T A;  4WK7 A;  3EDI A;  1L6J A;  4CTH A;  5I2Z A;  1GE5 A;  1OMJ A;  2OVZ A;  1IAG A;  1G49 A;  3LJG A;  3LQ0 A;  1XFX A;  2RJP A;  4PKT A;  2O3E A;  3KMC A;  2XS3 A;  2D1O A;  1YP1 A;  4AYK A;  4PKV A;  1H71 P;  1JK3 A;  1RMZ A;  2DDF A;  5I43 A;  3KEC A;  1JIW P;  3HDA P;  1UMT A;  1YOU A;  1A86 A;  2YIG A;  1HTD A;  2X3B A;  3I7I A;  4HX3 A;  3ZUK A;  4GWN A;  3Q2H A;  4H30 A;  1PWV A;  3EDZ A;  3DSL A;  1CGF A;  1KUH A;  2JT6 A;  4JIJ A;  1BSW A;  1I1I P;  2W12 A;  1AF0 A;  2N8R A;  2OZR A;  1JJ9 A;  1HY7 A;  1ZS0 A;  1SLN A;  3U1R A;  1R55 A;  3DNG A;  4WZV A;  3GBO A;  1QIC A;  1KUF A;  1XUR A;  2OW2 A;  1O0T A;  2OW1 A;  4IN9 A;  3AIG A;  1SLM A;  1UTZ A;  1HFC A;  1UTT A;  4GR8 A;  5I12 A;  5CZM A;  5BPA A;  1ZXC A;  5I0L A;  4IUW A;  4ON1 A;  4GR3 A;  5D3C A;  1D8M A;  3UVC A;  1ROS A;  1JKY A;  1RM8 A;  1IAD A;  5BOT A;  2KRJ A;  5CUH A;  3CKI A;  4XM7 A;  4H2E A;  3HDB A;  1PWW A;  1JAQ A;  1C7K A;  3E8R A;  4WKE A;  1BQO A;  1XFW A;  3L0V A;  2J0T A;  4ILW D;  4A7B A;  1D5J A;  1ATL A;  3LGP A;  4PKS A;  4R3V A;  3RTT A;  2FV5 A;  2JIH A;  2OVX A;  2X3A A;  3EDG A;  1JAN A;  1G05 A;  2JSD A;  3KEK A;  1QJJ A;  4I03 A;  1D8F A;  4H49 A;  3RTS A;  4AIG A;  2Z2D A;  456C A;  1R1J A;  3LJZ A;  4FU4 A;  2PJT A;  1SRP A;  1EB6 A;  5D1T A;  3HY7 A;  1CK7 A;  3HBV P;  4FXQ A;  5CXA A;  4FXY P;  4GR0 A;  2HU6 A;  1AYK A;  1QJI A;  5L79 A;  2Y6C A;  1KAP P;  2OXW A;  3LMC A;  1Z3J A;  3LQB A;  2X7M A;  4QKZ A;  3F15 A;  4I35 A;  4JA1 A;  1OS9 A;  3DL1 A;  1Y8J A;  2WOA A;  3P1V A;  3G5C A;  2DW2 A;  1JIZ A;  1G4K A;  2W0D A;  2OXU A;  5D1S A;  3AYU A;  2W14 A;  1GKD A;  4GQL A;  4AXQ A;  5JMY A;  1CXV A;  4XM8 A;  1JAO A;  1B8Y A;  1HOV A;  4AUO A;  1ZVX A;  2AIG P;  2JNP A;  3WV3 A;  1Y93 A;  2J83 A;  1GE7 A;  4G0D A;  4Q1L A;  3G42 A;  3HB2 P;  3EHX A;  3LIR A;  1R1H A;  3LK8 A;  2MZI A;  1XUD A;  1KUK A;  1FM1 A;  1SAT A;  3F17 A;  1G9K A;  1ND1 A;  2MLR A;  2POJ A;  4FVL A;  5LAB A;  1AKL A;  3P24 A;  4H3X A;  3I7G A;  5H8X A;  4J4M A;  4XBH A;  1UMS A;  1S4B P;  3OHL A;  1PWP A;  1IAE A;  2JT5 A;  4WKI A;  1Q3A A;  1WNI A;  1BUV M;  1K7Q A;  2CLT A;  1QIA A;  2X3C A;  3LUN A;  3WV1 A;  1EUB A;  1IAC A;  3B2Z A;  3F1A A;  1IAA A;  5D7W A;  1SMP A;  3O64 A;  1ZTQ A;  2DDY A;  3KME A;  3USN A;  3DWB A;  3K7L A;  1BZS A;  2QPJ A;  1BM6 A;  2O36 A;  3LE9 A;  1MMP A;  1GE6 A;  3V96 B;  3KEJ A;  1I76 A;  1K7I A;  2A8H A;  3KRY A;  2MZH A;  3K7N A;  1MMQ A;  5L7F A;  1KBC A;  1CGL A;  4IJO A;  1KUI A;  830C A;  1D7X A;  3HBU P;  2SRT A;  3WV2 A;  1GO8 P;  1YQY A;  3LEA A;  5D2B A;  1EAK A;  1Y0V A;  4DPE A;  1DTH A;  1MMB A;  1K7G A;  4JP4 A;  4PKW A;  3TS4 A;  3VTG A;  1O0Q A;  3EDH A;  2W15 A;  3LKA A;  2OY2 A;  1B3D A;  4PKU A;  3O2X A;  2K2G A;  1BKC I;  3VI1 A;  3LIK A;  2RJQ A;  1MNC A;  1JH1 A;  5I3M A;  2XS4 A;  4A3W A;  4GWM A;  5BOY A;  4H82 A; 
#chains in the Genus database with same CATH topology
 3TSK A;  2WO8 A;  4DD8 A;  1ZP5 A;  3L0T A;  2E3X A;  1KUG A;  5I4O A;  3EWJ A;  3B92 A;  1OM8 A;  2OW0 A;  1HFS A;  1BUD A;  3ZXH A;  2AYK A;  3OHO A;  1CAQ A;  4HMA A;  2Y6D A;  3SHI A;  3F16 A;  4H84 A;  4DF9 A;  2MZE A;  1GXD A;  1ZXV A;  1A85 A;  1PWQ A;  3DPE A;  4WF6 A;  4G9L A;  1XAX A;  2DW0 A;  1GO7 P;  3AYK A;  1HV5 A;  1XFY A;  1XFU A;  1C8T A;  1OS2 A;  2OXZ A;  2FV9 A;  3F19 A;  4L63 A;  4ZR5 A;  1J7N A;  4XCT A;  4XM6 A;  4PKQ A;  3LIL A;  2USN A;  5B5P A;  1OM6 A;  1OZ9 A;  2ERP A;  2I47 A;  1IAB A;  1CGE A;  4GF1 A;  2V4B A;  3Q2G A;  3TVC A;  2D1N A;  3LJT A;  3DTK A;  3ELM A;  2DW1 A;  1BIW A;  3HYG A;  4EFS A;  3KWV C;  1R54 A;  1JAP A;  1QIB A;  3LUM A;  3F18 A;  3MA2 A;  4L19 A;  1AST A;  1UEA A;  2YUF A;  4H1Q A;  2K9C A;  2W13 A;  1QUA A;  2YB9 A;  1BQQ M;  1BKC E;  2OI0 A;  3B8Z A;  4PKR A;  3BA0 A;  966C A;  1BKC A;  2E2D A;  4H76 A;  1PWU A;  1G12 A;  1FLS A;  1XUC A;  1MMR A;  4JQG A;  1CQR A;  1DMT A;  1R1I A;  1XFV A;  1USN A;  2OY4 A;  3N2U A;  3ZVS A;  1CIZ A;  1OM7 A;  3EHY A;  2ERQ A;  4DV8 A;  1SU3 A;  2MLS A;  2WO9 A;  3TT4 A;  3N2V A;  3KHI A;  5B5O A;  1FBL A;  2CKI A;  4JPA A;  3HY9 A;  5D1U A;  3NX7 A;  1OO9 A;  1GKC A;  2TCL A;  2L0R A;  1YCM A;  1C3I A;  3DPF A;  2OW9 A;  4GUY A;  2ERO A;  1I73 A;  1XFZ A;  4L6T A;  4WK7 A;  3EDI A;  1L6J A;  4CTH A;  5I2Z A;  1GE5 A;  1OMJ A;  2OVZ A;  1IAG A;  1G49 A;  3LJG A;  3LQ0 A;  1XFX A;  2RJP A;  4PKT A;  2O3E A;  3KMC A;  2XS3 A;  2D1O A;  1YP1 A;  4AYK A;  4PKV A;  1H71 P;  1JK3 A;  1RMZ A;  2DDF A;  5I43 A;  3KEC A;  1JIW P;  3HDA P;  1UMT A;  1YOU A;  1A86 A;  2YIG A;  1HTD A;  2X3B A;  3I7I A;  4HX3 A;  3ZUK A;  4GWN A;  3Q2H A;  4H30 A;  1PWV A;  3EDZ A;  3DSL A;  1CGF A;  1KUH A;  2JT6 A;  4JIJ A;  1BSW A;  1I1I P;  2W12 A;  1AF0 A;  2N8R A;  2OZR A;  1JJ9 A;  1HY7 A;  1ZS0 A;  1SLN A;  3U1R A;  1R55 A;  3DNG A;  4WZV A;  3GBO A;  1QIC A;  1KUF A;  1XUR A;  2OW2 A;  1O0T A;  2OW1 A;  4IN9 A;  3AIG A;  1SLM A;  1UTZ A;  1HFC A;  1UTT A;  4GR8 A;  5I12 A;  5CZM A;  5BPA A;  1ZXC A;  5I0L A;  4IUW A;  4ON1 A;  4GR3 A;  5D3C A;  1D8M A;  3UVC A;  1ROS A;  1JKY A;  1RM8 A;  1IAD A;  5BOT A;  2KRJ A;  5CUH A;  3CKI A;  4XM7 A;  4H2E A;  3HDB A;  1PWW A;  1JAQ A;  1C7K A;  3E8R A;  4WKE A;  1BQO A;  1XFW A;  3L0V A;  2J0T A;  4ILW D;  4A7B A;  1D5J A;  1ATL A;  3LGP A;  4PKS A;  4R3V A;  3RTT A;  2FV5 A;  2JIH A;  2OVX A;  2X3A A;  3EDG A;  1JAN A;  4L7A A;  1G05 A;  2JSD A;  3KEK A;  1QJJ A;  4I03 A;  1D8F A;  4H49 A;  1XM5 A;  3RTS A;  4AIG A;  2Z2D A;  456C A;  1R1J A;  3LJZ A;  4FU4 A;  2PJT A;  1SRP A;  1EB6 A;  5D1T A;  3HY7 A;  1CK7 A;  3HBV P;  4FXQ A;  5CXA A;  4FXY P;  4GR0 A;  2HU6 A;  1AYK A;  1QJI A;  5L79 A;  2Y6C A;  1KAP P;  2OXW A;  3LMC A;  1Z3J A;  3LQB A;  2X7M A;  4QKZ A;  3F15 A;  4I35 A;  4JA1 A;  1OS9 A;  3DL1 A;  1Y8J A;  2WOA A;  3P1V A;  3G5C A;  2DW2 A;  1JIZ A;  1G4K A;  2W0D A;  2OXU A;  5D1S A;  3AYU A;  2W14 A;  1GKD A;  4GQL A;  4AXQ A;  5JMY A;  1CXV A;  4XM8 A;  1TVI A;  1JAO A;  1B8Y A;  1HOV A;  4AUO A;  1ZVX A;  2AIG P;  2JNP A;  3WV3 A;  1Y93 A;  2J83 A;  1GE7 A;  4G0D A;  4Q1L A;  3G42 A;  3HB2 P;  3EHX A;  3LIR A;  1R1H A;  3LK8 A;  2MZI A;  1XUD A;  1KUK A;  1FM1 A;  1SAT A;  3F17 A;  1G9K A;  1ND1 A;  2MLR A;  2POJ A;  4FVL A;  5LAB A;  1AKL A;  3P24 A;  4H3X A;  3I7G A;  5H8X A;  4J4M A;  4XBH A;  1UMS A;  1S4B P;  3OHL A;  1PWP A;  1IAE A;  2JT5 A;  4WKI A;  1Q3A A;  1WNI A;  1BUV M;  1K7Q A;  2CLT A;  1QIA A;  2X3C A;  3LUN A;  3WV1 A;  1EUB A;  1IAC A;  3B2Z A;  3F1A A;  1IAA A;  5D7W A;  1SMP A;  3O64 A;  1ZTQ A;  2DDY A;  3KME A;  3USN A;  3DWB A;  3K7L A;  1BZS A;  2QPJ A;  1BM6 A;  2O36 A;  3LE9 A;  1MMP A;  1GE6 A;  3V96 B;  3KEJ A;  1I76 A;  1K7I A;  2A8H A;  3KRY A;  2MZH A;  3K7N A;  1MMQ A;  5L7F A;  1KBC A;  1CGL A;  4IJO A;  1KUI A;  830C A;  1D7X A;  3HBU P;  2SRT A;  3WV2 A;  1GO8 P;  1YQY A;  3LEA A;  5D2B A;  1EAK A;  3DTI A;  1Y0V A;  4DPE A;  1DTH A;  1MMB A;  1K7G A;  4JP4 A;  4PKW A;  3TS4 A;  3VTG A;  1O0Q A;  3EDH A;  3DTE A;  2W15 A;  2OY2 A;  3LKA A;  1B3D A;  4PKU A;  3O2X A;  2K2G A;  1BKC I;  3VI1 A;  3LIK A;  2RJQ A;  1MNC A;  1JH1 A;  5I3M A;  2XS4 A;  4A3W A;  4GWM A;  5BOY A;  4H82 A; 
#chains in the Genus database with same CATH homology
 3TSK A;  2WO8 A;  4DD8 A;  1ZP5 A;  3L0T A;  2E3X A;  1KUG A;  5I4O A;  3EWJ A;  3B92 A;  1OM8 A;  2OW0 A;  1HFS A;  1BUD A;  3ZXH A;  2AYK A;  3OHO A;  1CAQ A;  4HMA A;  2Y6D A;  3SHI A;  3F16 A;  4H84 A;  4DF9 A;  2MZE A;  1GXD A;  1ZXV A;  1A85 A;  1PWQ A;  3DPE A;  4WF6 A;  4G9L A;  2DW0 A;  1GO7 P;  3AYK A;  1HV5 A;  1XFY A;  1XFU A;  1C8T A;  1OS2 A;  2OXZ A;  2FV9 A;  3F19 A;  4L63 A;  4ZR5 A;  1J7N A;  4XCT A;  4XM6 A;  4PKQ A;  3LIL A;  2USN A;  5B5P A;  1OM6 A;  2ERP A;  2I47 A;  1IAB A;  1CGE A;  4GF1 A;  2V4B A;  3Q2G A;  3TVC A;  2D1N A;  3LJT A;  3DTK A;  3ELM A;  2DW1 A;  1BIW A;  3HYG A;  4EFS A;  3KWV C;  1R54 A;  1JAP A;  1QIB A;  3LUM A;  3F18 A;  3MA2 A;  4L19 A;  1AST A;  1UEA A;  2YUF A;  4H1Q A;  2K9C A;  2W13 A;  1QUA A;  2YB9 A;  1BQQ M;  1BKC E;  2OI0 A;  3B8Z A;  4PKR A;  3BA0 A;  966C A;  1BKC A;  2E2D A;  4H76 A;  1PWU A;  1G12 A;  1FLS A;  1XUC A;  1MMR A;  4JQG A;  1CQR A;  1DMT A;  1R1I A;  1XFV A;  1USN A;  2OY4 A;  3N2U A;  3ZVS A;  1CIZ A;  1OM7 A;  3EHY A;  2ERQ A;  4DV8 A;  1SU3 A;  2MLS A;  2WO9 A;  3TT4 A;  3N2V A;  3KHI A;  5B5O A;  1FBL A;  2CKI A;  4JPA A;  3HY9 A;  5D1U A;  3NX7 A;  1OO9 A;  1GKC A;  2TCL A;  2L0R A;  1YCM A;  1C3I A;  3DPF A;  2OW9 A;  4GUY A;  2ERO A;  1I73 A;  1XFZ A;  4L6T A;  4WK7 A;  3EDI A;  1L6J A;  4CTH A;  5I2Z A;  1GE5 A;  1OMJ A;  2OVZ A;  1IAG A;  1G49 A;  3LJG A;  3LQ0 A;  1XFX A;  2RJP A;  4PKT A;  2O3E A;  3KMC A;  2XS3 A;  2D1O A;  1YP1 A;  4AYK A;  4PKV A;  1H71 P;  1JK3 A;  1RMZ A;  2DDF A;  5I43 A;  3KEC A;  1JIW P;  3HDA P;  1UMT A;  1YOU A;  1A86 A;  2YIG A;  1HTD A;  2X3B A;  3I7I A;  4HX3 A;  3ZUK A;  4GWN A;  3Q2H A;  4H30 A;  1PWV A;  3EDZ A;  3DSL A;  1CGF A;  1KUH A;  2JT6 A;  4JIJ A;  1BSW A;  1I1I P;  2W12 A;  1AF0 A;  2N8R A;  2OZR A;  1JJ9 A;  1HY7 A;  1ZS0 A;  1SLN A;  3U1R A;  1R55 A;  3DNG A;  4WZV A;  3GBO A;  1QIC A;  1KUF A;  1XUR A;  2OW2 A;  1O0T A;  2OW1 A;  4IN9 A;  3AIG A;  1SLM A;  1UTZ A;  1HFC A;  1UTT A;  4GR8 A;  5I12 A;  5CZM A;  5BPA A;  1ZXC A;  5I0L A;  4IUW A;  4ON1 A;  4GR3 A;  5D3C A;  1D8M A;  3UVC A;  1ROS A;  1JKY A;  1RM8 A;  1IAD A;  5BOT A;  2KRJ A;  5CUH A;  3CKI A;  4XM7 A;  4H2E A;  3HDB A;  1PWW A;  1JAQ A;  1C7K A;  3E8R A;  4WKE A;  1BQO A;  1XFW A;  3L0V A;  2J0T A;  4ILW D;  4A7B A;  1D5J A;  1ATL A;  3LGP A;  4PKS A;  4R3V A;  3RTT A;  2FV5 A;  2JIH A;  2OVX A;  2X3A A;  3EDG A;  1JAN A;  4L7A A;  1G05 A;  2JSD A;  3KEK A;  1QJJ A;  4I03 A;  1D8F A;  4H49 A;  3RTS A;  4AIG A;  2Z2D A;  456C A;  1R1J A;  3LJZ A;  4FU4 A;  2PJT A;  1SRP A;  1EB6 A;  5D1T A;  3HY7 A;  1CK7 A;  3HBV P;  4FXQ A;  5CXA A;  4FXY P;  4GR0 A;  2HU6 A;  1AYK A;  1QJI A;  5L79 A;  2Y6C A;  1KAP P;  2OXW A;  3LMC A;  1Z3J A;  3LQB A;  2X7M A;  4QKZ A;  3F15 A;  4I35 A;  4JA1 A;  1OS9 A;  3DL1 A;  1Y8J A;  2WOA A;  3P1V A;  3G5C A;  2DW2 A;  1JIZ A;  1G4K A;  2W0D A;  2OXU A;  5D1S A;  3AYU A;  2W14 A;  1GKD A;  4GQL A;  4AXQ A;  5JMY A;  1CXV A;  4XM8 A;  1JAO A;  1B8Y A;  1HOV A;  4AUO A;  1ZVX A;  2AIG P;  2JNP A;  3WV3 A;  1Y93 A;  2J83 A;  1GE7 A;  4G0D A;  4Q1L A;  3G42 A;  3HB2 P;  3EHX A;  3LIR A;  1R1H A;  3LK8 A;  2MZI A;  1XUD A;  1KUK A;  1FM1 A;  1SAT A;  3F17 A;  1G9K A;  1ND1 A;  2MLR A;  2POJ A;  4FVL A;  5LAB A;  1AKL A;  3P24 A;  4H3X A;  3I7G A;  5H8X A;  4J4M A;  4XBH A;  1UMS A;  1S4B P;  3OHL A;  1PWP A;  1IAE A;  2JT5 A;  4WKI A;  1Q3A A;  1WNI A;  1BUV M;  1K7Q A;  2CLT A;  1QIA A;  2X3C A;  3LUN A;  3WV1 A;  1EUB A;  1IAC A;  3B2Z A;  3F1A A;  1IAA A;  5D7W A;  1SMP A;  3O64 A;  1ZTQ A;  2DDY A;  3KME A;  3USN A;  3DWB A;  3K7L A;  1BZS A;  2QPJ A;  1BM6 A;  2O36 A;  3LE9 A;  1MMP A;  1GE6 A;  3V96 B;  3KEJ A;  1I76 A;  1K7I A;  2A8H A;  3KRY A;  2MZH A;  3K7N A;  1MMQ A;  5L7F A;  1KBC A;  1CGL A;  4IJO A;  1KUI A;  830C A;  1D7X A;  3HBU P;  2SRT A;  3WV2 A;  1GO8 P;  1YQY A;  3LEA A;  5D2B A;  1EAK A;  3DTI A;  1Y0V A;  4DPE A;  1DTH A;  1MMB A;  1K7G A;  4JP4 A;  4PKW A;  3TS4 A;  3VTG A;  1O0Q A;  3EDH A;  3DTE A;  2W15 A;  2OY2 A;  3LKA A;  1B3D A;  4PKU A;  3O2X A;  2K2G A;  1BKC I;  3VI1 A;  3LIK A;  2RJQ A;  1MNC A;  1JH1 A;  5I3M A;  2XS4 A;  4A3W A;  4GWM A;  5BOY A;  4H82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...