2MZHA

Nmr solution structure of the pro form of human matrilysin (prommp-7) in complex with zwitterionic membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
248
structure length
248
Chain Sequence
LPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrilysin
publication title Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 248
sequence length 248
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2mzhA00
4DPEA 3HY9A 3CKIA 1OMJA 3TVCA 1SU3A 2OI0A 1YCMA 3LUNA 1JIWP 2DDYA 3WV3A 4GUYA 5BOYA 1KUGA 3DWBA 1AKLA 2E3XA 1PWQA 4FXYP 2WOAA 1CGEA 1Y0VA 5LABA 4AUOA 1ZP5A 1FLSA 4XM7A 4JP4A 4PKVA 1BKCA 1OO9A 2MLRA 2OW0A 1QIAA 3U1RA 5BPAA 2V4BA 4ZR5A 3Q2HA 1HFCA 1OS9A 1ZXCA 3BA0A 1PWUA 2W15A 1I73A 1K7QA 5I0LA 1IADA 3VI1A 1K7GA 4L19A 4ILWD 2W14A 3G42A 1C7KA 1XFYA 5CXAA 2JIHA 2JT6A 1MMPA 2Y6DA 3LIRA 3KECA 1JH1A 2TCLA 1GKCA 1HFSA 2MZEA 3KEKA 1BUDA 2DDFA 4IJOA 1C3IA 4PKRA 3O64A 4H1QA 1KAPP 2K2GA 1C8TA 1CAQA 4FVLA 2PJTA 1MMQA 4FXQA 3NX7A 2N8RA 1GO7P 1SLMA 1IAGA 2MZHA 3EDZA 1BIWA 1A85A 2ERPA 1BM6A 2OVZA 2W0DA 2KRJA 1CQRA 2DW1A 4I03A 1XFWA 966CA 3EHXA 4CTHA 3HY7A 4GR3A 2DW0A 3I7GA 1G4KA 2WO9A 3DL1A 4PKTA 1R1JA 5D1TA 3P24A 2D1OA 3N2UA 2E2DA 4GWMA 4J4MA 4H84A 5B5PA 5D2BA 2USNA 2XS3A 1ATLA 3HYGA 1HOVA 2XS4A 2X7MA 1UTTA 1Z3JA 1DTHA 1S4BP 1Y8JA 1XUCA 2AIGP 2EROA 1DMTA 2I47A 1ZTQA 1KUHA 1OM6A 3P1VA 1PWVA 4IN9A 4JIJA 1JAPA 3DSLA 3F18A 2OZRA 4XM6A 2YB9A 2OW9A 3LILA 3AYUA 3F16A 5I12A 3DPEA 2Z2DA 2W13A 1Q3AA 2OY2A 1ASTA 2HU6A 1O0QA 3ELMA 1ZS0A 3USNA 2OW2A 1BSWA 1PWPA 2X3CA 1BUVM 1EB6A 1GKDA 1JAOA 3LKAA 3LGPA 4WKIA 2FV5A 2MZIA 3EWJA 3TS4A 4JPAA 3O2XA 3K7LA 1KUIA 3KEJA 1MNCA 2CLTA 4PKUA 1D8FA 1GXDA 2AYKA 5BOTA 1QUAA 1JJ9A 4G9LA 3LMCA 1IACA 5I2ZA 1OM7A 3LUMA 2OY4A 5JMYA 4WF6A 3HBUP 2L0RA 3B2ZA 1JANA 1ROSA 1R1IA 3HDAP 1G05A 2J0TA 4GWNA 1YP1A 2JSDA 3EHYA 1QIBA 4WK7A 3OHLA 3LEAA 1SLNA 1BKCE 1KUKA 4GQLA 1BQOA 2SRTA 3OHOA 3LIKA 2YIGA 3LE9A 3HB2P 2O3EA 3LQBA 4A7BA 3EDGA 1IABA 1ZXVA 3AIGA 4QKZA 5CZMA 3MA2A 4ON1A 4WZVA 4DV8A 4H49A 3Q2GA 4GR8A 4PKSA 1K7IA 3LJZA 5CUHA 1YOUA 3LJTA 5I3MA 1Y93A 4H2EA 4GF1A 1YQYA 3LQ0A 1RM8A 1SRPA 3RTTA 1MMRA 5B5OA 3RTSA 2OXUA 1JAQA 2MLSA 5H8XA 2OXZA 3K7NA 1WNIA 4HMAA 1SATA 3TT4A 1D7XA 1R54A 1BZSA 3F19A 4R3VA 2QPJA 1SMPA 1XFVA 1HV5A 830CA 3F15A 4FU4A 1ZVXA 1JK3A 4DD8A 1L6JA 1I1IP 1ND1A 3KHIA 5L7FA 2OVXA 1USNA 1UMTA 2WO8A 3AYKA 1BKCI 4XCTA 2ERQA 1PWWA 3SHIA 1B8YA 4WKEA 1EAKA 4PKWA 4EFSA 1BQQM 4L6TA 1OS2A 5I4OA 3EDHA 1G9KA 1GE6A 5D1UA 3KWVC 4A3WA 1R1HA 1D8MA 1QICA 3KMEA 4JA1A 3GBOA 5I43A 1G12A 3ZXHA 1XURA 1FM1A 3LJGA 4I35A 1J7NA 4JQGA 4HX3A 1AYKA 1XFXA 3N2VA 2OXWA 1XFZA 2X3BA 1QJIA 1JKYA 3WV2A 1A86A 4G0DA 4AYKA 1GO8P 4IUWA 1HY7A 2O36A 1GE5A 3G5CA 1EUBA 1UTZA 1R55A 2D1NA 2X3AA 3EDIA 1JIZA 1B3DA 3I7IA 4H3XA 1CGFA 4GR0A 5D7WA 1O0TA 3UVCA 1UMSA 1RMZA 4H30A 3V96B 4XM8A 4H82A 3F17A 2Y6CA 4AXQA 1KBCA 3KMCA 5D3CA 2POJA 3KRYA 1XUDA 3TSKA 3E8RA 4AIGA 1QJJA 1CXVA 4L63A 2K9CA 1CGLA 1H71P 2JNPA 2RJPA 3HBVP 4DF9A 1OM8A 1XFUA 3HDBA 5D1SA 3L0TA 1CK7A 1KUFA 3ZUKA 2JT5A 1IAAA 2A8HA 4Q1LA 2OW1A 5L79A 3B92A 1GE7A 3LK8A 3ZVSA 1CIZA 3B8ZA 1G49A 3L0VA 456CA 2DW2A 1HTDA 2FV9A 3F1AA 1D5JA 2RJQA 2J83A 4H76A 4XBHA 1FBLA 1UEAA 3DNGA 2CKIA 1MMBA 4PKQA 2W12A 3VTGA 3DPFA 1IAEA 1I76A 3WV1A 1AF0A
chains in the Genus database with same CATH superfamily
4DPEA 3HY9A 3CKIA 1OMJA 3TVCA 1SU3A 2OI0A 1YCMA 3LUNA 1JIWP 2YUFA 2DDYA 3WV3A 4GUYA 5BOYA 1KUGA 3DWBA 1AKLA 2E3XA 1PWQA 4FXYP 2WOAA 1CGEA 1Y0VA 5LABA 4AUOA 1ZP5A 1FLSA 4XM7A 4JP4A 4PKVA 1BKCA 1OO9A 2MLRA 2OW0A 1QIAA 3U1RA 5BPAA 2V4BA 4ZR5A 3Q2HA 1HFCA 1OS9A 1ZXCA 1AF0A 3BA0A 1PWUA 4L7AA 2W15A 1I73A 1K7QA 5I0LA 1IADA 3VI1A 1K7GA 4L19A 4ILWD 2W14A 3G42A 1C7KA 1XFYA 5CXAA 2JIHA 2JT6A 1MMPA 2Y6DA 3LIRA 3KECA 1JH1A 2TCLA 1GKCA 1HFSA 2MZEA 3KEKA 1BUDA 2DDFA 4IJOA 1C3IA 4PKRA 3O64A 4H1QA 1KAPP 2K2GA 1C8TA 1CAQA 4FVLA 2PJTA 1MMQA 4FXQA 3NX7A 2N8RA 1GO7P 1SLMA 1IAGA 2MZHA 3EDZA 1BIWA 1A85A 2ERPA 1BM6A 2OVZA 2W0DA 2KRJA 1CQRA 2DW1A 4I03A 1XFWA 966CA 3EHXA 4CTHA 3HY7A 4GR3A 2DW0A 3I7GA 1G4KA 2WO9A 3DL1A 4PKTA 1R1JA 5D1TA 3P24A 2D1OA 3N2UA 2E2DA 4GWMA 4J4MA 4H84A 5B5PA 5D2BA 2USNA 2XS3A 1ATLA 3HYGA 1HOVA 3DTEA 2XS4A 2X7MA 1UTTA 1Z3JA 1DTHA 1S4BP 1Y8JA 1XUCA 2AIGP 2EROA 1DMTA 2I47A 1ZTQA 1KUHA 1OM6A 3P1VA 1PWVA 4IN9A 4JIJA 1JAPA 3DSLA 3F18A 2OZRA 4XM6A 2YB9A 2OW9A 3LILA 3AYUA 3F16A 5I12A 3DPEA 2Z2DA 2W13A 1Q3AA 2OY2A 1ASTA 2HU6A 1O0QA 3ELMA 1ZS0A 3USNA 2OW2A 1BSWA 1PWPA 2X3CA 1BUVM 1EB6A 1GKDA 1JAOA 3LKAA 3LGPA 4WKIA 2FV5A 2MZIA 3EWJA 3TS4A 4JPAA 3O2XA 3K7LA 1KUIA 3KEJA 1MNCA 2CLTA 4PKUA 1D8FA 1GXDA 2AYKA 5BOTA 1QUAA 1JJ9A 4G9LA 3LMCA 1IACA 5I2ZA 1OM7A 3LUMA 2OY4A 5JMYA 4WF6A 3HBUP 1XAXA 2L0RA 3B2ZA 1JANA 1ROSA 1R1IA 3HDAP 1G05A 2J0TA 4GWNA 1YP1A 2JSDA 3EHYA 1QIBA 4WK7A 3OHLA 3LEAA 1SLNA 1BKCE 1KUKA 4GQLA 1BQOA 2SRTA 3OHOA 3LIKA 2YIGA 3LE9A 3HB2P 2O3EA 3LQBA 4A7BA 3EDGA 1IABA 1ZXVA 3AIGA 4QKZA 5CZMA 3MA2A 4ON1A 4WZVA 4DV8A 4H49A 3Q2GA 4GR8A 4PKSA 1K7IA 3LJZA 5CUHA 1YOUA 3LJTA 5I3MA 1Y93A 4H2EA 4GF1A 1YQYA 3LQ0A 1RM8A 1SRPA 3RTTA 1MMRA 5B5OA 3RTSA 2OXUA 1JAQA 2MLSA 5H8XA 2OXZA 3K7NA 1WNIA 4HMAA 1SATA 3TT4A 1D7XA 1R54A 1BZSA 3F19A 4R3VA 2QPJA 1SMPA 1XFVA 1HV5A 830CA 3F15A 4FU4A 1ZVXA 1JK3A 4DD8A 1L6JA 1I1IP 1ND1A 3KHIA 5L7FA 2OVXA 1USNA 1XM5A 1UMTA 2WO8A 3AYKA 1OZ9A 1BKCI 4XCTA 2ERQA 1PWWA 3SHIA 1B8YA 4WKEA 1EAKA 4PKWA 4EFSA 1BQQM 4L6TA 1OS2A 5I4OA 3EDHA 1G9KA 1GE6A 5D1UA 3KWVC 4A3WA 1R1HA 1D8MA 1QICA 3KMEA 4JA1A 3GBOA 5I43A 1G12A 3ZXHA 1XURA 1FM1A 3LJGA 4I35A 1J7NA 4JQGA 4HX3A 1AYKA 1XFXA 3N2VA 2OXWA 1XFZA 2X3BA 1QJIA 1JKYA 3WV2A 1A86A 4G0DA 4AYKA 1GO8P 4IUWA 1HY7A 2O36A 1GE5A 3G5CA 1EUBA 1UTZA 1R55A 2D1NA 2X3AA 3EDIA 1JIZA 1B3DA 3I7IA 4H3XA 1CGFA 4GR0A 5D7WA 1O0TA 3UVCA 1UMSA 1RMZA 4H30A 3V96B 4XM8A 4H82A 3F17A 2Y6CA 4AXQA 1KBCA 3KMCA 5D3CA 2POJA 3KRYA 1XUDA 3TSKA 3E8RA 4AIGA 1QJJA 1CXVA 4L63A 2K9CA 1CGLA 1H71P 2JNPA 2RJPA 3HBVP 4DF9A 1OM8A 1XFUA 3HDBA 5D1SA 3L0TA 1CK7A 1KUFA 1TVIA 3ZUKA 2JT5A 1IAAA 2A8HA 4Q1LA 2OW1A 5L79A 3B92A 1GE7A 3LK8A 3ZVSA 1CIZA 3B8ZA 1G49A 3L0VA 456CA 2DW2A 1HTDA 2FV9A 3F1AA 1D5JA 2RJQA 2J83A 4H76A 4XBHA 1FBLA 1UEAA 3DNGA 2CKIA 1MMBA 4PKQA 2W12A 3VTGA 3DTKA 3DPFA 1IAEA 1I76A 3WV1A 3DTIA
chains in the Genus database with same CATH topology
4DPEA 3HY9A 3CKIA 1OMJA 3TVCA 1SU3A 2OI0A 1YCMA 3LUNA 1JIWP 2YUFA 2DDYA 3WV3A 4GUYA 5BOYA 1KUGA 3DWBA 1AKLA 2E3XA 1PWQA 4FXYP 2WOAA 1CGEA 1Y0VA 5LABA 4AUOA 1ZP5A 1FLSA 4XM7A 4JP4A 4PKVA 1BKCA 1OO9A 2MLRA 2OW0A 1QIAA 3U1RA 5BPAA 2V4BA 4ZR5A 3Q2HA 1HFCA 1OS9A 1ZXCA 1AF0A 3BA0A 1PWUA 4L7AA 2W15A 1I73A 1K7QA 5I0LA 1IADA 3VI1A 1K7GA 4L19A 4ILWD 2W14A 3G42A 1C7KA 1XFYA 5CXAA 2JIHA 2JT6A 1MMPA 2Y6DA 3LIRA 3KECA 1JH1A 2TCLA 1GKCA 1HFSA 2MZEA 3KEKA 1BUDA 2DDFA 4IJOA 1C3IA 4PKRA 3O64A 4H1QA 1KAPP 2K2GA 1C8TA 1CAQA 4FVLA 2PJTA 1MMQA 4FXQA 3NX7A 2N8RA 1GO7P 1SLMA 1IAGA 2MZHA 3EDZA 1BIWA 1A85A 2ERPA 1BM6A 2OVZA 2W0DA 2KRJA 1CQRA 2DW1A 4I03A 1XFWA 966CA 3EHXA 4CTHA 3HY7A 4GR3A 2DW0A 3I7GA 1G4KA 2WO9A 3DL1A 4PKTA 1R1JA 5D1TA 3P24A 2D1OA 3N2UA 2E2DA 4GWMA 4J4MA 4H84A 5B5PA 5D2BA 2USNA 2XS3A 1ATLA 3HYGA 1HOVA 3DTEA 2XS4A 2X7MA 1UTTA 1Z3JA 1DTHA 1S4BP 1Y8JA 1XUCA 2AIGP 2EROA 1DMTA 2I47A 1ZTQA 1KUHA 1OM6A 3P1VA 1PWVA 4IN9A 4JIJA 1JAPA 3DSLA 3F18A 2OZRA 4XM6A 2YB9A 2OW9A 3LILA 3AYUA 3F16A 5I12A 3DPEA 2Z2DA 2W13A 1Q3AA 2OY2A 1ASTA 2HU6A 1O0QA 3ELMA 1ZS0A 3USNA 2OW2A 1BSWA 1PWPA 2X3CA 1BUVM 1EB6A 1GKDA 1JAOA 3LKAA 3LGPA 4WKIA 2FV5A 2MZIA 3EWJA 3TS4A 4JPAA 3O2XA 3K7LA 1KUIA 3KEJA 1MNCA 2CLTA 4PKUA 1D8FA 1GXDA 2AYKA 5BOTA 1QUAA 1JJ9A 4G9LA 3LMCA 1IACA 5I2ZA 1OM7A 3LUMA 2OY4A 5JMYA 4WF6A 3HBUP 2L0RA 3B2ZA 1JANA 1ROSA 1R1IA 3HDAP 1G05A 2J0TA 4GWNA 1YP1A 2JSDA 3EHYA 1QIBA 4WK7A 3OHLA 3LEAA 1SLNA 1BKCE 1KUKA 4GQLA 1BQOA 2SRTA 3OHOA 3LIKA 2YIGA 3LE9A 3HB2P 2O3EA 3LQBA 4A7BA 3EDGA 1IABA 1ZXVA 3AIGA 4QKZA 5CZMA 3MA2A 4ON1A 4WZVA 4DV8A 4H49A 3Q2GA 4GR8A 4PKSA 1K7IA 3LJZA 5CUHA 1YOUA 3LJTA 5I3MA 1Y93A 4H2EA 4GF1A 1YQYA 3LQ0A 1RM8A 1SRPA 3RTTA 1MMRA 5B5OA 3RTSA 2OXUA 1JAQA 2MLSA 5H8XA 2OXZA 3K7NA 1WNIA 4HMAA 1SATA 3TT4A 1D7XA 1R54A 1BZSA 3F19A 4R3VA 2QPJA 1SMPA 1XFVA 1HV5A 830CA 3F15A 4FU4A 1ZVXA 1JK3A 4DD8A 1L6JA 1I1IP 1ND1A 3KHIA 5L7FA 2OVXA 1USNA 1UMTA 2WO8A 3AYKA 1BKCI 4XCTA 2ERQA 1PWWA 3SHIA 1B8YA 4WKEA 1EAKA 4PKWA 4EFSA 1BQQM 4L6TA 1OS2A 5I4OA 3EDHA 1G9KA 1GE6A 5D1UA 3KWVC 4A3WA 1R1HA 1D8MA 1QICA 3KMEA 4JA1A 3GBOA 5I43A 1G12A 3ZXHA 1XURA 1FM1A 3LJGA 4I35A 1J7NA 4JQGA 4HX3A 1AYKA 1XFXA 3N2VA 2OXWA 1XFZA 2X3BA 1QJIA 1JKYA 3WV2A 1A86A 4G0DA 4AYKA 1GO8P 4IUWA 1HY7A 2O36A 1GE5A 3G5CA 1EUBA 1UTZA 1R55A 2D1NA 2X3AA 3EDIA 1JIZA 1B3DA 3I7IA 4H3XA 1CGFA 4GR0A 5D7WA 1O0TA 3UVCA 1UMSA 1RMZA 4H30A 3V96B 4XM8A 4H82A 3F17A 2Y6CA 4AXQA 1KBCA 3KMCA 5D3CA 2POJA 3KRYA 1XUDA 3TSKA 3E8RA 4AIGA 1QJJA 1CXVA 4L63A 2K9CA 1CGLA 1H71P 2JNPA 2RJPA 3HBVP 4DF9A 1OM8A 1XFUA 3HDBA 5D1SA 3L0TA 1CK7A 1KUFA 3ZUKA 2JT5A 1IAAA 2A8HA 4Q1LA 2OW1A 5L79A 3B92A 1GE7A 3LK8A 3ZVSA 1CIZA 3B8ZA 1G49A 3L0VA 456CA 2DW2A 1HTDA 2FV9A 3F1AA 1D5JA 2RJQA 2J83A 4H76A 4XBHA 1FBLA 1UEAA 3DNGA 2CKIA 1MMBA 4PKQA 2W12A 3VTGA 3DTKA 3DPFA 1IAEA 1I76A 3WV1A 3DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPE A;  3HY9 A;  3CKI A;  1OMJ A;  3TVC A;  1SU3 A;  2OI0 A;  1YCM A;  3LUN A;  1JIW P;  2DDY A;  3WV3 A;  4GUY A;  5BOY A;  1KUG A;  3DWB A;  1AKL A;  2E3X A;  1PWQ A;  4FXY P;  2WOA A;  1CGE A;  1Y0V A;  5LAB A;  4AUO A;  1ZP5 A;  1FLS A;  4XM7 A;  4JP4 A;  4PKV A;  1BKC A;  1OO9 A;  2MLR A;  2OW0 A;  1QIA A;  3U1R A;  5BPA A;  2V4B A;  4ZR5 A;  3Q2H A;  1HFC A;  1OS9 A;  1ZXC A;  3BA0 A;  1PWU A;  2W15 A;  1I73 A;  1K7Q A;  5I0L A;  1IAD A;  3VI1 A;  1K7G A;  4L19 A;  4ILW D;  2W14 A;  3G42 A;  1C7K A;  1XFY A;  5CXA A;  2JIH A;  2JT6 A;  1MMP A;  2Y6D A;  3LIR A;  3KEC A;  1JH1 A;  2TCL A;  1GKC A;  1HFS A;  2MZE A;  3KEK A;  1BUD A;  2DDF A;  4IJO A;  1C3I A;  4PKR A;  3O64 A;  4H1Q A;  1KAP P;  2K2G A;  1C8T A;  1CAQ A;  4FVL A;  2PJT A;  1MMQ A;  4FXQ A;  3NX7 A;  2N8R A;  1GO7 P;  1SLM A;  1IAG A;  2MZH A;  3EDZ A;  1BIW A;  1A85 A;  2ERP A;  1BM6 A;  2OVZ A;  2W0D A;  2KRJ A;  1CQR A;  2DW1 A;  4I03 A;  1XFW A;  966C A;  3EHX A;  4CTH A;  3HY7 A;  4GR3 A;  2DW0 A;  3I7G A;  1G4K A;  2WO9 A;  3DL1 A;  4PKT A;  1R1J A;  5D1T A;  3P24 A;  2D1O A;  3N2U A;  2E2D A;  4GWM A;  4J4M A;  4H84 A;  5B5P A;  5D2B A;  2USN A;  2XS3 A;  1ATL A;  3HYG A;  1HOV A;  2XS4 A;  2X7M A;  1UTT A;  1Z3J A;  1DTH A;  1S4B P;  1Y8J A;  1XUC A;  2AIG P;  2ERO A;  1DMT A;  2I47 A;  1ZTQ A;  1KUH A;  1OM6 A;  3P1V A;  1PWV A;  4IN9 A;  4JIJ A;  1JAP A;  3DSL A;  3F18 A;  2OZR A;  4XM6 A;  2YB9 A;  2OW9 A;  3LIL A;  3AYU A;  3F16 A;  5I12 A;  3DPE A;  2Z2D A;  2W13 A;  1Q3A A;  2OY2 A;  1AST A;  2HU6 A;  1O0Q A;  3ELM A;  1ZS0 A;  3USN A;  2OW2 A;  1BSW A;  1PWP A;  2X3C A;  1BUV M;  1EB6 A;  1GKD A;  1JAO A;  3LKA A;  3LGP A;  4WKI A;  2FV5 A;  2MZI A;  3EWJ A;  3TS4 A;  4JPA A;  3O2X A;  3K7L A;  1KUI A;  3KEJ A;  1MNC A;  2CLT A;  4PKU A;  1D8F A;  1GXD A;  2AYK A;  5BOT A;  1QUA A;  1JJ9 A;  4G9L A;  3LMC A;  1IAC A;  5I2Z A;  1OM7 A;  3LUM A;  2OY4 A;  5JMY A;  4WF6 A;  3HBU P;  2L0R A;  3B2Z A;  1JAN A;  1ROS A;  1R1I A;  3HDA P;  1G05 A;  2J0T A;  4GWN A;  1YP1 A;  2JSD A;  3EHY A;  1QIB A;  4WK7 A;  3OHL A;  3LEA A;  1SLN A;  1BKC E;  1KUK A;  4GQL A;  1BQO A;  2SRT A;  3OHO A;  3LIK A;  2YIG A;  3LE9 A;  3HB2 P;  2O3E A;  3LQB A;  4A7B A;  3EDG A;  1IAB A;  1ZXV A;  3AIG A;  4QKZ A;  5CZM A;  3MA2 A;  4ON1 A;  4WZV A;  4DV8 A;  4H49 A;  3Q2G A;  4GR8 A;  4PKS A;  1K7I A;  3LJZ A;  5CUH A;  1YOU A;  3LJT A;  5I3M A;  1Y93 A;  4H2E A;  4GF1 A;  1YQY A;  3LQ0 A;  1RM8 A;  1SRP A;  3RTT A;  1MMR A;  5B5O A;  3RTS A;  2OXU A;  1JAQ A;  2MLS A;  5H8X A;  2OXZ A;  3K7N A;  1WNI A;  4HMA A;  1SAT A;  3TT4 A;  1D7X A;  1R54 A;  1BZS A;  3F19 A;  4R3V A;  2QPJ A;  1SMP A;  1XFV A;  1HV5 A;  830C A;  3F15 A;  4FU4 A;  1ZVX A;  1JK3 A;  4DD8 A;  1L6J A;  1I1I P;  1ND1 A;  3KHI A;  5L7F A;  2OVX A;  1USN A;  1UMT A;  2WO8 A;  3AYK A;  1BKC I;  4XCT A;  2ERQ A;  1PWW A;  3SHI A;  1B8Y A;  4WKE A;  1EAK A;  4PKW A;  4EFS A;  1BQQ M;  4L6T A;  1OS2 A;  5I4O A;  3EDH A;  1G9K A;  1GE6 A;  5D1U A;  3KWV C;  4A3W A;  1R1H A;  1D8M A;  1QIC A;  3KME A;  4JA1 A;  3GBO A;  5I43 A;  1G12 A;  3ZXH A;  1XUR A;  1FM1 A;  3LJG A;  4I35 A;  1J7N A;  4JQG A;  4HX3 A;  1AYK A;  1XFX A;  3N2V A;  2OXW A;  1XFZ A;  2X3B A;  1QJI A;  1JKY A;  3WV2 A;  1A86 A;  4G0D A;  4AYK A;  1GO8 P;  4IUW A;  1HY7 A;  2O36 A;  1GE5 A;  3G5C A;  1EUB A;  1UTZ A;  1R55 A;  2D1N A;  2X3A A;  3EDI A;  1JIZ A;  1B3D A;  3I7I A;  4H3X A;  1CGF A;  4GR0 A;  5D7W A;  1O0T A;  3UVC A;  1UMS A;  1RMZ A;  4H30 A;  3V96 B;  4XM8 A;  4H82 A;  3F17 A;  2Y6C A;  4AXQ A;  1KBC A;  3KMC A;  5D3C A;  2POJ A;  3KRY A;  1XUD A;  3TSK A;  3E8R A;  4AIG A;  1QJJ A;  1CXV A;  4L63 A;  2K9C A;  1CGL A;  1H71 P;  2JNP A;  2RJP A;  3HBV P;  4DF9 A;  1OM8 A;  1XFU A;  3HDB A;  5D1S A;  3L0T A;  1CK7 A;  1KUF A;  3ZUK A;  2JT5 A;  1IAA A;  2A8H A;  4Q1L A;  2OW1 A;  5L79 A;  3B92 A;  1GE7 A;  3LK8 A;  3ZVS A;  1CIZ A;  3B8Z A;  1G49 A;  3L0V A;  456C A;  2DW2 A;  1HTD A;  2FV9 A;  3F1A A;  1D5J A;  2RJQ A;  2J83 A;  4H76 A;  4XBH A;  1FBL A;  1UEA A;  3DNG A;  2CKI A;  1MMB A;  4PKQ A;  2W12 A;  3VTG A;  3DPF A;  1IAE A;  1I76 A;  3WV1 A;  1AF0 A; 
#chains in the Genus database with same CATH topology
 4DPE A;  3HY9 A;  3CKI A;  1OMJ A;  3TVC A;  1SU3 A;  2OI0 A;  1YCM A;  3LUN A;  1JIW P;  2YUF A;  2DDY A;  3WV3 A;  4GUY A;  5BOY A;  1KUG A;  3DWB A;  1AKL A;  2E3X A;  1PWQ A;  4FXY P;  2WOA A;  1CGE A;  1Y0V A;  5LAB A;  4AUO A;  1ZP5 A;  1FLS A;  4XM7 A;  4JP4 A;  4PKV A;  1BKC A;  1OO9 A;  2MLR A;  2OW0 A;  1QIA A;  3U1R A;  5BPA A;  2V4B A;  4ZR5 A;  3Q2H A;  1HFC A;  1OS9 A;  1ZXC A;  1AF0 A;  3BA0 A;  1PWU A;  4L7A A;  2W15 A;  1I73 A;  1K7Q A;  5I0L A;  1IAD A;  3VI1 A;  1K7G A;  4L19 A;  4ILW D;  2W14 A;  3G42 A;  1C7K A;  1XFY A;  5CXA A;  2JIH A;  2JT6 A;  1MMP A;  2Y6D A;  3LIR A;  3KEC A;  1JH1 A;  2TCL A;  1GKC A;  1HFS A;  2MZE A;  3KEK A;  1BUD A;  2DDF A;  4IJO A;  1C3I A;  4PKR A;  3O64 A;  4H1Q A;  1KAP P;  2K2G A;  1C8T A;  1CAQ A;  4FVL A;  2PJT A;  1MMQ A;  4FXQ A;  3NX7 A;  2N8R A;  1GO7 P;  1SLM A;  1IAG A;  2MZH A;  3EDZ A;  1BIW A;  1A85 A;  2ERP A;  1BM6 A;  2OVZ A;  2W0D A;  2KRJ A;  1CQR A;  2DW1 A;  4I03 A;  1XFW A;  966C A;  3EHX A;  4CTH A;  3HY7 A;  4GR3 A;  2DW0 A;  3I7G A;  1G4K A;  2WO9 A;  3DL1 A;  4PKT A;  1R1J A;  5D1T A;  3P24 A;  2D1O A;  3N2U A;  2E2D A;  4GWM A;  4J4M A;  4H84 A;  5B5P A;  5D2B A;  2USN A;  2XS3 A;  1ATL A;  3HYG A;  1HOV A;  3DTE A;  2XS4 A;  2X7M A;  1UTT A;  1Z3J A;  1DTH A;  1S4B P;  1Y8J A;  1XUC A;  2AIG P;  2ERO A;  1DMT A;  2I47 A;  1ZTQ A;  1KUH A;  1OM6 A;  3P1V A;  1PWV A;  4IN9 A;  4JIJ A;  1JAP A;  3DSL A;  3F18 A;  2OZR A;  4XM6 A;  2YB9 A;  2OW9 A;  3LIL A;  3AYU A;  3F16 A;  5I12 A;  3DPE A;  2Z2D A;  2W13 A;  1Q3A A;  2OY2 A;  1AST A;  2HU6 A;  1O0Q A;  3ELM A;  1ZS0 A;  3USN A;  2OW2 A;  1BSW A;  1PWP A;  2X3C A;  1BUV M;  1EB6 A;  1GKD A;  1JAO A;  3LKA A;  3LGP A;  4WKI A;  2FV5 A;  2MZI A;  3EWJ A;  3TS4 A;  4JPA A;  3O2X A;  3K7L A;  1KUI A;  3KEJ A;  1MNC A;  2CLT A;  4PKU A;  1D8F A;  1GXD A;  2AYK A;  5BOT A;  1QUA A;  1JJ9 A;  4G9L A;  3LMC A;  1IAC A;  5I2Z A;  1OM7 A;  3LUM A;  2OY4 A;  5JMY A;  4WF6 A;  3HBU P;  1XAX A;  2L0R A;  3B2Z A;  1JAN A;  1ROS A;  1R1I A;  3HDA P;  1G05 A;  2J0T A;  4GWN A;  1YP1 A;  2JSD A;  3EHY A;  1QIB A;  4WK7 A;  3OHL A;  3LEA A;  1SLN A;  1BKC E;  1KUK A;  4GQL A;  1BQO A;  2SRT A;  3OHO A;  3LIK A;  2YIG A;  3LE9 A;  3HB2 P;  2O3E A;  3LQB A;  4A7B A;  3EDG A;  1IAB A;  1ZXV A;  3AIG A;  4QKZ A;  5CZM A;  3MA2 A;  4ON1 A;  4WZV A;  4DV8 A;  4H49 A;  3Q2G A;  4GR8 A;  4PKS A;  1K7I A;  3LJZ A;  5CUH A;  1YOU A;  3LJT A;  5I3M A;  1Y93 A;  4H2E A;  4GF1 A;  1YQY A;  3LQ0 A;  1RM8 A;  1SRP A;  3RTT A;  1MMR A;  5B5O A;  3RTS A;  2OXU A;  1JAQ A;  2MLS A;  5H8X A;  2OXZ A;  3K7N A;  1WNI A;  4HMA A;  1SAT A;  3TT4 A;  1D7X A;  1R54 A;  1BZS A;  3F19 A;  4R3V A;  2QPJ A;  1SMP A;  1XFV A;  1HV5 A;  830C A;  3F15 A;  4FU4 A;  1ZVX A;  1JK3 A;  4DD8 A;  1L6J A;  1I1I P;  1ND1 A;  3KHI A;  5L7F A;  2OVX A;  1USN A;  1XM5 A;  1UMT A;  2WO8 A;  3AYK A;  1OZ9 A;  1BKC I;  4XCT A;  2ERQ A;  1PWW A;  3SHI A;  1B8Y A;  4WKE A;  1EAK A;  4PKW A;  4EFS A;  1BQQ M;  4L6T A;  1OS2 A;  5I4O A;  3EDH A;  1G9K A;  1GE6 A;  5D1U A;  3KWV C;  4A3W A;  1R1H A;  1D8M A;  1QIC A;  3KME A;  4JA1 A;  3GBO A;  5I43 A;  1G12 A;  3ZXH A;  1XUR A;  1FM1 A;  3LJG A;  4I35 A;  1J7N A;  4JQG A;  4HX3 A;  1AYK A;  1XFX A;  3N2V A;  2OXW A;  1XFZ A;  2X3B A;  1QJI A;  1JKY A;  3WV2 A;  1A86 A;  4G0D A;  4AYK A;  1GO8 P;  4IUW A;  1HY7 A;  2O36 A;  1GE5 A;  3G5C A;  1EUB A;  1UTZ A;  1R55 A;  2D1N A;  2X3A A;  3EDI A;  1JIZ A;  1B3D A;  3I7I A;  4H3X A;  1CGF A;  4GR0 A;  5D7W A;  1O0T A;  3UVC A;  1UMS A;  1RMZ A;  4H30 A;  3V96 B;  4XM8 A;  4H82 A;  3F17 A;  2Y6C A;  4AXQ A;  1KBC A;  3KMC A;  5D3C A;  2POJ A;  3KRY A;  1XUD A;  3TSK A;  3E8R A;  4AIG A;  1QJJ A;  1CXV A;  4L63 A;  2K9C A;  1CGL A;  1H71 P;  2JNP A;  2RJP A;  3HBV P;  4DF9 A;  1OM8 A;  1XFU A;  3HDB A;  5D1S A;  3L0T A;  1CK7 A;  1KUF A;  1TVI A;  3ZUK A;  2JT5 A;  1IAA A;  2A8H A;  4Q1L A;  2OW1 A;  5L79 A;  3B92 A;  1GE7 A;  3LK8 A;  3ZVS A;  1CIZ A;  3B8Z A;  1G49 A;  3L0V A;  456C A;  2DW2 A;  1HTD A;  2FV9 A;  3F1A A;  1D5J A;  2RJQ A;  2J83 A;  4H76 A;  4XBH A;  1FBL A;  1UEA A;  3DNG A;  2CKI A;  1MMB A;  4PKQ A;  2W12 A;  3VTG A;  3DTK A;  3DPF A;  1IAE A;  1I76 A;  3WV1 A;  3DTI A; 
#chains in the Genus database with same CATH homology
 4DPE A;  3HY9 A;  3CKI A;  1OMJ A;  3TVC A;  1SU3 A;  2OI0 A;  1YCM A;  3LUN A;  1JIW P;  2YUF A;  2DDY A;  3WV3 A;  4GUY A;  5BOY A;  1KUG A;  3DWB A;  1AKL A;  2E3X A;  1PWQ A;  4FXY P;  2WOA A;  1CGE A;  1Y0V A;  5LAB A;  4AUO A;  1ZP5 A;  1FLS A;  4XM7 A;  4JP4 A;  4PKV A;  1BKC A;  1OO9 A;  2MLR A;  2OW0 A;  1QIA A;  3U1R A;  5BPA A;  2V4B A;  4ZR5 A;  3Q2H A;  1HFC A;  1OS9 A;  1ZXC A;  1AF0 A;  3BA0 A;  1PWU A;  4L7A A;  2W15 A;  1I73 A;  1K7Q A;  5I0L A;  1IAD A;  3VI1 A;  1K7G A;  4L19 A;  4ILW D;  2W14 A;  3G42 A;  1C7K A;  1XFY A;  5CXA A;  2JIH A;  2JT6 A;  1MMP A;  2Y6D A;  3LIR A;  3KEC A;  1JH1 A;  2TCL A;  1GKC A;  1HFS A;  2MZE A;  3KEK A;  1BUD A;  2DDF A;  4IJO A;  1C3I A;  4PKR A;  3O64 A;  4H1Q A;  1KAP P;  2K2G A;  1C8T A;  1CAQ A;  4FVL A;  2PJT A;  1MMQ A;  4FXQ A;  3NX7 A;  2N8R A;  1GO7 P;  1SLM A;  1IAG A;  2MZH A;  3EDZ A;  1BIW A;  1A85 A;  2ERP A;  1BM6 A;  2OVZ A;  2W0D A;  2KRJ A;  1CQR A;  2DW1 A;  4I03 A;  1XFW A;  966C A;  3EHX A;  4CTH A;  3HY7 A;  4GR3 A;  2DW0 A;  3I7G A;  1G4K A;  2WO9 A;  3DL1 A;  4PKT A;  1R1J A;  5D1T A;  3P24 A;  2D1O A;  3N2U A;  2E2D A;  4GWM A;  4J4M A;  4H84 A;  5B5P A;  5D2B A;  2USN A;  2XS3 A;  1ATL A;  3HYG A;  1HOV A;  3DTE A;  2XS4 A;  2X7M A;  1UTT A;  1Z3J A;  1DTH A;  1S4B P;  1Y8J A;  1XUC A;  2AIG P;  2ERO A;  1DMT A;  2I47 A;  1ZTQ A;  1KUH A;  1OM6 A;  3P1V A;  1PWV A;  4IN9 A;  4JIJ A;  1JAP A;  3DSL A;  3F18 A;  2OZR A;  4XM6 A;  2YB9 A;  2OW9 A;  3LIL A;  3AYU A;  3F16 A;  5I12 A;  3DPE A;  2Z2D A;  2W13 A;  1Q3A A;  2OY2 A;  1AST A;  2HU6 A;  1O0Q A;  3ELM A;  1ZS0 A;  3USN A;  2OW2 A;  1BSW A;  1PWP A;  2X3C A;  1BUV M;  1EB6 A;  1GKD A;  1JAO A;  3LKA A;  3LGP A;  4WKI A;  2FV5 A;  2MZI A;  3EWJ A;  3TS4 A;  4JPA A;  3O2X A;  3K7L A;  1KUI A;  3KEJ A;  1MNC A;  2CLT A;  4PKU A;  1D8F A;  1GXD A;  2AYK A;  5BOT A;  1QUA A;  1JJ9 A;  4G9L A;  3LMC A;  1IAC A;  5I2Z A;  1OM7 A;  3LUM A;  2OY4 A;  5JMY A;  4WF6 A;  3HBU P;  2L0R A;  3B2Z A;  1JAN A;  1ROS A;  1R1I A;  3HDA P;  1G05 A;  2J0T A;  4GWN A;  1YP1 A;  2JSD A;  3EHY A;  1QIB A;  4WK7 A;  3OHL A;  3LEA A;  1SLN A;  1BKC E;  1KUK A;  4GQL A;  1BQO A;  2SRT A;  3OHO A;  3LIK A;  2YIG A;  3LE9 A;  3HB2 P;  2O3E A;  3LQB A;  4A7B A;  3EDG A;  1IAB A;  1ZXV A;  3AIG A;  4QKZ A;  5CZM A;  3MA2 A;  4ON1 A;  4WZV A;  4DV8 A;  4H49 A;  3Q2G A;  4GR8 A;  4PKS A;  1K7I A;  3LJZ A;  5CUH A;  1YOU A;  3LJT A;  5I3M A;  1Y93 A;  4H2E A;  4GF1 A;  1YQY A;  3LQ0 A;  1RM8 A;  1SRP A;  3RTT A;  1MMR A;  5B5O A;  3RTS A;  2OXU A;  1JAQ A;  2MLS A;  5H8X A;  2OXZ A;  3K7N A;  1WNI A;  4HMA A;  1SAT A;  3TT4 A;  1D7X A;  1R54 A;  1BZS A;  3F19 A;  4R3V A;  2QPJ A;  1SMP A;  1XFV A;  1HV5 A;  830C A;  3F15 A;  4FU4 A;  1ZVX A;  1JK3 A;  4DD8 A;  1L6J A;  1I1I P;  1ND1 A;  3KHI A;  5L7F A;  2OVX A;  1USN A;  1UMT A;  2WO8 A;  3AYK A;  1BKC I;  4XCT A;  2ERQ A;  1PWW A;  3SHI A;  1B8Y A;  4WKE A;  1EAK A;  4PKW A;  4EFS A;  1BQQ M;  4L6T A;  1OS2 A;  5I4O A;  3EDH A;  1G9K A;  1GE6 A;  5D1U A;  3KWV C;  4A3W A;  1R1H A;  1D8M A;  1QIC A;  3KME A;  4JA1 A;  3GBO A;  5I43 A;  1G12 A;  3ZXH A;  1XUR A;  1FM1 A;  3LJG A;  4I35 A;  1J7N A;  4JQG A;  4HX3 A;  1AYK A;  1XFX A;  3N2V A;  2OXW A;  1XFZ A;  2X3B A;  1QJI A;  1JKY A;  3WV2 A;  1A86 A;  4G0D A;  4AYK A;  1GO8 P;  4IUW A;  1HY7 A;  2O36 A;  1GE5 A;  3G5C A;  1EUB A;  1UTZ A;  1R55 A;  2D1N A;  2X3A A;  3EDI A;  1JIZ A;  1B3D A;  3I7I A;  4H3X A;  1CGF A;  4GR0 A;  5D7W A;  1O0T A;  3UVC A;  1UMS A;  1RMZ A;  4H30 A;  3V96 B;  4XM8 A;  4H82 A;  3F17 A;  2Y6C A;  4AXQ A;  1KBC A;  3KMC A;  5D3C A;  2POJ A;  3KRY A;  1XUD A;  3TSK A;  3E8R A;  4AIG A;  1QJJ A;  1CXV A;  4L63 A;  2K9C A;  1CGL A;  1H71 P;  2JNP A;  2RJP A;  3HBV P;  4DF9 A;  1OM8 A;  1XFU A;  3HDB A;  5D1S A;  3L0T A;  1CK7 A;  1KUF A;  3ZUK A;  2JT5 A;  1IAA A;  2A8H A;  4Q1L A;  2OW1 A;  5L79 A;  3B92 A;  1GE7 A;  3LK8 A;  3ZVS A;  1CIZ A;  3B8Z A;  1G49 A;  3L0V A;  456C A;  2DW2 A;  1HTD A;  2FV9 A;  3F1A A;  1D5J A;  2RJQ A;  2J83 A;  4H76 A;  4XBH A;  1FBL A;  1UEA A;  3DNG A;  2CKI A;  1MMB A;  4PKQ A;  2W12 A;  3VTG A;  3DTK A;  3DPF A;  1IAE A;  1I76 A;  3WV1 A;  3DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...