2MZHA

Nmr solution structure of the pro form of human matrilysin (prommp-7) in complex with zwitterionic membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
248
structure length
248
Chain Sequence
b'LPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrilysin
publication title Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 248
sequence length 248
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2mzhA00
2MLRA 4PKVA 1MMQA 1Z3JA 3MA2A 1CAQA 2CLTA 5I0LA 4HX3A 3WV1A 3E8RA 5BOYA 3UVCA 4I35A 2ERQA 3SHIA 2FV5A 1OMJA 1GXDA 3I7IA 1O0QA 1SMPA 4H30A 1CIZA 4JA1A 1UTZA 3EHXA 1DMTA 5BPAA 2OXUA 3LK8A 5D1UA 3L0VA 4DF9A 5D2BA 1ASTA 1R54A 1BIWA 4PKWA 2I47A 1MMPA 1OM6A 1IAEA 1QIBA 3WV3A 1JIZA 3VI1A 1RM8A 4DD8A 3KRYA 1IAAA 3TVCA 4PKSA 1BSWA 1A86A 1YP1A 5D1TA 4H2EA 4H84A 1PWPA 1XFUA 2V4BA 4IN9A 1Y0VA 1QIAA 3EHYA 1Y93A 1JANA 3EDZA 1Y8JA 3ZVSA 2DW2A 2XS4A 1JK3A 5BOTA 2OW2A 1JAPA 3HY9A 3LUNA 4XM8A 3DPFA 1BKCE 1FM1A 1ZP5A 4AIGA 3LJGA 4PKUA 1GO7P 2OW9A 2AYKA 3U1RA 1O0TA 4PKTA 2WOAA 1KUHA 2JT6A 3CKIA 3HBVP 1G12A 2DW1A 5CZMA 1ZS0A 1C8TA 4ILWD 1K7GA 4XBHA 5D7WA 3DWBA 4PKRA 830CA 3KECA 2CKIA 2PJTA 2OZRA 1G4KA 5LABA 4FXYP 2MZHA 3N2VA 1KBCA 1XFXA 3LEAA 4GQLA 4WZVA 3USNA 966CA 5I3MA 3HYGA 5CXAA 2YB9A 3HDBA 2EROA 3KMEA 3F16A 1C7KA 1KUGA 1OM8A 1USNA 1JIWP 5L7FA 1CK7A 4CTHA 2X3CA 1ZXVA 1L6JA 1D5JA 4GR0A 4GR3A 2K9CA 2YIGA 4DPEA 4GUYA 1K7IA 1B8YA 2W12A 5I12A 3F19A 2JIHA 2WO9A 2FV9A 1MMRA 2O3EA 1D8FA 1D8MA 1JAOA 1YQYA 2A8HA 3KWVC 1OS9A 1QJIA 1BQOA 3P1VA 1BKCI 1IAGA 4FVLA 1B3DA 1ZVXA 1BZSA 1SLNA 2OI0A 3O2XA 1R1JA 3EDIA 2MZEA 1ROSA 1HY7A 1G9KA 1D7XA 3KEJA 5B5PA 1GE7A 4GF1A 1SU3A 1Q3AA 3F18A 1PWVA 1BKCA 1R1IA 3LILA 2OW0A 1GE6A 1CGLA 4WF6A 4G0DA 3P24A 3ZXHA 1XUCA 2OXZA 4ON1A 4H49A 2DW0A 1I1IP 3KMCA 1R55A 4QKZA 3B2ZA 1EB6A 1G05A 3LGPA 2Y6DA 1KUIA 2AIGP 4H76A 1H71P 3OHLA 1UMSA 1KUFA 1HV5A 2X7MA 3Q2HA 1ND1A 5CUHA 1IABA 1GE5A 1I76A 5I43A 3AIGA 3N2UA 4G9LA 1IACA 1OM7A 1SLMA 3VTGA 1XFVA 2L0RA 2OVZA 4DV8A 1ATLA 2E3XA 3LIKA 4ZR5A 2W14A 3Q2GA 1PWUA 2HU6A 4IJOA 1BUVM 3HB2P 2WO8A 3EWJA 4JP4A 5JMYA 3HY7A 3F1AA 4WKEA 2W13A 4Q1LA 3OHOA 3DSLA 3EDGA 1JH1A 3F17A 4XM7A 4AXQA 3LMCA 3ZUKA 3K7LA 1UTTA 4EFSA 1KUKA 4HMAA 2DDYA 456CA 5H8XA 1CXVA 1FLSA 5I4OA 2OXWA 1SATA 3AYUA 1WNIA 2TCLA 1S4BP 4GWMA 2Z2DA 1JJ9A 3LIRA 1MMBA 1IADA 3I7GA 4A7BA 2JNPA 1SRPA 4I03A 1BM6A 1G49A 1I73A 3G5CA 2W15A 4L63A 3RTTA 2O36A 5I2ZA 2X3AA 4WKIA 1GO8P 1AKLA 4JPAA 4JQGA 2OVXA 1DTHA 2N8RA 4IUWA 2USNA 2ERPA 5L79A 4L6TA 1HTDA 2JT5A 1JKYA 1QUAA 2OW1A 4PKQA 3LJTA 3K7NA 4R3VA 1XFWA 3BA0A 3LE9A 5D1SA 4GWNA 3RTSA 1RMZA 3TT4A 4AUOA 1CQRA 4FU4A 1BUDA 1YCMA 3DPEA 2JSDA 3ELMA 4L19A 1YOUA 4J4MA 3B8ZA 3WV2A 1EAKA 1BQQM 1AF0A 3F15A 2J0TA 3LJZA 1A85A 2Y6CA 3LQ0A 1QICA 4A3WA 2X3BA 1ZTQA 3GBOA 4XM6A 1KAPP 1K7QA 2POJA 3G42A 2J83A 1CGFA 1HFSA 3LKAA 3DL1A 1OO9A 4GR8A 2MZIA 2DDFA 2KRJA 1CGEA 3DNGA 1PWQA 1JAQA 3KEKA 3HDAP 4H82A 3LUMA 4FXQA 1AYKA 4H3XA 1ZXCA 3LQBA 2XS3A 1OS2A 2MLSA 2OY4A 3O64A 3AYKA 1FBLA 3TSKA 1QJJA 4AYKA 1UMTA 4JIJA 1MNCA 1HOVA 2D1OA 2RJPA 2W0DA 1PWWA 4WK7A 1EUBA 3TS4A 4H1QA 3KHIA 1C3IA 2E2DA 2QPJA 3V96B 1HFCA 1XFZA 3NX7A 1UEAA 5B5OA 4XCTA 1XFYA 1XURA 2K2GA 2RJQA 3B92A 2SRTA 3HBUP 1GKDA 2OY2A 1R1HA 1J7NA 1XUDA 2D1NA 5D3CA 3EDHA 1GKCA 3L0TA
chains in the Genus database with same CATH superfamily
2MLRA 4PKVA 1MMQA 1Z3JA 3MA2A 1CAQA 2CLTA 5I0LA 4HX3A 3WV1A 3E8RA 5BOYA 3UVCA 4I35A 2ERQA 3SHIA 2FV5A 1OMJA 1GXDA 3I7IA 1O0QA 1SMPA 4H30A 1CIZA 4JA1A 1UTZA 3EHXA 1DMTA 5BPAA 2OXUA 3LK8A 5D1UA 3L0VA 4DF9A 5D2BA 1ASTA 1R54A 1BIWA 4PKWA 2I47A 1MMPA 1OM6A 1IAEA 1QIBA 3WV3A 1JIZA 3VI1A 1RM8A 4DD8A 3KRYA 1IAAA 3TVCA 4PKSA 1BSWA 1A86A 1XM5A 1YP1A 5D1TA 4H2EA 4H84A 1PWPA 1XFUA 2V4BA 4IN9A 1Y0VA 1QIAA 3EHYA 1Y93A 1JANA 3EDZA 1Y8JA 3ZVSA 2DW2A 2XS4A 1JK3A 5BOTA 2OW2A 1JAPA 3HY9A 3LUNA 4XM8A 3DPFA 1BKCE 1FM1A 1ZP5A 4AIGA 3LJGA 4PKUA 1GO7P 2OW9A 2AYKA 3U1RA 1O0TA 4PKTA 2WOAA 1KUHA 2JT6A 3CKIA 3HBVP 1G12A 2DW1A 5CZMA 1ZS0A 1C8TA 4ILWD 1K7GA 4XBHA 5D7WA 3DWBA 4PKRA 830CA 3KECA 2CKIA 2PJTA 2OZRA 1G4KA 5LABA 4FXYP 2MZHA 3N2VA 1KBCA 1XFXA 3LEAA 4GQLA 4WZVA 3USNA 966CA 5I3MA 3HYGA 5CXAA 2YB9A 3HDBA 2EROA 3KMEA 3F16A 1C7KA 1KUGA 1OM8A 1USNA 1JIWP 5L7FA 1CK7A 4CTHA 2X3CA 1ZXVA 1L6JA 1D5JA 4GR0A 4GR3A 2K9CA 2YIGA 4DPEA 4GUYA 1K7IA 1B8YA 2W12A 5I12A 3F19A 2JIHA 2WO9A 2FV9A 1MMRA 2O3EA 1D8FA 1D8MA 1JAOA 1YQYA 2A8HA 3KWVC 1OS9A 1QJIA 1BQOA 3P1VA 1BKCI 1IAGA 3DTKA 4FVLA 1B3DA 1ZVXA 1BZSA 1SLNA 2OI0A 3O2XA 1R1JA 3EDIA 2MZEA 1ROSA 1HY7A 1G9KA 1D7XA 3KEJA 5B5PA 1GE7A 4GF1A 1SU3A 1Q3AA 3F18A 1PWVA 1BKCA 1R1IA 3LILA 2OW0A 1GE6A 1CGLA 4WF6A 4G0DA 3P24A 3ZXHA 1XUCA 2OXZA 4ON1A 4H49A 2DW0A 1I1IP 3DTEA 3KMCA 1R55A 4QKZA 3B2ZA 1EB6A 1G05A 3LGPA 2Y6DA 1KUIA 2AIGP 4H76A 1H71P 3OHLA 1UMSA 1KUFA 1HV5A 2X7MA 3Q2HA 1ND1A 1XAXA 5CUHA 1IABA 1GE5A 1I76A 5I43A 3AIGA 3N2UA 4G9LA 1IACA 1OM7A 1SLMA 3VTGA 1XFVA 2L0RA 2OVZA 4DV8A 1ATLA 2E3XA 3LIKA 4ZR5A 2W14A 3Q2GA 1PWUA 2HU6A 4IJOA 1BUVM 3HB2P 2WO8A 3EWJA 4JP4A 5JMYA 3HY7A 3F1AA 4WKEA 2W13A 4Q1LA 3OHOA 3DSLA 3EDGA 1JH1A 3F17A 4XM7A 4AXQA 3LMCA 3ZUKA 3K7LA 1UTTA 4EFSA 1KUKA 4HMAA 2DDYA 456CA 5H8XA 1CXVA 1FLSA 5I4OA 2OXWA 1SATA 3AYUA 1WNIA 2TCLA 1TVIA 1S4BP 4GWMA 2Z2DA 1JJ9A 3LIRA 1MMBA 1IADA 3I7GA 4A7BA 2JNPA 1SRPA 4I03A 1BM6A 1G49A 1I73A 3G5CA 2W15A 4L63A 3RTTA 2O36A 5I2ZA 2X3AA 4WKIA 1GO8P 2YUFA 1AKLA 4JPAA 1OZ9A 4JQGA 2OVXA 1DTHA 2N8RA 4IUWA 2USNA 2ERPA 5L79A 4L6TA 1HTDA 2JT5A 1JKYA 1QUAA 2OW1A 4PKQA 3LJTA 3K7NA 4R3VA 1XFWA 3BA0A 3LE9A 5D1SA 4GWNA 3RTSA 1RMZA 3TT4A 4AUOA 1CQRA 4FU4A 1BUDA 1YCMA 3DPEA 2JSDA 3ELMA 4L19A 1YOUA 4J4MA 3B8ZA 3WV2A 1EAKA 1BQQM 1AF0A 3F15A 2J0TA 3LJZA 1A85A 2Y6CA 3LQ0A 1QICA 4A3WA 4L7AA 2X3BA 1ZTQA 3GBOA 4XM6A 1KAPP 1K7QA 2POJA 3G42A 2J83A 1CGFA 1HFSA 3LKAA 3DL1A 3DTIA 1OO9A 4GR8A 2MZIA 2DDFA 2KRJA 1CGEA 3DNGA 1PWQA 1JAQA 3KEKA 3HDAP 4H82A 3LUMA 4FXQA 1AYKA 4H3XA 1ZXCA 3LQBA 2XS3A 1OS2A 2MLSA 2OY4A 3O64A 3AYKA 1FBLA 3TSKA 1QJJA 4AYKA 1UMTA 4JIJA 1MNCA 1HOVA 2D1OA 2RJPA 2W0DA 1PWWA 4WK7A 1EUBA 3TS4A 4H1QA 3KHIA 1C3IA 2E2DA 2QPJA 3V96B 1HFCA 1XFZA 3NX7A 1UEAA 5B5OA 4XCTA 1XFYA 1XURA 2K2GA 2RJQA 3B92A 2SRTA 3HBUP 1GKDA 2OY2A 1R1HA 1J7NA 1XUDA 2D1NA 5D3CA 3EDHA 1GKCA 3L0TA
chains in the Genus database with same CATH topology
2MLRA 4PKVA 1MMQA 1Z3JA 3MA2A 1CAQA 2CLTA 5I0LA 4HX3A 3WV1A 3E8RA 5BOYA 3UVCA 4I35A 2ERQA 3SHIA 2FV5A 1OMJA 1GXDA 3I7IA 1O0QA 1SMPA 4H30A 1CIZA 4JA1A 1UTZA 3EHXA 1DMTA 5BPAA 2OXUA 3LK8A 5D1UA 3L0VA 4DF9A 5D2BA 1ASTA 1R54A 1BIWA 4PKWA 2I47A 1MMPA 1OM6A 1IAEA 1QIBA 3WV3A 1JIZA 3VI1A 1RM8A 4DD8A 3KRYA 1IAAA 3TVCA 4PKSA 1BSWA 1A86A 1YP1A 5D1TA 4H2EA 4H84A 1PWPA 1XFUA 2V4BA 4IN9A 1Y0VA 1QIAA 3EHYA 1Y93A 1JANA 3EDZA 1Y8JA 3ZVSA 2DW2A 2XS4A 1JK3A 5BOTA 2OW2A 1JAPA 3HY9A 3LUNA 4XM8A 3DPFA 1BKCE 1FM1A 1ZP5A 4AIGA 3LJGA 4PKUA 1GO7P 2OW9A 2AYKA 3U1RA 1O0TA 4PKTA 2WOAA 1KUHA 2JT6A 3CKIA 3HBVP 1G12A 2DW1A 5CZMA 1ZS0A 1C8TA 4ILWD 1K7GA 4XBHA 5D7WA 3DWBA 4PKRA 830CA 3KECA 2CKIA 2PJTA 2OZRA 1G4KA 5LABA 4FXYP 2MZHA 3N2VA 1KBCA 1XFXA 3LEAA 4GQLA 4WZVA 3USNA 966CA 5I3MA 3HYGA 5CXAA 2YB9A 3HDBA 2EROA 3KMEA 3F16A 1C7KA 1KUGA 1OM8A 1USNA 1JIWP 5L7FA 1CK7A 4CTHA 2X3CA 1ZXVA 1L6JA 1D5JA 4GR0A 4GR3A 2K9CA 2YIGA 4DPEA 4GUYA 1K7IA 1B8YA 2W12A 5I12A 3F19A 2JIHA 2WO9A 2FV9A 1MMRA 2O3EA 1D8FA 1D8MA 1JAOA 1YQYA 2A8HA 3KWVC 1OS9A 1QJIA 1BQOA 3P1VA 1BKCI 1IAGA 3DTKA 4FVLA 1B3DA 1ZVXA 1BZSA 1SLNA 2OI0A 3O2XA 1R1JA 3EDIA 2MZEA 1ROSA 1HY7A 1G9KA 1D7XA 3KEJA 5B5PA 1GE7A 4GF1A 1SU3A 1Q3AA 3F18A 1PWVA 1BKCA 1R1IA 3LILA 2OW0A 1GE6A 1CGLA 4WF6A 4G0DA 3P24A 3ZXHA 1XUCA 2OXZA 4ON1A 4H49A 2DW0A 1I1IP 3DTEA 3KMCA 1R55A 4QKZA 3B2ZA 1EB6A 1G05A 3LGPA 2Y6DA 1KUIA 2AIGP 4H76A 1H71P 3OHLA 1UMSA 1KUFA 1HV5A 2X7MA 3Q2HA 1ND1A 5CUHA 1IABA 1GE5A 1I76A 5I43A 3AIGA 3N2UA 4G9LA 1IACA 1OM7A 1SLMA 3VTGA 1XFVA 2L0RA 2OVZA 4DV8A 1ATLA 2E3XA 3LIKA 4ZR5A 2W14A 3Q2GA 1PWUA 2HU6A 4IJOA 1BUVM 3HB2P 2WO8A 3EWJA 4JP4A 5JMYA 3HY7A 3F1AA 4WKEA 2W13A 4Q1LA 3OHOA 3DSLA 3EDGA 1JH1A 3F17A 4XM7A 4AXQA 3LMCA 3ZUKA 3K7LA 1UTTA 4EFSA 1KUKA 4HMAA 2DDYA 456CA 5H8XA 1CXVA 1FLSA 5I4OA 2OXWA 1SATA 3AYUA 1WNIA 2TCLA 1S4BP 4GWMA 2Z2DA 1JJ9A 3LIRA 1MMBA 1IADA 3I7GA 4A7BA 2JNPA 1SRPA 4I03A 1BM6A 1G49A 1I73A 3G5CA 2W15A 4L63A 3RTTA 2O36A 5I2ZA 2X3AA 4WKIA 1GO8P 2YUFA 1AKLA 4JPAA 4JQGA 2OVXA 1DTHA 2N8RA 4IUWA 2USNA 2ERPA 5L79A 4L6TA 1HTDA 2JT5A 1JKYA 1QUAA 2OW1A 4PKQA 3LJTA 3K7NA 4R3VA 1XFWA 3BA0A 3LE9A 5D1SA 4GWNA 3RTSA 1RMZA 3TT4A 4AUOA 1CQRA 4FU4A 1BUDA 1YCMA 3DPEA 2JSDA 3ELMA 4L19A 1YOUA 4J4MA 3B8ZA 3WV2A 1EAKA 1BQQM 1AF0A 3F15A 2J0TA 3LJZA 1A85A 2Y6CA 3LQ0A 1QICA 4A3WA 4L7AA 2X3BA 1ZTQA 3GBOA 4XM6A 1KAPP 1K7QA 2POJA 3G42A 2J83A 1CGFA 1HFSA 3LKAA 3DL1A 3DTIA 1OO9A 4GR8A 2MZIA 2DDFA 2KRJA 1CGEA 3DNGA 1PWQA 1JAQA 3KEKA 3HDAP 4H82A 3LUMA 4FXQA 1AYKA 4H3XA 1ZXCA 3LQBA 2XS3A 1OS2A 2MLSA 2OY4A 3O64A 3AYKA 1FBLA 3TSKA 1QJJA 4AYKA 1UMTA 4JIJA 1MNCA 1HOVA 2D1OA 2RJPA 2W0DA 1PWWA 4WK7A 1EUBA 3TS4A 4H1QA 3KHIA 1C3IA 2E2DA 2QPJA 3V96B 1HFCA 1XFZA 3NX7A 1UEAA 5B5OA 4XCTA 1XFYA 1XURA 2K2GA 2RJQA 3B92A 2SRTA 3HBUP 1GKDA 2OY2A 1R1HA 1J7NA 1XUDA 2D1NA 5D3CA 3EDHA 1GKCA 3L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLR A;  4PKV A;  1MMQ A;  1Z3J A;  3MA2 A;  1CAQ A;  2CLT A;  5I0L A;  4HX3 A;  3WV1 A;  3E8R A;  5BOY A;  3UVC A;  4I35 A;  2ERQ A;  3SHI A;  2FV5 A;  1OMJ A;  1GXD A;  3I7I A;  1O0Q A;  1SMP A;  4H30 A;  1CIZ A;  4JA1 A;  1UTZ A;  3EHX A;  1DMT A;  5BPA A;  2OXU A;  3LK8 A;  5D1U A;  3L0V A;  4DF9 A;  5D2B A;  1AST A;  1R54 A;  1BIW A;  4PKW A;  2I47 A;  1MMP A;  1OM6 A;  1IAE A;  1QIB A;  3WV3 A;  1JIZ A;  3VI1 A;  1RM8 A;  4DD8 A;  3KRY A;  1IAA A;  3TVC A;  4PKS A;  1BSW A;  1A86 A;  1YP1 A;  5D1T A;  4H2E A;  4H84 A;  1PWP A;  1XFU A;  2V4B A;  4IN9 A;  1Y0V A;  1QIA A;  3EHY A;  1Y93 A;  1JAN A;  3EDZ A;  1Y8J A;  3ZVS A;  2DW2 A;  2XS4 A;  1JK3 A;  5BOT A;  2OW2 A;  1JAP A;  3HY9 A;  3LUN A;  4XM8 A;  3DPF A;  1BKC E;  1FM1 A;  1ZP5 A;  4AIG A;  3LJG A;  4PKU A;  1GO7 P;  2OW9 A;  2AYK A;  3U1R A;  1O0T A;  4PKT A;  2WOA A;  1KUH A;  2JT6 A;  3CKI A;  3HBV P;  1G12 A;  2DW1 A;  5CZM A;  1ZS0 A;  1C8T A;  4ILW D;  1K7G A;  4XBH A;  5D7W A;  3DWB A;  4PKR A;  830C A;  3KEC A;  2CKI A;  2PJT A;  2OZR A;  1G4K A;  5LAB A;  4FXY P;  2MZH A;  3N2V A;  1KBC A;  1XFX A;  3LEA A;  4GQL A;  4WZV A;  3USN A;  966C A;  5I3M A;  3HYG A;  5CXA A;  2YB9 A;  3HDB A;  2ERO A;  3KME A;  3F16 A;  1C7K A;  1KUG A;  1OM8 A;  1USN A;  1JIW P;  5L7F A;  1CK7 A;  4CTH A;  2X3C A;  1ZXV A;  1L6J A;  1D5J A;  4GR0 A;  4GR3 A;  2K9C A;  2YIG A;  4DPE A;  4GUY A;  1K7I A;  1B8Y A;  2W12 A;  5I12 A;  3F19 A;  2JIH A;  2WO9 A;  2FV9 A;  1MMR A;  2O3E A;  1D8F A;  1D8M A;  1JAO A;  1YQY A;  2A8H A;  3KWV C;  1OS9 A;  1QJI A;  1BQO A;  3P1V A;  1BKC I;  1IAG A;  4FVL A;  1B3D A;  1ZVX A;  1BZS A;  1SLN A;  2OI0 A;  3O2X A;  1R1J A;  3EDI A;  2MZE A;  1ROS A;  1HY7 A;  1G9K A;  1D7X A;  3KEJ A;  5B5P A;  1GE7 A;  4GF1 A;  1SU3 A;  1Q3A A;  3F18 A;  1PWV A;  1BKC A;  1R1I A;  3LIL A;  2OW0 A;  1GE6 A;  1CGL A;  4WF6 A;  4G0D A;  3P24 A;  3ZXH A;  1XUC A;  2OXZ A;  4ON1 A;  4H49 A;  2DW0 A;  1I1I P;  3KMC A;  1R55 A;  4QKZ A;  3B2Z A;  1EB6 A;  1G05 A;  3LGP A;  2Y6D A;  1KUI A;  2AIG P;  4H76 A;  1H71 P;  3OHL A;  1UMS A;  1KUF A;  1HV5 A;  2X7M A;  3Q2H A;  1ND1 A;  5CUH A;  1IAB A;  1GE5 A;  1I76 A;  5I43 A;  3AIG A;  3N2U A;  4G9L A;  1IAC A;  1OM7 A;  1SLM A;  3VTG A;  1XFV A;  2L0R A;  2OVZ A;  4DV8 A;  1ATL A;  2E3X A;  3LIK A;  4ZR5 A;  2W14 A;  3Q2G A;  1PWU A;  2HU6 A;  4IJO A;  1BUV M;  3HB2 P;  2WO8 A;  3EWJ A;  4JP4 A;  5JMY A;  3HY7 A;  3F1A A;  4WKE A;  2W13 A;  4Q1L A;  3OHO A;  3DSL A;  3EDG A;  1JH1 A;  3F17 A;  4XM7 A;  4AXQ A;  3LMC A;  3ZUK A;  3K7L A;  1UTT A;  4EFS A;  1KUK A;  4HMA A;  2DDY A;  456C A;  5H8X A;  1CXV A;  1FLS A;  5I4O A;  2OXW A;  1SAT A;  3AYU A;  1WNI A;  2TCL A;  1S4B P;  4GWM A;  2Z2D A;  1JJ9 A;  3LIR A;  1MMB A;  1IAD A;  3I7G A;  4A7B A;  2JNP A;  1SRP A;  4I03 A;  1BM6 A;  1G49 A;  1I73 A;  3G5C A;  2W15 A;  4L63 A;  3RTT A;  2O36 A;  5I2Z A;  2X3A A;  4WKI A;  1GO8 P;  1AKL A;  4JPA A;  4JQG A;  2OVX A;  1DTH A;  2N8R A;  4IUW A;  2USN A;  2ERP A;  5L79 A;  4L6T A;  1HTD A;  2JT5 A;  1JKY A;  1QUA A;  2OW1 A;  4PKQ A;  3LJT A;  3K7N A;  4R3V A;  1XFW A;  3BA0 A;  3LE9 A;  5D1S A;  4GWN A;  3RTS A;  1RMZ A;  3TT4 A;  4AUO A;  1CQR A;  4FU4 A;  1BUD A;  1YCM A;  3DPE A;  2JSD A;  3ELM A;  4L19 A;  1YOU A;  4J4M A;  3B8Z A;  3WV2 A;  1EAK A;  1BQQ M;  1AF0 A;  3F15 A;  2J0T A;  3LJZ A;  1A85 A;  2Y6C A;  3LQ0 A;  1QIC A;  4A3W A;  2X3B A;  1ZTQ A;  3GBO A;  4XM6 A;  1KAP P;  1K7Q A;  2POJ A;  3G42 A;  2J83 A;  1CGF A;  1HFS A;  3LKA A;  3DL1 A;  1OO9 A;  4GR8 A;  2MZI A;  2DDF A;  2KRJ A;  1CGE A;  3DNG A;  1PWQ A;  1JAQ A;  3KEK A;  3HDA P;  4H82 A;  3LUM A;  4FXQ A;  1AYK A;  4H3X A;  1ZXC A;  3LQB A;  2XS3 A;  1OS2 A;  2MLS A;  2OY4 A;  3O64 A;  3AYK A;  1FBL A;  3TSK A;  1QJJ A;  4AYK A;  1UMT A;  4JIJ A;  1MNC A;  1HOV A;  2D1O A;  2RJP A;  2W0D A;  1PWW A;  4WK7 A;  1EUB A;  3TS4 A;  4H1Q A;  3KHI A;  1C3I A;  2E2D A;  2QPJ A;  3V96 B;  1HFC A;  1XFZ A;  3NX7 A;  1UEA A;  5B5O A;  4XCT A;  1XFY A;  1XUR A;  2K2G A;  2RJQ A;  3B92 A;  2SRT A;  3HBU P;  1GKD A;  2OY2 A;  1R1H A;  1J7N A;  1XUD A;  2D1N A;  5D3C A;  3EDH A;  1GKC A;  3L0T A; 
#chains in the Genus database with same CATH topology
 2MLR A;  4PKV A;  1MMQ A;  1Z3J A;  3MA2 A;  1CAQ A;  2CLT A;  5I0L A;  4HX3 A;  3WV1 A;  3E8R A;  5BOY A;  3UVC A;  4I35 A;  2ERQ A;  3SHI A;  2FV5 A;  1OMJ A;  1GXD A;  3I7I A;  1O0Q A;  1SMP A;  4H30 A;  1CIZ A;  4JA1 A;  1UTZ A;  3EHX A;  1DMT A;  5BPA A;  2OXU A;  3LK8 A;  5D1U A;  3L0V A;  4DF9 A;  5D2B A;  1AST A;  1R54 A;  1BIW A;  4PKW A;  2I47 A;  1MMP A;  1OM6 A;  1IAE A;  1QIB A;  3WV3 A;  1JIZ A;  3VI1 A;  1RM8 A;  4DD8 A;  3KRY A;  1IAA A;  3TVC A;  4PKS A;  1BSW A;  1A86 A;  1XM5 A;  1YP1 A;  5D1T A;  4H2E A;  4H84 A;  1PWP A;  1XFU A;  2V4B A;  4IN9 A;  1Y0V A;  1QIA A;  3EHY A;  1Y93 A;  1JAN A;  3EDZ A;  1Y8J A;  3ZVS A;  2DW2 A;  2XS4 A;  1JK3 A;  5BOT A;  2OW2 A;  1JAP A;  3HY9 A;  3LUN A;  4XM8 A;  3DPF A;  1BKC E;  1FM1 A;  1ZP5 A;  4AIG A;  3LJG A;  4PKU A;  1GO7 P;  2OW9 A;  2AYK A;  3U1R A;  1O0T A;  4PKT A;  2WOA A;  1KUH A;  2JT6 A;  3CKI A;  3HBV P;  1G12 A;  2DW1 A;  5CZM A;  1ZS0 A;  1C8T A;  4ILW D;  1K7G A;  4XBH A;  5D7W A;  3DWB A;  4PKR A;  830C A;  3KEC A;  2CKI A;  2PJT A;  2OZR A;  1G4K A;  5LAB A;  4FXY P;  2MZH A;  3N2V A;  1KBC A;  1XFX A;  3LEA A;  4GQL A;  4WZV A;  3USN A;  966C A;  5I3M A;  3HYG A;  5CXA A;  2YB9 A;  3HDB A;  2ERO A;  3KME A;  3F16 A;  1C7K A;  1KUG A;  1OM8 A;  1USN A;  1JIW P;  5L7F A;  1CK7 A;  4CTH A;  2X3C A;  1ZXV A;  1L6J A;  1D5J A;  4GR0 A;  4GR3 A;  2K9C A;  2YIG A;  4DPE A;  4GUY A;  1K7I A;  1B8Y A;  2W12 A;  5I12 A;  3F19 A;  2JIH A;  2WO9 A;  2FV9 A;  1MMR A;  2O3E A;  1D8F A;  1D8M A;  1JAO A;  1YQY A;  2A8H A;  3KWV C;  1OS9 A;  1QJI A;  1BQO A;  3P1V A;  1BKC I;  1IAG A;  3DTK A;  4FVL A;  1B3D A;  1ZVX A;  1BZS A;  1SLN A;  2OI0 A;  3O2X A;  1R1J A;  3EDI A;  2MZE A;  1ROS A;  1HY7 A;  1G9K A;  1D7X A;  3KEJ A;  5B5P A;  1GE7 A;  4GF1 A;  1SU3 A;  1Q3A A;  3F18 A;  1PWV A;  1BKC A;  1R1I A;  3LIL A;  2OW0 A;  1GE6 A;  1CGL A;  4WF6 A;  4G0D A;  3P24 A;  3ZXH A;  1XUC A;  2OXZ A;  4ON1 A;  4H49 A;  2DW0 A;  1I1I P;  3DTE A;  3KMC A;  1R55 A;  4QKZ A;  3B2Z A;  1EB6 A;  1G05 A;  3LGP A;  2Y6D A;  1KUI A;  2AIG P;  4H76 A;  1H71 P;  3OHL A;  1UMS A;  1KUF A;  1HV5 A;  2X7M A;  3Q2H A;  1ND1 A;  1XAX A;  5CUH A;  1IAB A;  1GE5 A;  1I76 A;  5I43 A;  3AIG A;  3N2U A;  4G9L A;  1IAC A;  1OM7 A;  1SLM A;  3VTG A;  1XFV A;  2L0R A;  2OVZ A;  4DV8 A;  1ATL A;  2E3X A;  3LIK A;  4ZR5 A;  2W14 A;  3Q2G A;  1PWU A;  2HU6 A;  4IJO A;  1BUV M;  3HB2 P;  2WO8 A;  3EWJ A;  4JP4 A;  5JMY A;  3HY7 A;  3F1A A;  4WKE A;  2W13 A;  4Q1L A;  3OHO A;  3DSL A;  3EDG A;  1JH1 A;  3F17 A;  4XM7 A;  4AXQ A;  3LMC A;  3ZUK A;  3K7L A;  1UTT A;  4EFS A;  1KUK A;  4HMA A;  2DDY A;  456C A;  5H8X A;  1CXV A;  1FLS A;  5I4O A;  2OXW A;  1SAT A;  3AYU A;  1WNI A;  2TCL A;  1TVI A;  1S4B P;  4GWM A;  2Z2D A;  1JJ9 A;  3LIR A;  1MMB A;  1IAD A;  3I7G A;  4A7B A;  2JNP A;  1SRP A;  4I03 A;  1BM6 A;  1G49 A;  1I73 A;  3G5C A;  2W15 A;  4L63 A;  3RTT A;  2O36 A;  5I2Z A;  2X3A A;  4WKI A;  1GO8 P;  2YUF A;  1AKL A;  4JPA A;  1OZ9 A;  4JQG A;  2OVX A;  1DTH A;  2N8R A;  4IUW A;  2USN A;  2ERP A;  5L79 A;  4L6T A;  1HTD A;  2JT5 A;  1JKY A;  1QUA A;  2OW1 A;  4PKQ A;  3LJT A;  3K7N A;  4R3V A;  1XFW A;  3BA0 A;  3LE9 A;  5D1S A;  4GWN A;  3RTS A;  1RMZ A;  3TT4 A;  4AUO A;  1CQR A;  4FU4 A;  1BUD A;  1YCM A;  3DPE A;  2JSD A;  3ELM A;  4L19 A;  1YOU A;  4J4M A;  3B8Z A;  3WV2 A;  1EAK A;  1BQQ M;  1AF0 A;  3F15 A;  2J0T A;  3LJZ A;  1A85 A;  2Y6C A;  3LQ0 A;  1QIC A;  4A3W A;  4L7A A;  2X3B A;  1ZTQ A;  3GBO A;  4XM6 A;  1KAP P;  1K7Q A;  2POJ A;  3G42 A;  2J83 A;  1CGF A;  1HFS A;  3LKA A;  3DL1 A;  3DTI A;  1OO9 A;  4GR8 A;  2MZI A;  2DDF A;  2KRJ A;  1CGE A;  3DNG A;  1PWQ A;  1JAQ A;  3KEK A;  3HDA P;  4H82 A;  3LUM A;  4FXQ A;  1AYK A;  4H3X A;  1ZXC A;  3LQB A;  2XS3 A;  1OS2 A;  2MLS A;  2OY4 A;  3O64 A;  3AYK A;  1FBL A;  3TSK A;  1QJJ A;  4AYK A;  1UMT A;  4JIJ A;  1MNC A;  1HOV A;  2D1O A;  2RJP A;  2W0D A;  1PWW A;  4WK7 A;  1EUB A;  3TS4 A;  4H1Q A;  3KHI A;  1C3I A;  2E2D A;  2QPJ A;  3V96 B;  1HFC A;  1XFZ A;  3NX7 A;  1UEA A;  5B5O A;  4XCT A;  1XFY A;  1XUR A;  2K2G A;  2RJQ A;  3B92 A;  2SRT A;  3HBU P;  1GKD A;  2OY2 A;  1R1H A;  1J7N A;  1XUD A;  2D1N A;  5D3C A;  3EDH A;  1GKC A;  3L0T A; 
#chains in the Genus database with same CATH homology
 2MLR A;  4PKV A;  1MMQ A;  1Z3J A;  3MA2 A;  1CAQ A;  2CLT A;  5I0L A;  4HX3 A;  3WV1 A;  3E8R A;  5BOY A;  3UVC A;  4I35 A;  2ERQ A;  3SHI A;  2FV5 A;  1OMJ A;  1GXD A;  3I7I A;  1O0Q A;  1SMP A;  4H30 A;  1CIZ A;  4JA1 A;  1UTZ A;  3EHX A;  1DMT A;  5BPA A;  2OXU A;  3LK8 A;  5D1U A;  3L0V A;  4DF9 A;  5D2B A;  1AST A;  1R54 A;  1BIW A;  4PKW A;  2I47 A;  1MMP A;  1OM6 A;  1IAE A;  1QIB A;  3WV3 A;  1JIZ A;  3VI1 A;  1RM8 A;  4DD8 A;  3KRY A;  1IAA A;  3TVC A;  4PKS A;  1BSW A;  1A86 A;  1YP1 A;  5D1T A;  4H2E A;  4H84 A;  1PWP A;  1XFU A;  2V4B A;  4IN9 A;  1Y0V A;  1QIA A;  3EHY A;  1Y93 A;  1JAN A;  3EDZ A;  1Y8J A;  3ZVS A;  2DW2 A;  2XS4 A;  1JK3 A;  5BOT A;  2OW2 A;  1JAP A;  3HY9 A;  3LUN A;  4XM8 A;  3DPF A;  1BKC E;  1FM1 A;  1ZP5 A;  4AIG A;  3LJG A;  4PKU A;  1GO7 P;  2OW9 A;  2AYK A;  3U1R A;  1O0T A;  4PKT A;  2WOA A;  1KUH A;  2JT6 A;  3CKI A;  3HBV P;  1G12 A;  2DW1 A;  5CZM A;  1ZS0 A;  1C8T A;  4ILW D;  1K7G A;  4XBH A;  5D7W A;  3DWB A;  4PKR A;  830C A;  3KEC A;  2CKI A;  2PJT A;  2OZR A;  1G4K A;  5LAB A;  4FXY P;  2MZH A;  3N2V A;  1KBC A;  1XFX A;  3LEA A;  4GQL A;  4WZV A;  3USN A;  966C A;  5I3M A;  3HYG A;  5CXA A;  2YB9 A;  3HDB A;  2ERO A;  3KME A;  3F16 A;  1C7K A;  1KUG A;  1OM8 A;  1USN A;  1JIW P;  5L7F A;  1CK7 A;  4CTH A;  2X3C A;  1ZXV A;  1L6J A;  1D5J A;  4GR0 A;  4GR3 A;  2K9C A;  2YIG A;  4DPE A;  4GUY A;  1K7I A;  1B8Y A;  2W12 A;  5I12 A;  3F19 A;  2JIH A;  2WO9 A;  2FV9 A;  1MMR A;  2O3E A;  1D8F A;  1D8M A;  1JAO A;  1YQY A;  2A8H A;  3KWV C;  1OS9 A;  1QJI A;  1BQO A;  3P1V A;  1BKC I;  1IAG A;  3DTK A;  4FVL A;  1B3D A;  1ZVX A;  1BZS A;  1SLN A;  2OI0 A;  3O2X A;  1R1J A;  3EDI A;  2MZE A;  1ROS A;  1HY7 A;  1G9K A;  1D7X A;  3KEJ A;  5B5P A;  1GE7 A;  4GF1 A;  1SU3 A;  1Q3A A;  3F18 A;  1PWV A;  1BKC A;  1R1I A;  3LIL A;  2OW0 A;  1GE6 A;  1CGL A;  4WF6 A;  4G0D A;  3P24 A;  3ZXH A;  1XUC A;  2OXZ A;  4ON1 A;  4H49 A;  2DW0 A;  1I1I P;  3DTE A;  3KMC A;  1R55 A;  4QKZ A;  3B2Z A;  1EB6 A;  1G05 A;  3LGP A;  2Y6D A;  1KUI A;  2AIG P;  4H76 A;  1H71 P;  3OHL A;  1UMS A;  1KUF A;  1HV5 A;  2X7M A;  3Q2H A;  1ND1 A;  5CUH A;  1IAB A;  1GE5 A;  1I76 A;  5I43 A;  3AIG A;  3N2U A;  4G9L A;  1IAC A;  1OM7 A;  1SLM A;  3VTG A;  1XFV A;  2L0R A;  2OVZ A;  4DV8 A;  1ATL A;  2E3X A;  3LIK A;  4ZR5 A;  2W14 A;  3Q2G A;  1PWU A;  2HU6 A;  4IJO A;  1BUV M;  3HB2 P;  2WO8 A;  3EWJ A;  4JP4 A;  5JMY A;  3HY7 A;  3F1A A;  4WKE A;  2W13 A;  4Q1L A;  3OHO A;  3DSL A;  3EDG A;  1JH1 A;  3F17 A;  4XM7 A;  4AXQ A;  3LMC A;  3ZUK A;  3K7L A;  1UTT A;  4EFS A;  1KUK A;  4HMA A;  2DDY A;  456C A;  5H8X A;  1CXV A;  1FLS A;  5I4O A;  2OXW A;  1SAT A;  3AYU A;  1WNI A;  2TCL A;  1S4B P;  4GWM A;  2Z2D A;  1JJ9 A;  3LIR A;  1MMB A;  1IAD A;  3I7G A;  4A7B A;  2JNP A;  1SRP A;  4I03 A;  1BM6 A;  1G49 A;  1I73 A;  3G5C A;  2W15 A;  4L63 A;  3RTT A;  2O36 A;  5I2Z A;  2X3A A;  4WKI A;  1GO8 P;  2YUF A;  1AKL A;  4JPA A;  4JQG A;  2OVX A;  1DTH A;  2N8R A;  4IUW A;  2USN A;  2ERP A;  5L79 A;  4L6T A;  1HTD A;  2JT5 A;  1JKY A;  1QUA A;  2OW1 A;  4PKQ A;  3LJT A;  3K7N A;  4R3V A;  1XFW A;  3BA0 A;  3LE9 A;  5D1S A;  4GWN A;  3RTS A;  1RMZ A;  3TT4 A;  4AUO A;  1CQR A;  4FU4 A;  1BUD A;  1YCM A;  3DPE A;  2JSD A;  3ELM A;  4L19 A;  1YOU A;  4J4M A;  3B8Z A;  3WV2 A;  1EAK A;  1BQQ M;  1AF0 A;  3F15 A;  2J0T A;  3LJZ A;  1A85 A;  2Y6C A;  3LQ0 A;  1QIC A;  4A3W A;  4L7A A;  2X3B A;  1ZTQ A;  3GBO A;  4XM6 A;  1KAP P;  1K7Q A;  2POJ A;  3G42 A;  2J83 A;  1CGF A;  1HFS A;  3LKA A;  3DL1 A;  3DTI A;  1OO9 A;  4GR8 A;  2MZI A;  2DDF A;  2KRJ A;  1CGE A;  3DNG A;  1PWQ A;  1JAQ A;  3KEK A;  3HDA P;  4H82 A;  3LUM A;  4FXQ A;  1AYK A;  4H3X A;  1ZXC A;  3LQB A;  2XS3 A;  1OS2 A;  2MLS A;  2OY4 A;  3O64 A;  3AYK A;  1FBL A;  3TSK A;  1QJJ A;  4AYK A;  1UMT A;  4JIJ A;  1MNC A;  1HOV A;  2D1O A;  2RJP A;  2W0D A;  1PWW A;  4WK7 A;  1EUB A;  3TS4 A;  4H1Q A;  3KHI A;  1C3I A;  2E2D A;  2QPJ A;  3V96 B;  1HFC A;  1XFZ A;  3NX7 A;  1UEA A;  5B5O A;  4XCT A;  1XFY A;  1XUR A;  2K2G A;  2RJQ A;  3B92 A;  2SRT A;  3HBU P;  1GKD A;  2OY2 A;  1R1H A;  1J7N A;  1XUD A;  2D1N A;  5D3C A;  3EDH A;  1GKC A;  3L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...