2JT6A

Solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of 3-4'-cyanobyphenyl-4-yloxy)-n-hdydroxypropionamide (mmp-3 inhibitor vii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
GIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Stromelysin-1
publication title Matrix metalloproteinase-inhibitor interaction: the solution structure of the catalytic domain of human matrix metalloproteinase-3 with different inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 161
sequence length 161
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2jt6A00
1L6JA 2ERPA 1HTDA 2Y6CA 3P24A 4AIGA 4HMAA 3Q2GA 2OVZA 2V4BA 4GF1A 3ZXHA 3K7NA 4H3XA 3AIGA 1UMSA 2W0DA 4WF6A 1UMTA 4J4MA 1SLMA 1KUGA 2YIGA 1D8FA 2W12A 1PWWA 3HBVP 2X7MA 4PKQA 2W13A 1GKCA 2OY2A 4H49A 2QPJA 2WOAA 1C3IA 2E3XA 4GR0A 3DPEA 3KMCA 4L63A 4PKRA 1CK7A 1AYKA 1IADA 1XFUA 4WK7A 2J0TA 1GE5A 3GBOA 1OM6A 4PKVA 3KHIA 4AYKA 3LIRA 3N2UA 5D3CA 4PKSA 456CA 1EUBA 1HY7A 1MNCA 3KEKA 3LIKA 4FXYP 5L79A 4JA1A 2OY4A 1JANA 1R1JA 4I03A 1XFVA 3F17A 4WKIA 1HFSA 4EFSA 2CLTA 3V96B 1QUAA 2MLRA 4IUWA 1XUCA 1I1IP 1OS2A 3CKIA 1Y0VA 3LJGA 3O2XA 1PWUA 4PKTA 2ERQA 1ATLA 3EDZA 4WKEA 1O0TA 1ROSA 3KEJA 3U1RA 4GWNA 2SRTA 4H1QA 1J7NA 2DDYA 1SLNA 3HYGA 3LUMA 1B8YA 1CXVA 1HV5A 4PKUA 1B3DA 1ZS0A 2JSDA 1XFYA 1BKCA 1MMRA 1A85A 4DF9A 3RTSA 3TT4A 2HU6A 2FV9A 3DWBA 4ON1A 1JKYA 4JPAA 2CKIA 3F19A 2JNPA 1CGEA 1D8MA 1ND1A 5CUHA 5L7FA 3O64A 3LJZA 1Z3JA 2PJTA 5I3MA 2JIHA 1HFCA 1ASTA 4ZR5A 4FXQA 3TS4A 4DD8A 1D5JA 3KRYA 1PWVA 1K7QA 830CA 1RM8A 4G0DA 1KUFA 3I7IA 4CTHA 2Z2DA 1JIZA 4R3VA 3F16A 1I73A 2YB9A 5CZMA 1IAAA 3LEAA 4I35A 1S4BP 2MLSA 1YOUA 3LILA 1QIBA 2J83A 1MMBA 2MZIA 5I12A 1MMPA 2FV5A 2W15A 5D1SA 1BM6A 1GXDA 3E8RA 4H2EA 1WNIA 1BQOA 3AYUA 2N8RA 1BUDA 1BIWA 3WV2A 3DPFA 2AYKA 5D1TA 1CQRA 1XFWA 1CGFA 2K2GA 2OXWA 2O3EA 3WV3A 1QJJA 4GQLA 4JIJA 4QKZA 1CGLA 3KWVC 2D1OA 1FM1A 2DW0A 3Q2HA 5BPAA 3K7LA 4L6TA 3VTGA 1XURA 4GWMA 1EB6A 4GUYA 3EDIA 3LE9A 1H71P 2EROA 4H82A 4AUOA 1PWPA 5CXAA 3EWJA 1JAQA 1ZXCA 5JMYA 3B92A 1DMTA 3VI1A 1IAGA 3TSKA 1XFXA 1IAEA 3LQ0A 3L0VA 5BOYA 5LABA 4XM6A 5B5OA 2MZHA 1OM8A 3LJTA 1GE7A 5D2BA 5B5PA 3LKAA 3B2ZA 5H8XA 1JH1A 3EDHA 3RTTA 1G4KA 1SU3A 1QJIA 1JAOA 2KRJA 2Y6DA 3F15A 3OHOA 2OXUA 4GR3A 2JT6A 1IABA 1G49A 4Q1LA 1SRPA 1FLSA 1C7KA 1CIZA 1JJ9A 1UTTA 3EDGA 2OVXA 3EHYA 1R54A 1KUHA 1BUVM 1PWQA 4A3WA 3TVCA 2XS4A 3KMEA 4JQGA 3USNA 4IN9A 2W14A 4XCTA 5I0LA 4L19A 3HB2P 2RJPA 3NX7A 1ZVXA 3HDAP 3HDBA 2OXZA 1GE6A 1UTZA 1XFZA 4IJOA 1QICA 1OS9A 2X3AA 3G5CA 966CA 1OO9A 1G12A 1GO7P 4DPEA 1R55A 1BSWA 1CAQA 3HBUP 5I43A 2DW1A 3WV1A 1G9KA 4XBHA 3F18A 4FU4A 1XUDA 1AKLA 3LGPA 4WZVA 3DNGA 1BKCE 1JAPA 2JT5A 5D7WA 1R1HA 3DSLA 2XS3A 3BA0A 3LUNA 1SATA 1JK3A 2I47A 3MA2A 1ZXVA 3AYKA 3HY9A 1OMJA 3I7GA 2RJQA 4H76A 1K7IA 1KAPP 4XM8A 3ELMA 4G9LA 4GR8A 1A86A 1DTHA 1KUKA 1SMPA 2A8HA 1Q3AA 5D1UA 2OW1A 1RMZA 2OW9A 2X3BA 3HY7A 1GKDA 2K9CA 1KUIA 4AXQA 3LK8A 2USNA 1O0QA 2POJA 1YQYA 4DV8A 2TCLA 2D1NA 2E2DA 1EAKA 4A7BA 1ZP5A 2DW2A 3DL1A 3ZVSA 1Y93A 1IACA 2OW0A 1K7GA 5I4OA 1GO8P 3B8ZA 1BKCI 3F1AA 3KECA 1HOVA 1YP1A 3G42A 2DDFA 2OW2A 4XM7A 3UVCA 2L0RA 2OI0A 2O36A 4H30A 5I2ZA 1MMQA 3SHIA 1R1IA 1BZSA 1Y8JA 1I76A 4ILWD 1OM7A 1FBLA 1KBCA 4H84A 1AF0A 1UEAA 3LQBA 1QIAA 4JP4A 2OZRA 1YCMA 3L0TA 1JIWP 3EHXA 5BOTA 3N2VA 2MZEA 2WO9A 2WO8A 1C8TA 4FVLA 3LMCA 2X3CA 4HX3A 2AIGP 1D7XA 1BQQM 1ZTQA 3ZUKA 3P1VA 1USNA 4PKWA 1G05A 3OHLA
chains in the Genus database with same CATH superfamily
1L6JA 2ERPA 1HTDA 2Y6CA 3P24A 4AIGA 4HMAA 3Q2GA 2OVZA 2V4BA 4GF1A 3ZXHA 3K7NA 4H3XA 3AIGA 1UMSA 2W0DA 4WF6A 1UMTA 4J4MA 1SLMA 1KUGA 2YIGA 1D8FA 2W12A 1PWWA 3HBVP 2X7MA 4PKQA 2W13A 1GKCA 2OY2A 4H49A 2QPJA 2WOAA 1C3IA 1OZ9A 2E3XA 4GR0A 3DPEA 3KMCA 4L63A 4PKRA 1CK7A 1AYKA 1IADA 1XFUA 4WK7A 2J0TA 1GE5A 3GBOA 1OM6A 4PKVA 3KHIA 4AYKA 3LIRA 3N2UA 5D3CA 4PKSA 456CA 1EUBA 1HY7A 1MNCA 3KEKA 3LIKA 4FXYP 5L79A 4JA1A 2OY4A 1JANA 1R1JA 4I03A 1XFVA 3F17A 4WKIA 1HFSA 4EFSA 2CLTA 3V96B 1QUAA 2MLRA 4IUWA 1XUCA 1I1IP 1OS2A 3CKIA 1Y0VA 3LJGA 3O2XA 1PWUA 4PKTA 2ERQA 1ATLA 3EDZA 4WKEA 1O0TA 1ROSA 3KEJA 3U1RA 4GWNA 2SRTA 4H1QA 1J7NA 2DDYA 1SLNA 3HYGA 3LUMA 1B8YA 1CXVA 1HV5A 4PKUA 1B3DA 1ZS0A 2JSDA 1XFYA 1BKCA 1MMRA 1A85A 4DF9A 3RTSA 3TT4A 2HU6A 2FV9A 3DWBA 4ON1A 1JKYA 4JPAA 2CKIA 3F19A 2JNPA 1CGEA 1D8MA 1ND1A 5CUHA 5L7FA 3O64A 3LJZA 1Z3JA 2PJTA 5I3MA 2JIHA 1HFCA 1ASTA 4ZR5A 4FXQA 3TS4A 4DD8A 1D5JA 3DTKA 3KRYA 1PWVA 1K7QA 830CA 1RM8A 4G0DA 1KUFA 3I7IA 4CTHA 2Z2DA 1JIZA 4R3VA 3F16A 1I73A 2YB9A 5CZMA 1IAAA 3LEAA 4I35A 1S4BP 2MLSA 1YOUA 3LILA 1QIBA 2J83A 1MMBA 2MZIA 5I12A 1MMPA 2FV5A 2W15A 5D1SA 1BM6A 1GXDA 3E8RA 4H2EA 1WNIA 1BQOA 3AYUA 2N8RA 1BUDA 1BIWA 3WV2A 3DPFA 2AYKA 5D1TA 3DTEA 1CQRA 1XFWA 1CGFA 2K2GA 2OXWA 1XAXA 2O3EA 3WV3A 1QJJA 4GQLA 4JIJA 4QKZA 1CGLA 3KWVC 2D1OA 1FM1A 2DW0A 3Q2HA 5BPAA 3K7LA 4L6TA 3VTGA 1XURA 4GWMA 1EB6A 4GUYA 3EDIA 3LE9A 1H71P 2EROA 4H82A 4AUOA 1PWPA 5CXAA 3EWJA 1JAQA 1ZXCA 5JMYA 3B92A 1DMTA 3VI1A 1IAGA 3TSKA 1XFXA 1IAEA 3LQ0A 3L0VA 5BOYA 1XM5A 5LABA 4XM6A 5B5OA 2MZHA 1OM8A 3LJTA 1GE7A 3DTIA 5D2BA 5B5PA 3LKAA 3B2ZA 5H8XA 1JH1A 3EDHA 3RTTA 1G4KA 1SU3A 1QJIA 1JAOA 2KRJA 2Y6DA 3F15A 3OHOA 2OXUA 4GR3A 2JT6A 1IABA 1G49A 4Q1LA 1SRPA 1FLSA 1C7KA 1CIZA 1JJ9A 1UTTA 3EDGA 2OVXA 3EHYA 1R54A 1KUHA 1BUVM 1PWQA 4A3WA 3TVCA 4L7AA 2XS4A 3KMEA 4JQGA 3USNA 4IN9A 2W14A 4XCTA 5I0LA 4L19A 3HB2P 2RJPA 3NX7A 1ZVXA 3HDAP 3HDBA 2OXZA 1GE6A 1UTZA 1XFZA 4IJOA 1QICA 1OS9A 2X3AA 3G5CA 966CA 1OO9A 1G12A 1GO7P 4DPEA 1R55A 1BSWA 1CAQA 3HBUP 5I43A 2DW1A 3WV1A 1G9KA 4XBHA 3F18A 4FU4A 1XUDA 1AKLA 3LGPA 4WZVA 3DNGA 1BKCE 1JAPA 2JT5A 5D7WA 1R1HA 3DSLA 2XS3A 3BA0A 3LUNA 1SATA 1JK3A 2I47A 3MA2A 1ZXVA 3AYKA 3HY9A 1OMJA 3I7GA 2RJQA 4H76A 1K7IA 1KAPP 4XM8A 3ELMA 4G9LA 4GR8A 1A86A 1DTHA 1KUKA 1SMPA 2A8HA 1Q3AA 5D1UA 2OW1A 1RMZA 2OW9A 2X3BA 3HY7A 1GKDA 2K9CA 1KUIA 4AXQA 3LK8A 2USNA 1O0QA 2POJA 1YQYA 4DV8A 2TCLA 2D1NA 2E2DA 1EAKA 4A7BA 1ZP5A 2DW2A 3DL1A 3ZVSA 1Y93A 1IACA 2OW0A 1K7GA 5I4OA 1GO8P 1TVIA 3B8ZA 1BKCI 3F1AA 3KECA 1HOVA 1YP1A 3G42A 2DDFA 2OW2A 4XM7A 3UVCA 2L0RA 2OI0A 2O36A 4H30A 5I2ZA 1MMQA 3SHIA 1R1IA 1BZSA 1Y8JA 1I76A 4ILWD 1OM7A 1FBLA 1KBCA 4H84A 1AF0A 1UEAA 3LQBA 1QIAA 4JP4A 2OZRA 1YCMA 3L0TA 1JIWP 3EHXA 5BOTA 3N2VA 2MZEA 2WO9A 2WO8A 1C8TA 4FVLA 3LMCA 2X3CA 4HX3A 2AIGP 1D7XA 1BQQM 1ZTQA 3ZUKA 3P1VA 1USNA 4PKWA 1G05A 3OHLA 2YUFA
chains in the Genus database with same CATH topology
1L6JA 2ERPA 1HTDA 2Y6CA 3P24A 4AIGA 4HMAA 3Q2GA 2OVZA 2V4BA 4GF1A 3ZXHA 3K7NA 4H3XA 3AIGA 1UMSA 2W0DA 4WF6A 1UMTA 4J4MA 1SLMA 1KUGA 2YIGA 1D8FA 2W12A 1PWWA 3HBVP 2X7MA 4PKQA 2W13A 1GKCA 2OY2A 4H49A 2QPJA 2WOAA 1C3IA 2E3XA 4GR0A 3DPEA 3KMCA 4L63A 4PKRA 1CK7A 1AYKA 1IADA 1XFUA 4WK7A 2J0TA 1GE5A 3GBOA 1OM6A 4PKVA 3KHIA 4AYKA 3LIRA 3N2UA 5D3CA 4PKSA 456CA 1EUBA 1HY7A 1MNCA 3KEKA 3LIKA 4FXYP 5L79A 4JA1A 2OY4A 1JANA 1R1JA 4I03A 1XFVA 3F17A 4WKIA 1HFSA 4EFSA 2CLTA 3V96B 1QUAA 2MLRA 4IUWA 1XUCA 1I1IP 1OS2A 3CKIA 1Y0VA 3LJGA 3O2XA 1PWUA 4PKTA 2ERQA 1ATLA 3EDZA 4WKEA 1O0TA 1ROSA 3KEJA 3U1RA 4GWNA 2SRTA 4H1QA 1J7NA 2DDYA 1SLNA 3HYGA 3LUMA 1B8YA 1CXVA 1HV5A 4PKUA 1B3DA 1ZS0A 2JSDA 1XFYA 1BKCA 1MMRA 1A85A 4DF9A 3RTSA 3TT4A 2HU6A 2FV9A 3DWBA 4ON1A 1JKYA 4JPAA 2CKIA 3F19A 2JNPA 1CGEA 1D8MA 1ND1A 5CUHA 5L7FA 3O64A 3LJZA 1Z3JA 2PJTA 5I3MA 2JIHA 1HFCA 1ASTA 4ZR5A 4FXQA 3TS4A 4DD8A 1D5JA 3DTKA 3KRYA 1PWVA 1K7QA 830CA 1RM8A 4G0DA 1KUFA 3I7IA 4CTHA 2Z2DA 1JIZA 4R3VA 3F16A 1I73A 2YB9A 5CZMA 1IAAA 3LEAA 4I35A 1S4BP 2MLSA 1YOUA 3LILA 1QIBA 2J83A 1MMBA 2MZIA 5I12A 1MMPA 2FV5A 2W15A 5D1SA 1BM6A 1GXDA 3E8RA 4H2EA 1WNIA 1BQOA 3AYUA 2N8RA 1BUDA 1BIWA 3WV2A 3DPFA 2AYKA 5D1TA 3DTEA 1CQRA 1XFWA 1CGFA 2K2GA 2OXWA 2O3EA 3WV3A 1QJJA 4GQLA 4JIJA 4QKZA 1CGLA 3KWVC 2D1OA 1FM1A 2DW0A 3Q2HA 5BPAA 3K7LA 4L6TA 3VTGA 1XURA 4GWMA 1EB6A 4GUYA 3EDIA 3LE9A 1H71P 2EROA 4H82A 4AUOA 1PWPA 5CXAA 3EWJA 1JAQA 1ZXCA 5JMYA 3B92A 1DMTA 3VI1A 1IAGA 3TSKA 1XFXA 1IAEA 3LQ0A 3L0VA 5BOYA 5LABA 4XM6A 5B5OA 2MZHA 1OM8A 3LJTA 1GE7A 3DTIA 5D2BA 5B5PA 3LKAA 3B2ZA 5H8XA 1JH1A 3EDHA 3RTTA 1G4KA 1SU3A 1QJIA 1JAOA 2KRJA 2Y6DA 3F15A 3OHOA 2OXUA 4GR3A 2JT6A 1IABA 1G49A 4Q1LA 1SRPA 1FLSA 1C7KA 1CIZA 1JJ9A 1UTTA 3EDGA 2OVXA 3EHYA 1R54A 1KUHA 1BUVM 1PWQA 4A3WA 3TVCA 4L7AA 2XS4A 3KMEA 4JQGA 3USNA 4IN9A 2W14A 4XCTA 5I0LA 4L19A 3HB2P 2RJPA 3NX7A 1ZVXA 3HDAP 3HDBA 2OXZA 1GE6A 1UTZA 1XFZA 4IJOA 1QICA 1OS9A 2X3AA 3G5CA 966CA 1OO9A 1G12A 1GO7P 4DPEA 1R55A 1BSWA 1CAQA 3HBUP 5I43A 2DW1A 3WV1A 1G9KA 4XBHA 3F18A 4FU4A 1XUDA 1AKLA 3LGPA 4WZVA 3DNGA 1BKCE 1JAPA 2JT5A 5D7WA 1R1HA 3DSLA 2XS3A 3BA0A 3LUNA 1SATA 1JK3A 2I47A 3MA2A 1ZXVA 3AYKA 3HY9A 1OMJA 3I7GA 2RJQA 4H76A 1K7IA 1KAPP 4XM8A 3ELMA 4G9LA 4GR8A 1A86A 1DTHA 1KUKA 1SMPA 2A8HA 1Q3AA 5D1UA 2OW1A 1RMZA 2OW9A 2X3BA 3HY7A 1GKDA 2K9CA 1KUIA 4AXQA 3LK8A 2USNA 1O0QA 2POJA 1YQYA 4DV8A 2TCLA 2D1NA 2E2DA 1EAKA 4A7BA 1ZP5A 2DW2A 3DL1A 3ZVSA 1Y93A 1IACA 2OW0A 1K7GA 5I4OA 1GO8P 3B8ZA 1BKCI 3F1AA 3KECA 1HOVA 1YP1A 3G42A 2DDFA 2OW2A 4XM7A 3UVCA 2L0RA 2OI0A 2O36A 4H30A 5I2ZA 1MMQA 3SHIA 1R1IA 1BZSA 1Y8JA 1I76A 4ILWD 1OM7A 1FBLA 1KBCA 4H84A 1AF0A 1UEAA 3LQBA 1QIAA 4JP4A 2OZRA 1YCMA 3L0TA 1JIWP 3EHXA 5BOTA 3N2VA 2MZEA 2WO9A 2WO8A 1C8TA 4FVLA 3LMCA 2X3CA 4HX3A 2AIGP 1D7XA 1BQQM 1ZTQA 3ZUKA 3P1VA 1USNA 4PKWA 1G05A 3OHLA 2YUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6J A;  2ERP A;  1HTD A;  2Y6C A;  3P24 A;  4AIG A;  4HMA A;  3Q2G A;  2OVZ A;  2V4B A;  4GF1 A;  3ZXH A;  3K7N A;  4H3X A;  3AIG A;  1UMS A;  2W0D A;  4WF6 A;  1UMT A;  4J4M A;  1SLM A;  1KUG A;  2YIG A;  1D8F A;  2W12 A;  1PWW A;  3HBV P;  2X7M A;  4PKQ A;  2W13 A;  1GKC A;  2OY2 A;  4H49 A;  2QPJ A;  2WOA A;  1C3I A;  2E3X A;  4GR0 A;  3DPE A;  3KMC A;  4L63 A;  4PKR A;  1CK7 A;  1AYK A;  1IAD A;  1XFU A;  4WK7 A;  2J0T A;  1GE5 A;  3GBO A;  1OM6 A;  4PKV A;  3KHI A;  4AYK A;  3LIR A;  3N2U A;  5D3C A;  4PKS A;  456C A;  1EUB A;  1HY7 A;  1MNC A;  3KEK A;  3LIK A;  4FXY P;  5L79 A;  4JA1 A;  2OY4 A;  1JAN A;  1R1J A;  4I03 A;  1XFV A;  3F17 A;  4WKI A;  1HFS A;  4EFS A;  2CLT A;  3V96 B;  1QUA A;  2MLR A;  4IUW A;  1XUC A;  1I1I P;  1OS2 A;  3CKI A;  1Y0V A;  3LJG A;  3O2X A;  1PWU A;  4PKT A;  2ERQ A;  1ATL A;  3EDZ A;  4WKE A;  1O0T A;  1ROS A;  3KEJ A;  3U1R A;  4GWN A;  2SRT A;  4H1Q A;  1J7N A;  2DDY A;  1SLN A;  3HYG A;  3LUM A;  1B8Y A;  1CXV A;  1HV5 A;  4PKU A;  1B3D A;  1ZS0 A;  2JSD A;  1XFY A;  1BKC A;  1MMR A;  1A85 A;  4DF9 A;  3RTS A;  3TT4 A;  2HU6 A;  2FV9 A;  3DWB A;  4ON1 A;  1JKY A;  4JPA A;  2CKI A;  3F19 A;  2JNP A;  1CGE A;  1D8M A;  1ND1 A;  5CUH A;  5L7F A;  3O64 A;  3LJZ A;  1Z3J A;  2PJT A;  5I3M A;  2JIH A;  1HFC A;  1AST A;  4ZR5 A;  4FXQ A;  3TS4 A;  4DD8 A;  1D5J A;  3KRY A;  1PWV A;  1K7Q A;  830C A;  1RM8 A;  4G0D A;  1KUF A;  3I7I A;  4CTH A;  2Z2D A;  1JIZ A;  4R3V A;  3F16 A;  1I73 A;  2YB9 A;  5CZM A;  1IAA A;  3LEA A;  4I35 A;  1S4B P;  2MLS A;  1YOU A;  3LIL A;  1QIB A;  2J83 A;  1MMB A;  2MZI A;  5I12 A;  1MMP A;  2FV5 A;  2W15 A;  5D1S A;  1BM6 A;  1GXD A;  3E8R A;  4H2E A;  1WNI A;  1BQO A;  3AYU A;  2N8R A;  1BUD A;  1BIW A;  3WV2 A;  3DPF A;  2AYK A;  5D1T A;  1CQR A;  1XFW A;  1CGF A;  2K2G A;  2OXW A;  2O3E A;  3WV3 A;  1QJJ A;  4GQL A;  4JIJ A;  4QKZ A;  1CGL A;  3KWV C;  2D1O A;  1FM1 A;  2DW0 A;  3Q2H A;  5BPA A;  3K7L A;  4L6T A;  3VTG A;  1XUR A;  4GWM A;  1EB6 A;  4GUY A;  3EDI A;  3LE9 A;  1H71 P;  2ERO A;  4H82 A;  4AUO A;  1PWP A;  5CXA A;  3EWJ A;  1JAQ A;  1ZXC A;  5JMY A;  3B92 A;  1DMT A;  3VI1 A;  1IAG A;  3TSK A;  1XFX A;  1IAE A;  3LQ0 A;  3L0V A;  5BOY A;  5LAB A;  4XM6 A;  5B5O A;  2MZH A;  1OM8 A;  3LJT A;  1GE7 A;  5D2B A;  5B5P A;  3LKA A;  3B2Z A;  5H8X A;  1JH1 A;  3EDH A;  3RTT A;  1G4K A;  1SU3 A;  1QJI A;  1JAO A;  2KRJ A;  2Y6D A;  3F15 A;  3OHO A;  2OXU A;  4GR3 A;  2JT6 A;  1IAB A;  1G49 A;  4Q1L A;  1SRP A;  1FLS A;  1C7K A;  1CIZ A;  1JJ9 A;  1UTT A;  3EDG A;  2OVX A;  3EHY A;  1R54 A;  1KUH A;  1BUV M;  1PWQ A;  4A3W A;  3TVC A;  2XS4 A;  3KME A;  4JQG A;  3USN A;  4IN9 A;  2W14 A;  4XCT A;  5I0L A;  4L19 A;  3HB2 P;  2RJP A;  3NX7 A;  1ZVX A;  3HDA P;  3HDB A;  2OXZ A;  1GE6 A;  1UTZ A;  1XFZ A;  4IJO A;  1QIC A;  1OS9 A;  2X3A A;  3G5C A;  966C A;  1OO9 A;  1G12 A;  1GO7 P;  4DPE A;  1R55 A;  1BSW A;  1CAQ A;  3HBU P;  5I43 A;  2DW1 A;  3WV1 A;  1G9K A;  4XBH A;  3F18 A;  4FU4 A;  1XUD A;  1AKL A;  3LGP A;  4WZV A;  3DNG A;  1BKC E;  1JAP A;  2JT5 A;  5D7W A;  1R1H A;  3DSL A;  2XS3 A;  3BA0 A;  3LUN A;  1SAT A;  1JK3 A;  2I47 A;  3MA2 A;  1ZXV A;  3AYK A;  3HY9 A;  1OMJ A;  3I7G A;  2RJQ A;  4H76 A;  1K7I A;  1KAP P;  4XM8 A;  3ELM A;  4G9L A;  4GR8 A;  1A86 A;  1DTH A;  1KUK A;  1SMP A;  2A8H A;  1Q3A A;  5D1U A;  2OW1 A;  1RMZ A;  2OW9 A;  2X3B A;  3HY7 A;  1GKD A;  2K9C A;  1KUI A;  4AXQ A;  3LK8 A;  2USN A;  1O0Q A;  2POJ A;  1YQY A;  4DV8 A;  2TCL A;  2D1N A;  2E2D A;  1EAK A;  4A7B A;  1ZP5 A;  2DW2 A;  3DL1 A;  3ZVS A;  1Y93 A;  1IAC A;  2OW0 A;  1K7G A;  5I4O A;  1GO8 P;  3B8Z A;  1BKC I;  3F1A A;  3KEC A;  1HOV A;  1YP1 A;  3G42 A;  2DDF A;  2OW2 A;  4XM7 A;  3UVC A;  2L0R A;  2OI0 A;  2O36 A;  4H30 A;  5I2Z A;  1MMQ A;  3SHI A;  1R1I A;  1BZS A;  1Y8J A;  1I76 A;  4ILW D;  1OM7 A;  1FBL A;  1KBC A;  4H84 A;  1AF0 A;  1UEA A;  3LQB A;  1QIA A;  4JP4 A;  2OZR A;  1YCM A;  3L0T A;  1JIW P;  3EHX A;  5BOT A;  3N2V A;  2MZE A;  2WO9 A;  2WO8 A;  1C8T A;  4FVL A;  3LMC A;  2X3C A;  4HX3 A;  2AIG P;  1D7X A;  1BQQ M;  1ZTQ A;  3ZUK A;  3P1V A;  1USN A;  4PKW A;  1G05 A;  3OHL A; 
#chains in the Genus database with same CATH topology
 1L6J A;  2ERP A;  1HTD A;  2Y6C A;  3P24 A;  4AIG A;  4HMA A;  3Q2G A;  2OVZ A;  2V4B A;  4GF1 A;  3ZXH A;  3K7N A;  4H3X A;  3AIG A;  1UMS A;  2W0D A;  4WF6 A;  1UMT A;  4J4M A;  1SLM A;  1KUG A;  2YIG A;  1D8F A;  2W12 A;  1PWW A;  3HBV P;  2X7M A;  4PKQ A;  2W13 A;  1GKC A;  2OY2 A;  4H49 A;  2QPJ A;  2WOA A;  1C3I A;  1OZ9 A;  2E3X A;  4GR0 A;  3DPE A;  3KMC A;  4L63 A;  4PKR A;  1CK7 A;  1AYK A;  1IAD A;  1XFU A;  4WK7 A;  2J0T A;  1GE5 A;  3GBO A;  1OM6 A;  4PKV A;  3KHI A;  4AYK A;  3LIR A;  3N2U A;  5D3C A;  4PKS A;  456C A;  1EUB A;  1HY7 A;  1MNC A;  3KEK A;  3LIK A;  4FXY P;  5L79 A;  4JA1 A;  2OY4 A;  1JAN A;  1R1J A;  4I03 A;  1XFV A;  3F17 A;  4WKI A;  1HFS A;  4EFS A;  2CLT A;  3V96 B;  1QUA A;  2MLR A;  4IUW A;  1XUC A;  1I1I P;  1OS2 A;  3CKI A;  1Y0V A;  3LJG A;  3O2X A;  1PWU A;  4PKT A;  2ERQ A;  1ATL A;  3EDZ A;  4WKE A;  1O0T A;  1ROS A;  3KEJ A;  3U1R A;  4GWN A;  2SRT A;  4H1Q A;  1J7N A;  2DDY A;  1SLN A;  3HYG A;  3LUM A;  1B8Y A;  1CXV A;  1HV5 A;  4PKU A;  1B3D A;  1ZS0 A;  2JSD A;  1XFY A;  1BKC A;  1MMR A;  1A85 A;  4DF9 A;  3RTS A;  3TT4 A;  2HU6 A;  2FV9 A;  3DWB A;  4ON1 A;  1JKY A;  4JPA A;  2CKI A;  3F19 A;  2JNP A;  1CGE A;  1D8M A;  1ND1 A;  5CUH A;  5L7F A;  3O64 A;  3LJZ A;  1Z3J A;  2PJT A;  5I3M A;  2JIH A;  1HFC A;  1AST A;  4ZR5 A;  4FXQ A;  3TS4 A;  4DD8 A;  1D5J A;  3DTK A;  3KRY A;  1PWV A;  1K7Q A;  830C A;  1RM8 A;  4G0D A;  1KUF A;  3I7I A;  4CTH A;  2Z2D A;  1JIZ A;  4R3V A;  3F16 A;  1I73 A;  2YB9 A;  5CZM A;  1IAA A;  3LEA A;  4I35 A;  1S4B P;  2MLS A;  1YOU A;  3LIL A;  1QIB A;  2J83 A;  1MMB A;  2MZI A;  5I12 A;  1MMP A;  2FV5 A;  2W15 A;  5D1S A;  1BM6 A;  1GXD A;  3E8R A;  4H2E A;  1WNI A;  1BQO A;  3AYU A;  2N8R A;  1BUD A;  1BIW A;  3WV2 A;  3DPF A;  2AYK A;  5D1T A;  3DTE A;  1CQR A;  1XFW A;  1CGF A;  2K2G A;  2OXW A;  1XAX A;  2O3E A;  3WV3 A;  1QJJ A;  4GQL A;  4JIJ A;  4QKZ A;  1CGL A;  3KWV C;  2D1O A;  1FM1 A;  2DW0 A;  3Q2H A;  5BPA A;  3K7L A;  4L6T A;  3VTG A;  1XUR A;  4GWM A;  1EB6 A;  4GUY A;  3EDI A;  3LE9 A;  1H71 P;  2ERO A;  4H82 A;  4AUO A;  1PWP A;  5CXA A;  3EWJ A;  1JAQ A;  1ZXC A;  5JMY A;  3B92 A;  1DMT A;  3VI1 A;  1IAG A;  3TSK A;  1XFX A;  1IAE A;  3LQ0 A;  3L0V A;  5BOY A;  1XM5 A;  5LAB A;  4XM6 A;  5B5O A;  2MZH A;  1OM8 A;  3LJT A;  1GE7 A;  3DTI A;  5D2B A;  5B5P A;  3LKA A;  3B2Z A;  5H8X A;  1JH1 A;  3EDH A;  3RTT A;  1G4K A;  1SU3 A;  1QJI A;  1JAO A;  2KRJ A;  2Y6D A;  3F15 A;  3OHO A;  2OXU A;  4GR3 A;  2JT6 A;  1IAB A;  1G49 A;  4Q1L A;  1SRP A;  1FLS A;  1C7K A;  1CIZ A;  1JJ9 A;  1UTT A;  3EDG A;  2OVX A;  3EHY A;  1R54 A;  1KUH A;  1BUV M;  1PWQ A;  4A3W A;  3TVC A;  4L7A A;  2XS4 A;  3KME A;  4JQG A;  3USN A;  4IN9 A;  2W14 A;  4XCT A;  5I0L A;  4L19 A;  3HB2 P;  2RJP A;  3NX7 A;  1ZVX A;  3HDA P;  3HDB A;  2OXZ A;  1GE6 A;  1UTZ A;  1XFZ A;  4IJO A;  1QIC A;  1OS9 A;  2X3A A;  3G5C A;  966C A;  1OO9 A;  1G12 A;  1GO7 P;  4DPE A;  1R55 A;  1BSW A;  1CAQ A;  3HBU P;  5I43 A;  2DW1 A;  3WV1 A;  1G9K A;  4XBH A;  3F18 A;  4FU4 A;  1XUD A;  1AKL A;  3LGP A;  4WZV A;  3DNG A;  1BKC E;  1JAP A;  2JT5 A;  5D7W A;  1R1H A;  3DSL A;  2XS3 A;  3BA0 A;  3LUN A;  1SAT A;  1JK3 A;  2I47 A;  3MA2 A;  1ZXV A;  3AYK A;  3HY9 A;  1OMJ A;  3I7G A;  2RJQ A;  4H76 A;  1K7I A;  1KAP P;  4XM8 A;  3ELM A;  4G9L A;  4GR8 A;  1A86 A;  1DTH A;  1KUK A;  1SMP A;  2A8H A;  1Q3A A;  5D1U A;  2OW1 A;  1RMZ A;  2OW9 A;  2X3B A;  3HY7 A;  1GKD A;  2K9C A;  1KUI A;  4AXQ A;  3LK8 A;  2USN A;  1O0Q A;  2POJ A;  1YQY A;  4DV8 A;  2TCL A;  2D1N A;  2E2D A;  1EAK A;  4A7B A;  1ZP5 A;  2DW2 A;  3DL1 A;  3ZVS A;  1Y93 A;  1IAC A;  2OW0 A;  1K7G A;  5I4O A;  1GO8 P;  1TVI A;  3B8Z A;  1BKC I;  3F1A A;  3KEC A;  1HOV A;  1YP1 A;  3G42 A;  2DDF A;  2OW2 A;  4XM7 A;  3UVC A;  2L0R A;  2OI0 A;  2O36 A;  4H30 A;  5I2Z A;  1MMQ A;  3SHI A;  1R1I A;  1BZS A;  1Y8J A;  1I76 A;  4ILW D;  1OM7 A;  1FBL A;  1KBC A;  4H84 A;  1AF0 A;  1UEA A;  3LQB A;  1QIA A;  4JP4 A;  2OZR A;  1YCM A;  3L0T A;  1JIW P;  3EHX A;  5BOT A;  3N2V A;  2MZE A;  2WO9 A;  2WO8 A;  1C8T A;  4FVL A;  3LMC A;  2X3C A;  4HX3 A;  2AIG P;  1D7X A;  1BQQ M;  1ZTQ A;  3ZUK A;  3P1V A;  1USN A;  4PKW A;  1G05 A;  3OHL A;  2YUF A; 
#chains in the Genus database with same CATH homology
 1L6J A;  2ERP A;  1HTD A;  2Y6C A;  3P24 A;  4AIG A;  4HMA A;  3Q2G A;  2OVZ A;  2V4B A;  4GF1 A;  3ZXH A;  3K7N A;  4H3X A;  3AIG A;  1UMS A;  2W0D A;  4WF6 A;  1UMT A;  4J4M A;  1SLM A;  1KUG A;  2YIG A;  1D8F A;  2W12 A;  1PWW A;  3HBV P;  2X7M A;  4PKQ A;  2W13 A;  1GKC A;  2OY2 A;  4H49 A;  2QPJ A;  2WOA A;  1C3I A;  2E3X A;  4GR0 A;  3DPE A;  3KMC A;  4L63 A;  4PKR A;  1CK7 A;  1AYK A;  1IAD A;  1XFU A;  4WK7 A;  2J0T A;  1GE5 A;  3GBO A;  1OM6 A;  4PKV A;  3KHI A;  4AYK A;  3LIR A;  3N2U A;  5D3C A;  4PKS A;  456C A;  1EUB A;  1HY7 A;  1MNC A;  3KEK A;  3LIK A;  4FXY P;  5L79 A;  4JA1 A;  2OY4 A;  1JAN A;  1R1J A;  4I03 A;  1XFV A;  3F17 A;  4WKI A;  1HFS A;  4EFS A;  2CLT A;  3V96 B;  1QUA A;  2MLR A;  4IUW A;  1XUC A;  1I1I P;  1OS2 A;  3CKI A;  1Y0V A;  3LJG A;  3O2X A;  1PWU A;  4PKT A;  2ERQ A;  1ATL A;  3EDZ A;  4WKE A;  1O0T A;  1ROS A;  3KEJ A;  3U1R A;  4GWN A;  2SRT A;  4H1Q A;  1J7N A;  2DDY A;  1SLN A;  3HYG A;  3LUM A;  1B8Y A;  1CXV A;  1HV5 A;  4PKU A;  1B3D A;  1ZS0 A;  2JSD A;  1XFY A;  1BKC A;  1MMR A;  1A85 A;  4DF9 A;  3RTS A;  3TT4 A;  2HU6 A;  2FV9 A;  3DWB A;  4ON1 A;  1JKY A;  4JPA A;  2CKI A;  3F19 A;  2JNP A;  1CGE A;  1D8M A;  1ND1 A;  5CUH A;  5L7F A;  3O64 A;  3LJZ A;  1Z3J A;  2PJT A;  5I3M A;  2JIH A;  1HFC A;  1AST A;  4ZR5 A;  4FXQ A;  3TS4 A;  4DD8 A;  1D5J A;  3DTK A;  3KRY A;  1PWV A;  1K7Q A;  830C A;  1RM8 A;  4G0D A;  1KUF A;  3I7I A;  4CTH A;  2Z2D A;  1JIZ A;  4R3V A;  3F16 A;  1I73 A;  2YB9 A;  5CZM A;  1IAA A;  3LEA A;  4I35 A;  1S4B P;  2MLS A;  1YOU A;  3LIL A;  1QIB A;  2J83 A;  1MMB A;  2MZI A;  5I12 A;  1MMP A;  2FV5 A;  2W15 A;  5D1S A;  1BM6 A;  1GXD A;  3E8R A;  4H2E A;  1WNI A;  1BQO A;  3AYU A;  2N8R A;  1BUD A;  1BIW A;  3WV2 A;  3DPF A;  2AYK A;  5D1T A;  3DTE A;  1CQR A;  1XFW A;  1CGF A;  2K2G A;  2OXW A;  2O3E A;  3WV3 A;  1QJJ A;  4GQL A;  4JIJ A;  4QKZ A;  1CGL A;  3KWV C;  2D1O A;  1FM1 A;  2DW0 A;  3Q2H A;  5BPA A;  3K7L A;  4L6T A;  3VTG A;  1XUR A;  4GWM A;  1EB6 A;  4GUY A;  3EDI A;  3LE9 A;  1H71 P;  2ERO A;  4H82 A;  4AUO A;  1PWP A;  5CXA A;  3EWJ A;  1JAQ A;  1ZXC A;  5JMY A;  3B92 A;  1DMT A;  3VI1 A;  1IAG A;  3TSK A;  1XFX A;  1IAE A;  3LQ0 A;  3L0V A;  5BOY A;  5LAB A;  4XM6 A;  5B5O A;  2MZH A;  1OM8 A;  3LJT A;  1GE7 A;  3DTI A;  5D2B A;  5B5P A;  3LKA A;  3B2Z A;  5H8X A;  1JH1 A;  3EDH A;  3RTT A;  1G4K A;  1SU3 A;  1QJI A;  1JAO A;  2KRJ A;  2Y6D A;  3F15 A;  3OHO A;  2OXU A;  4GR3 A;  2JT6 A;  1IAB A;  1G49 A;  4Q1L A;  1SRP A;  1FLS A;  1C7K A;  1CIZ A;  1JJ9 A;  1UTT A;  3EDG A;  2OVX A;  3EHY A;  1R54 A;  1KUH A;  1BUV M;  1PWQ A;  4A3W A;  3TVC A;  4L7A A;  2XS4 A;  3KME A;  4JQG A;  3USN A;  4IN9 A;  2W14 A;  4XCT A;  5I0L A;  4L19 A;  3HB2 P;  2RJP A;  3NX7 A;  1ZVX A;  3HDA P;  3HDB A;  2OXZ A;  1GE6 A;  1UTZ A;  1XFZ A;  4IJO A;  1QIC A;  1OS9 A;  2X3A A;  3G5C A;  966C A;  1OO9 A;  1G12 A;  1GO7 P;  4DPE A;  1R55 A;  1BSW A;  1CAQ A;  3HBU P;  5I43 A;  2DW1 A;  3WV1 A;  1G9K A;  4XBH A;  3F18 A;  4FU4 A;  1XUD A;  1AKL A;  3LGP A;  4WZV A;  3DNG A;  1BKC E;  1JAP A;  2JT5 A;  5D7W A;  1R1H A;  3DSL A;  2XS3 A;  3BA0 A;  3LUN A;  1SAT A;  1JK3 A;  2I47 A;  3MA2 A;  1ZXV A;  3AYK A;  3HY9 A;  1OMJ A;  3I7G A;  2RJQ A;  4H76 A;  1K7I A;  1KAP P;  4XM8 A;  3ELM A;  4G9L A;  4GR8 A;  1A86 A;  1DTH A;  1KUK A;  1SMP A;  2A8H A;  1Q3A A;  5D1U A;  2OW1 A;  1RMZ A;  2OW9 A;  2X3B A;  3HY7 A;  1GKD A;  2K9C A;  1KUI A;  4AXQ A;  3LK8 A;  2USN A;  1O0Q A;  2POJ A;  1YQY A;  4DV8 A;  2TCL A;  2D1N A;  2E2D A;  1EAK A;  4A7B A;  1ZP5 A;  2DW2 A;  3DL1 A;  3ZVS A;  1Y93 A;  1IAC A;  2OW0 A;  1K7G A;  5I4O A;  1GO8 P;  3B8Z A;  1BKC I;  3F1A A;  3KEC A;  1HOV A;  1YP1 A;  3G42 A;  2DDF A;  2OW2 A;  4XM7 A;  3UVC A;  2L0R A;  2OI0 A;  2O36 A;  4H30 A;  5I2Z A;  1MMQ A;  3SHI A;  1R1I A;  1BZS A;  1Y8J A;  1I76 A;  4ILW D;  1OM7 A;  1FBL A;  1KBC A;  4H84 A;  1AF0 A;  1UEA A;  3LQB A;  1QIA A;  4JP4 A;  2OZR A;  1YCM A;  3L0T A;  1JIW P;  3EHX A;  5BOT A;  3N2V A;  2MZE A;  2WO9 A;  2WO8 A;  1C8T A;  4FVL A;  3LMC A;  2X3C A;  4HX3 A;  2AIG P;  1D7X A;  1BQQ M;  1ZTQ A;  3ZUK A;  3P1V A;  1USN A;  4PKW A;  1G05 A;  3OHL A;  2YUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...