3LJZA

Crystal structure of human mmp-13 complexed with an amino-2-indanol compound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
161
Chain Sequence
ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPDDDVQGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Structure analysis reveals the flexibility of the ADAMTS-5 active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 161
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ljzA00
1G9KA 2W12A 1JKYA 3KRYA 3DPFA 5I4OA 2RJQA 3I7IA 3HDBA 3HYGA 3KEKA 1BKCI 1XFUA 1EUBA 4PKQA 2AIGP 1MMPA 1DTHA 2YB9A 1KAPP 3EDHA 3LEAA 1KUHA 2OZRA 4H2EA 3ZXHA 4XM7A 3KMEA 1R1JA 2MZIA 1USNA 1R55A 2HU6A 4PKSA 4H84A 4GF1A 1UTZA 2Z2DA 1JJ9A 2OY4A 4GUYA 4FXQA 1AKLA 1UMSA 4HMAA 1IADA 3GBOA 4AYKA 5JMYA 1IAGA 3KHIA 2CLTA 2K9CA 5L79A 3VTGA 4EFSA 4WF6A 3LILA 3HB2P 2OXUA 3LJGA 3KECA 2DW0A 1CGFA 1SU3A 4JA1A 4PKUA 2D1NA 2W15A 2DW2A 4ILWD 2D1OA 3DWBA 4L19A 1GKCA 3LGPA 1QIBA 1QJJA 2AYKA 4ON1A 1PWUA 3UVCA 4H49A 1BIWA 1XUCA 4A7BA 4AXQA 456CA 1RM8A 4HX3A 5H8XA 1JIWP 2TCLA 3O64A 1CIZA 1D7XA 5D1SA 4DPEA 3WV1A 1KUGA 4GWNA 3I7GA 1KUIA 5CXAA 1CGLA 2USNA 3F15A 3LIKA 4Q1LA 1ZXVA 1OM8A 1QJIA 3Q2HA 1BQQM 1EB6A 1OS2A 4H82A 2YIGA 3K7NA 5CUHA 2PJTA 3EDIA 1MNCA 3DNGA 4FU4A 2OVZA 1B8YA 2W0DA 4DV8A 2I47A 4AIGA 2X3CA 4IJOA 4XCTA 1G4KA 1SMPA 2QPJA 1ROSA 1OM6A 2O36A 1MMBA 1G12A 3LQ0A 1Z3JA 3N2UA 4QKZA 3WV3A 1Y0VA 1ATLA 2MLRA 2DW1A 1WNIA 1QIAA 2K2GA 2OW1A 1GE5A 2EROA 1XFZA 1O0TA 5BOTA 2A8HA 3LUNA 4G0DA 4GWMA 4XBHA 3HBUP 3G5CA 1CAQA 1BZSA 1MMRA 2JSDA 1HY7A 1Q3AA 3V96B 1R1IA 4WK7A 1KBCA 3DL1A 3L0VA 3TVCA 1RMZA 3NX7A 4WKEA 2X3BA 1XUDA 3SHIA 1D8FA 3F1AA 5LABA 1HV5A 2Y6CA 3KEJA 3LQBA 2OI0A 3EHYA 2WO8A 3DPEA 1AYKA 3KWVC 1PWQA 1ZTQA 2E2DA 3Q2GA 1JIZA 3KMCA 4A3WA 5D7WA 5I43A 1IAEA 3HDAP 3HBVP 5I2ZA 1BKCA 3ELMA 4H1QA 1GXDA 3WV2A 1H71P 3N2VA 1BSWA 3O2XA 3VI1A 1SLNA 1A85A 1JANA 2O3EA 1CK7A 2X7MA 2V4BA 4JPAA 1QICA 2XS3A 4FVLA 1IABA 2OW9A 3P1VA 2JT5A 1OM7A 3CKIA 5L7FA 3AYKA 2J83A 2POJA 2OY2A 1YQYA 1JK3A 1HOVA 2OW0A 4AUOA 1K7IA 1IAAA 3EHXA 4IUWA 3EDZA 2FV9A 2OW2A 1K7QA 1BQOA 3HY7A 1SATA 2KRJA 5BPAA 1GKDA 3U1RA 3RTTA 1R1HA 1UTTA 1I1IP 3TT4A 5I0LA 2X3AA 1EAKA 1YOUA 2ERPA 4CTHA 1J7NA 1I73A 1OO9A 1BKCE 4JQGA 3LJZA 1FBLA 1PWPA 1G05A 2W13A 1L6JA 3F18A 1HFSA 2OXWA 4PKTA 3LIRA 2WO9A 3AYUA 1OMJA 1Y93A 1UEAA 4GR3A 3F16A 1R54A 4WZVA 3LKAA 4XM8A 1PWWA 3B8ZA 3LUMA 1D8MA 3EWJA 1G49A 3EDGA 4H30A 1DMTA 3DSLA 1IACA 1SRPA 1CQRA 3E8RA 1GO8P 1B3DA 4R3VA 5D1UA 1GO7P 4FXYP 3B2ZA 4H3XA 3ZUKA 2MZHA 1UMTA 1GE7A 1C3IA 1C7KA 1MMQA 1K7GA 2OXZA 3HY9A 1ZXCA 1ZP5A 4DD8A 1I76A 1XFWA 3OHLA 4I35A 4J4MA 1D5JA 5D3CA 2E3XA 1FLSA 830CA 3F17A 3F19A 3LMCA 2DDYA 1HFCA 3LE9A 1FM1A 1GE6A 1ND1A 5I3MA 1JAOA 2J0TA 4PKVA 3MA2A 4H76A 1XFVA 3L0TA 3P24A 5I12A 4I03A 1XFYA 4PKWA 2RJPA 1OS9A 1ZS0A 3G42A 1AF0A 4GR8A 5D2BA 4L6TA 5B5OA 3TS4A 4JP4A 1ASTA 3USNA 1Y8JA 3B92A 2SRTA 3BA0A 5BOYA 4JIJA 3TSKA 1KUFA 2JNPA 4XM6A 5CZMA 2L0RA 1SLMA 2MLSA 2DDFA 1PWVA 2OVXA 2MZEA 3K7LA 4ZR5A 1YP1A 1XURA 2WOAA 1JAPA 1BUDA 2JT6A 1A86A 5D1TA 4GR0A 2JIHA 1O0QA 1CGEA 2XS4A 4G9LA 1JH1A 1CXVA 1QUAA 2FV5A 2Y6DA 1YCMA 1KUKA 3OHOA 2N8RA 4WKIA 4GQLA 1ZVXA 3RTSA 4DF9A 2CKIA 2ERQA 1BUVM 4IN9A 1JAQA 3LK8A 2W14A 3LJTA 4L63A 966CA 1S4BP 1XFXA 3AIGA 3ZVSA 4PKRA 1BM6A 5B5PA 1C8TA 1HTDA
chains in the Genus database with same CATH superfamily
1G9KA 2W12A 1JKYA 3KRYA 3DPFA 5I4OA 2RJQA 3I7IA 3HDBA 3HYGA 3KEKA 4L7AA 1BKCI 1XFUA 1EUBA 4PKQA 2AIGP 1MMPA 1DTHA 2YB9A 1KAPP 3EDHA 3LEAA 1KUHA 2OZRA 4H2EA 3ZXHA 4XM7A 3KMEA 1R1JA 2MZIA 1USNA 1R55A 2HU6A 4PKSA 4H84A 4GF1A 1UTZA 2Z2DA 1JJ9A 2OY4A 4GUYA 4FXQA 1AKLA 1UMSA 4HMAA 1IADA 3GBOA 4AYKA 5JMYA 1IAGA 3KHIA 2CLTA 2K9CA 5L79A 3VTGA 4EFSA 4WF6A 3LILA 3HB2P 2OXUA 3LJGA 3KECA 2DW0A 1CGFA 1SU3A 4JA1A 4PKUA 2D1NA 2W15A 2DW2A 4ILWD 2D1OA 3DWBA 4L19A 1GKCA 3LGPA 1QIBA 1QJJA 2AYKA 4ON1A 1PWUA 3UVCA 4H49A 1BIWA 1XUCA 4A7BA 4AXQA 456CA 1RM8A 4HX3A 5H8XA 1JIWP 2TCLA 3O64A 1CIZA 1D7XA 5D1SA 4DPEA 3WV1A 1KUGA 4GWNA 3I7GA 1KUIA 5CXAA 1CGLA 2USNA 3F15A 3LIKA 4Q1LA 1ZXVA 1OM8A 1QJIA 3Q2HA 1BQQM 1EB6A 1OS2A 4H82A 2YIGA 3K7NA 5CUHA 2PJTA 3EDIA 1MNCA 3DNGA 4FU4A 2OVZA 1B8YA 2W0DA 4DV8A 2I47A 4AIGA 2X3CA 4IJOA 4XCTA 1G4KA 1SMPA 2QPJA 1ROSA 1OM6A 2O36A 1MMBA 1G12A 3LQ0A 1Z3JA 3N2UA 4QKZA 3WV3A 1Y0VA 1ATLA 2MLRA 2DW1A 1WNIA 1QIAA 2K2GA 2OW1A 1GE5A 2EROA 1XFZA 1O0TA 5BOTA 2A8HA 3LUNA 4G0DA 4GWMA 4XBHA 3HBUP 3G5CA 1TVIA 1CAQA 1BZSA 1MMRA 2JSDA 1HY7A 1Q3AA 3V96B 1R1IA 4WK7A 1KBCA 3DL1A 3L0VA 3TVCA 1RMZA 3NX7A 4WKEA 2X3BA 1XUDA 3SHIA 1D8FA 3F1AA 5LABA 1HV5A 2Y6CA 3KEJA 3LQBA 2OI0A 3EHYA 2WO8A 3DPEA 1AYKA 3KWVC 1PWQA 1ZTQA 2E2DA 3Q2GA 1JIZA 3KMCA 4A3WA 5D7WA 5I43A 1IAEA 3HDAP 3HBVP 5I2ZA 1BKCA 3ELMA 4H1QA 1GXDA 3WV2A 3DTKA 1H71P 3N2VA 1BSWA 3O2XA 3VI1A 1SLNA 1A85A 1JANA 2O3EA 1CK7A 2X7MA 2V4BA 4JPAA 1QICA 2XS3A 4FVLA 1IABA 2OW9A 3P1VA 2JT5A 1OM7A 3CKIA 5L7FA 3AYKA 2J83A 2POJA 2OY2A 1YQYA 1JK3A 1HOVA 2OW0A 4AUOA 1K7IA 1IAAA 3DTEA 3EHXA 3EDZA 4IUWA 2FV9A 2OW2A 1K7QA 1BQOA 3HY7A 1SATA 2KRJA 5BPAA 1GKDA 3U1RA 3RTTA 1R1HA 1UTTA 1I1IP 3TT4A 5I0LA 2X3AA 1EAKA 1OZ9A 1YOUA 2ERPA 4CTHA 1J7NA 1I73A 1OO9A 1BKCE 4JQGA 1FBLA 1PWPA 3LJZA 1G05A 2W13A 1L6JA 3F18A 1HFSA 2OXWA 4PKTA 3LIRA 2WO9A 3AYUA 1OMJA 1Y93A 1UEAA 4GR3A 3F16A 1R54A 4WZVA 3LKAA 4XM8A 1PWWA 3B8ZA 3LUMA 1D8MA 3EWJA 1G49A 3EDGA 4H30A 1DMTA 3DSLA 1IACA 1SRPA 1CQRA 3E8RA 1GO8P 1B3DA 3DTIA 4R3VA 5D1UA 1GO7P 4FXYP 3B2ZA 4H3XA 3ZUKA 2MZHA 1UMTA 1GE7A 1C3IA 1C7KA 1MMQA 1K7GA 2OXZA 3HY9A 1ZXCA 1ZP5A 4DD8A 1I76A 1XFWA 3OHLA 4I35A 4J4MA 1D5JA 5D3CA 2E3XA 1XM5A 1FLSA 830CA 3F17A 3F19A 3LMCA 2DDYA 1HFCA 3LE9A 1FM1A 1GE6A 1ND1A 5I3MA 1JAOA 2J0TA 4PKVA 3MA2A 4H76A 1XFVA 3L0TA 3P24A 5I12A 4I03A 2YUFA 1XFYA 4PKWA 2RJPA 1OS9A 1ZS0A 3G42A 1AF0A 4GR8A 5D2BA 4L6TA 5B5OA 3TS4A 4JP4A 1ASTA 3USNA 1Y8JA 3B92A 2SRTA 3BA0A 5BOYA 4JIJA 3TSKA 1KUFA 2JNPA 4XM6A 5CZMA 2L0RA 1SLMA 2MLSA 1XAXA 2DDFA 1PWVA 2OVXA 2MZEA 3K7LA 4ZR5A 1YP1A 1XURA 2WOAA 1JAPA 1BUDA 2JT6A 1A86A 5D1TA 4GR0A 2JIHA 1O0QA 1CGEA 2XS4A 4G9LA 1JH1A 1CXVA 1QUAA 2FV5A 2Y6DA 1YCMA 1KUKA 3OHOA 2N8RA 4WKIA 4GQLA 1ZVXA 3RTSA 4DF9A 2CKIA 2ERQA 1BUVM 4IN9A 1JAQA 3LK8A 2W14A 3LJTA 4L63A 966CA 1S4BP 1XFXA 3AIGA 3ZVSA 4PKRA 1BM6A 5B5PA 1C8TA 1HTDA
chains in the Genus database with same CATH topology
1G9KA 2W12A 1JKYA 3KRYA 3DPFA 5I4OA 2RJQA 3I7IA 3HDBA 3HYGA 3KEKA 4L7AA 1BKCI 1XFUA 1EUBA 4PKQA 2AIGP 1MMPA 1DTHA 2YB9A 1KAPP 3EDHA 3LEAA 1KUHA 2OZRA 4H2EA 3ZXHA 4XM7A 3KMEA 1R1JA 2MZIA 1USNA 1R55A 2HU6A 4PKSA 4H84A 4GF1A 1UTZA 2Z2DA 1JJ9A 2OY4A 4GUYA 4FXQA 1AKLA 1UMSA 4HMAA 1IADA 3GBOA 4AYKA 5JMYA 1IAGA 3KHIA 2CLTA 2K9CA 5L79A 3VTGA 4EFSA 4WF6A 3LILA 3HB2P 2OXUA 3LJGA 3KECA 2DW0A 1CGFA 1SU3A 4JA1A 4PKUA 2D1NA 2W15A 2DW2A 4ILWD 2D1OA 3DWBA 4L19A 1GKCA 3LGPA 1QIBA 1QJJA 2AYKA 4ON1A 1PWUA 3UVCA 4H49A 1BIWA 1XUCA 4A7BA 4AXQA 456CA 1RM8A 4HX3A 5H8XA 1JIWP 2TCLA 3O64A 1CIZA 1D7XA 5D1SA 4DPEA 3WV1A 1KUGA 4GWNA 3I7GA 1KUIA 5CXAA 1CGLA 2USNA 3F15A 3LIKA 4Q1LA 1ZXVA 1OM8A 1QJIA 3Q2HA 1BQQM 1EB6A 1OS2A 4H82A 2YIGA 3K7NA 5CUHA 2PJTA 3EDIA 1MNCA 3DNGA 4FU4A 2OVZA 1B8YA 2W0DA 4DV8A 2I47A 4AIGA 2X3CA 4IJOA 4XCTA 1G4KA 1SMPA 2QPJA 1ROSA 1OM6A 2O36A 1MMBA 1G12A 3LQ0A 1Z3JA 3N2UA 4QKZA 3WV3A 1Y0VA 1ATLA 2MLRA 2DW1A 1WNIA 1QIAA 2K2GA 2OW1A 1GE5A 2EROA 1XFZA 1O0TA 5BOTA 2A8HA 3LUNA 4G0DA 4GWMA 4XBHA 3HBUP 3G5CA 1CAQA 1BZSA 1MMRA 2JSDA 1HY7A 1Q3AA 3V96B 1R1IA 4WK7A 1KBCA 3DL1A 3L0VA 3TVCA 1RMZA 3NX7A 4WKEA 2X3BA 1XUDA 3SHIA 1D8FA 3F1AA 5LABA 1HV5A 2Y6CA 3KEJA 3LQBA 2OI0A 3EHYA 2WO8A 3DPEA 1AYKA 3KWVC 1PWQA 1ZTQA 2E2DA 3Q2GA 1JIZA 3KMCA 4A3WA 5D7WA 5I43A 1IAEA 3HDAP 3HBVP 5I2ZA 1BKCA 3ELMA 4H1QA 1GXDA 3WV2A 3DTKA 1H71P 3N2VA 1BSWA 3O2XA 3VI1A 1SLNA 1A85A 1JANA 2O3EA 1CK7A 2X7MA 2V4BA 4JPAA 1QICA 2XS3A 4FVLA 1IABA 2OW9A 3P1VA 2JT5A 1OM7A 3CKIA 5L7FA 3AYKA 2J83A 2POJA 2OY2A 1YQYA 1JK3A 1HOVA 2OW0A 4AUOA 1K7IA 1IAAA 3DTEA 3EHXA 3EDZA 4IUWA 2FV9A 2OW2A 1K7QA 1BQOA 3HY7A 1SATA 2KRJA 5BPAA 1GKDA 3U1RA 3RTTA 1R1HA 1UTTA 1I1IP 3TT4A 5I0LA 2X3AA 1EAKA 1YOUA 2ERPA 4CTHA 1J7NA 1I73A 1OO9A 1BKCE 4JQGA 3LJZA 1FBLA 1PWPA 1G05A 2W13A 1L6JA 3F18A 1HFSA 2OXWA 4PKTA 3LIRA 2WO9A 3AYUA 1OMJA 1Y93A 1UEAA 4GR3A 3F16A 1R54A 4WZVA 3LKAA 4XM8A 1PWWA 3B8ZA 3LUMA 1D8MA 3EWJA 1G49A 3EDGA 4H30A 1DMTA 3DSLA 1IACA 1SRPA 1CQRA 3E8RA 1GO8P 1B3DA 3DTIA 4R3VA 5D1UA 1GO7P 4FXYP 3B2ZA 4H3XA 3ZUKA 2MZHA 1UMTA 1GE7A 1C3IA 1C7KA 1MMQA 1K7GA 2OXZA 3HY9A 1ZXCA 1ZP5A 4DD8A 1I76A 1XFWA 3OHLA 4I35A 4J4MA 1D5JA 5D3CA 2E3XA 1FLSA 830CA 3F17A 3F19A 3LMCA 2DDYA 1HFCA 3LE9A 1FM1A 1GE6A 1ND1A 5I3MA 1JAOA 2J0TA 4PKVA 3MA2A 4H76A 1XFVA 3L0TA 3P24A 5I12A 4I03A 2YUFA 1XFYA 4PKWA 2RJPA 1OS9A 1ZS0A 3G42A 1AF0A 4GR8A 5D2BA 4L6TA 5B5OA 3TS4A 4JP4A 1ASTA 3USNA 1Y8JA 3B92A 2SRTA 3BA0A 5BOYA 4JIJA 3TSKA 1KUFA 2JNPA 4XM6A 5CZMA 2L0RA 1SLMA 2MLSA 2DDFA 1PWVA 2OVXA 2MZEA 3K7LA 4ZR5A 1YP1A 1XURA 2WOAA 1JAPA 1BUDA 2JT6A 1A86A 5D1TA 4GR0A 2JIHA 1O0QA 1CGEA 2XS4A 4G9LA 1JH1A 1CXVA 1QUAA 2FV5A 2Y6DA 1YCMA 1KUKA 3OHOA 2N8RA 4WKIA 4GQLA 1ZVXA 3RTSA 4DF9A 2CKIA 2ERQA 1BUVM 4IN9A 1JAQA 3LK8A 2W14A 3LJTA 4L63A 966CA 1S4BP 1XFXA 3AIGA 3ZVSA 4PKRA 1BM6A 5B5PA 1C8TA 1HTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G9K A;  2W12 A;  1JKY A;  3KRY A;  3DPF A;  5I4O A;  2RJQ A;  3I7I A;  3HDB A;  3HYG A;  3KEK A;  1BKC I;  1XFU A;  1EUB A;  4PKQ A;  2AIG P;  1MMP A;  1DTH A;  2YB9 A;  1KAP P;  3EDH A;  3LEA A;  1KUH A;  2OZR A;  4H2E A;  3ZXH A;  4XM7 A;  3KME A;  1R1J A;  2MZI A;  1USN A;  1R55 A;  2HU6 A;  4PKS A;  4H84 A;  4GF1 A;  1UTZ A;  2Z2D A;  1JJ9 A;  2OY4 A;  4GUY A;  4FXQ A;  1AKL A;  1UMS A;  4HMA A;  1IAD A;  3GBO A;  4AYK A;  5JMY A;  1IAG A;  3KHI A;  2CLT A;  2K9C A;  5L79 A;  3VTG A;  4EFS A;  4WF6 A;  3LIL A;  3HB2 P;  2OXU A;  3LJG A;  3KEC A;  2DW0 A;  1CGF A;  1SU3 A;  4JA1 A;  4PKU A;  2D1N A;  2W15 A;  2DW2 A;  4ILW D;  2D1O A;  3DWB A;  4L19 A;  1GKC A;  3LGP A;  1QIB A;  1QJJ A;  2AYK A;  4ON1 A;  1PWU A;  3UVC A;  4H49 A;  1BIW A;  1XUC A;  4A7B A;  4AXQ A;  456C A;  1RM8 A;  4HX3 A;  5H8X A;  1JIW P;  2TCL A;  3O64 A;  1CIZ A;  1D7X A;  5D1S A;  4DPE A;  3WV1 A;  1KUG A;  4GWN A;  3I7G A;  1KUI A;  5CXA A;  1CGL A;  2USN A;  3F15 A;  3LIK A;  4Q1L A;  1ZXV A;  1OM8 A;  1QJI A;  3Q2H A;  1BQQ M;  1EB6 A;  1OS2 A;  4H82 A;  2YIG A;  3K7N A;  5CUH A;  2PJT A;  3EDI A;  1MNC A;  3DNG A;  4FU4 A;  2OVZ A;  1B8Y A;  2W0D A;  4DV8 A;  2I47 A;  4AIG A;  2X3C A;  4IJO A;  4XCT A;  1G4K A;  1SMP A;  2QPJ A;  1ROS A;  1OM6 A;  2O36 A;  1MMB A;  1G12 A;  3LQ0 A;  1Z3J A;  3N2U A;  4QKZ A;  3WV3 A;  1Y0V A;  1ATL A;  2MLR A;  2DW1 A;  1WNI A;  1QIA A;  2K2G A;  2OW1 A;  1GE5 A;  2ERO A;  1XFZ A;  1O0T A;  5BOT A;  2A8H A;  3LUN A;  4G0D A;  4GWM A;  4XBH A;  3HBU P;  3G5C A;  1CAQ A;  1BZS A;  1MMR A;  2JSD A;  1HY7 A;  1Q3A A;  3V96 B;  1R1I A;  4WK7 A;  1KBC A;  3DL1 A;  3L0V A;  3TVC A;  1RMZ A;  3NX7 A;  4WKE A;  2X3B A;  1XUD A;  3SHI A;  1D8F A;  3F1A A;  5LAB A;  1HV5 A;  2Y6C A;  3KEJ A;  3LQB A;  2OI0 A;  3EHY A;  2WO8 A;  3DPE A;  1AYK A;  3KWV C;  1PWQ A;  1ZTQ A;  2E2D A;  3Q2G A;  1JIZ A;  3KMC A;  4A3W A;  5D7W A;  5I43 A;  1IAE A;  3HDA P;  3HBV P;  5I2Z A;  1BKC A;  3ELM A;  4H1Q A;  1GXD A;  3WV2 A;  1H71 P;  3N2V A;  1BSW A;  3O2X A;  3VI1 A;  1SLN A;  1A85 A;  1JAN A;  2O3E A;  1CK7 A;  2X7M A;  2V4B A;  4JPA A;  1QIC A;  2XS3 A;  4FVL A;  1IAB A;  2OW9 A;  3P1V A;  2JT5 A;  1OM7 A;  3CKI A;  5L7F A;  3AYK A;  2J83 A;  2POJ A;  2OY2 A;  1YQY A;  1JK3 A;  1HOV A;  2OW0 A;  4AUO A;  1K7I A;  1IAA A;  3EHX A;  4IUW A;  3EDZ A;  2FV9 A;  2OW2 A;  1K7Q A;  1BQO A;  3HY7 A;  1SAT A;  2KRJ A;  5BPA A;  1GKD A;  3U1R A;  3RTT A;  1R1H A;  1UTT A;  1I1I P;  3TT4 A;  5I0L A;  2X3A A;  1EAK A;  1YOU A;  2ERP A;  4CTH A;  1J7N A;  1I73 A;  1OO9 A;  1BKC E;  4JQG A;  3LJZ A;  1FBL A;  1PWP A;  1G05 A;  2W13 A;  1L6J A;  3F18 A;  1HFS A;  2OXW A;  4PKT A;  3LIR A;  2WO9 A;  3AYU A;  1OMJ A;  1Y93 A;  1UEA A;  4GR3 A;  3F16 A;  1R54 A;  4WZV A;  3LKA A;  4XM8 A;  1PWW A;  3B8Z A;  3LUM A;  1D8M A;  3EWJ A;  1G49 A;  3EDG A;  4H30 A;  1DMT A;  3DSL A;  1IAC A;  1SRP A;  1CQR A;  3E8R A;  1GO8 P;  1B3D A;  4R3V A;  5D1U A;  1GO7 P;  4FXY P;  3B2Z A;  4H3X A;  3ZUK A;  2MZH A;  1UMT A;  1GE7 A;  1C3I A;  1C7K A;  1MMQ A;  1K7G A;  2OXZ A;  3HY9 A;  1ZXC A;  1ZP5 A;  4DD8 A;  1I76 A;  1XFW A;  3OHL A;  4I35 A;  4J4M A;  1D5J A;  5D3C A;  2E3X A;  1FLS A;  830C A;  3F17 A;  3F19 A;  3LMC A;  2DDY A;  1HFC A;  3LE9 A;  1FM1 A;  1GE6 A;  1ND1 A;  5I3M A;  1JAO A;  2J0T A;  4PKV A;  3MA2 A;  4H76 A;  1XFV A;  3L0T A;  3P24 A;  5I12 A;  4I03 A;  1XFY A;  4PKW A;  2RJP A;  1OS9 A;  1ZS0 A;  3G42 A;  1AF0 A;  4GR8 A;  5D2B A;  4L6T A;  5B5O A;  3TS4 A;  4JP4 A;  1AST A;  3USN A;  1Y8J A;  3B92 A;  2SRT A;  3BA0 A;  5BOY A;  4JIJ A;  3TSK A;  1KUF A;  2JNP A;  4XM6 A;  5CZM A;  2L0R A;  1SLM A;  2MLS A;  2DDF A;  1PWV A;  2OVX A;  2MZE A;  3K7L A;  4ZR5 A;  1YP1 A;  1XUR A;  2WOA A;  1JAP A;  1BUD A;  2JT6 A;  1A86 A;  5D1T A;  4GR0 A;  2JIH A;  1O0Q A;  1CGE A;  2XS4 A;  4G9L A;  1JH1 A;  1CXV A;  1QUA A;  2FV5 A;  2Y6D A;  1YCM A;  1KUK A;  3OHO A;  2N8R A;  4WKI A;  4GQL A;  1ZVX A;  3RTS A;  4DF9 A;  2CKI A;  2ERQ A;  1BUV M;  4IN9 A;  1JAQ A;  3LK8 A;  2W14 A;  3LJT A;  4L63 A;  966C A;  1S4B P;  1XFX A;  3AIG A;  3ZVS A;  4PKR A;  1BM6 A;  5B5P A;  1C8T A;  1HTD A; 
#chains in the Genus database with same CATH topology
 1G9K A;  2W12 A;  1JKY A;  3KRY A;  3DPF A;  5I4O A;  2RJQ A;  3I7I A;  3HDB A;  3HYG A;  3KEK A;  4L7A A;  1BKC I;  1XFU A;  1EUB A;  4PKQ A;  2AIG P;  1MMP A;  1DTH A;  2YB9 A;  1KAP P;  3EDH A;  3LEA A;  1KUH A;  2OZR A;  4H2E A;  3ZXH A;  4XM7 A;  3KME A;  1R1J A;  2MZI A;  1USN A;  1R55 A;  2HU6 A;  4PKS A;  4H84 A;  4GF1 A;  1UTZ A;  2Z2D A;  1JJ9 A;  2OY4 A;  4GUY A;  4FXQ A;  1AKL A;  1UMS A;  4HMA A;  1IAD A;  3GBO A;  4AYK A;  5JMY A;  1IAG A;  3KHI A;  2CLT A;  2K9C A;  5L79 A;  3VTG A;  4EFS A;  4WF6 A;  3LIL A;  3HB2 P;  2OXU A;  3LJG A;  3KEC A;  2DW0 A;  1CGF A;  1SU3 A;  4JA1 A;  4PKU A;  2D1N A;  2W15 A;  2DW2 A;  4ILW D;  2D1O A;  3DWB A;  4L19 A;  1GKC A;  3LGP A;  1QIB A;  1QJJ A;  2AYK A;  4ON1 A;  1PWU A;  3UVC A;  4H49 A;  1BIW A;  1XUC A;  4A7B A;  4AXQ A;  456C A;  1RM8 A;  4HX3 A;  5H8X A;  1JIW P;  2TCL A;  3O64 A;  1CIZ A;  1D7X A;  5D1S A;  4DPE A;  3WV1 A;  1KUG A;  4GWN A;  3I7G A;  1KUI A;  5CXA A;  1CGL A;  2USN A;  3F15 A;  3LIK A;  4Q1L A;  1ZXV A;  1OM8 A;  1QJI A;  3Q2H A;  1BQQ M;  1EB6 A;  1OS2 A;  4H82 A;  2YIG A;  3K7N A;  5CUH A;  2PJT A;  3EDI A;  1MNC A;  3DNG A;  4FU4 A;  2OVZ A;  1B8Y A;  2W0D A;  4DV8 A;  2I47 A;  4AIG A;  2X3C A;  4IJO A;  4XCT A;  1G4K A;  1SMP A;  2QPJ A;  1ROS A;  1OM6 A;  2O36 A;  1MMB A;  1G12 A;  3LQ0 A;  1Z3J A;  3N2U A;  4QKZ A;  3WV3 A;  1Y0V A;  1ATL A;  2MLR A;  2DW1 A;  1WNI A;  1QIA A;  2K2G A;  2OW1 A;  1GE5 A;  2ERO A;  1XFZ A;  1O0T A;  5BOT A;  2A8H A;  3LUN A;  4G0D A;  4GWM A;  4XBH A;  3HBU P;  3G5C A;  1TVI A;  1CAQ A;  1BZS A;  1MMR A;  2JSD A;  1HY7 A;  1Q3A A;  3V96 B;  1R1I A;  4WK7 A;  1KBC A;  3DL1 A;  3L0V A;  3TVC A;  1RMZ A;  3NX7 A;  4WKE A;  2X3B A;  1XUD A;  3SHI A;  1D8F A;  3F1A A;  5LAB A;  1HV5 A;  2Y6C A;  3KEJ A;  3LQB A;  2OI0 A;  3EHY A;  2WO8 A;  3DPE A;  1AYK A;  3KWV C;  1PWQ A;  1ZTQ A;  2E2D A;  3Q2G A;  1JIZ A;  3KMC A;  4A3W A;  5D7W A;  5I43 A;  1IAE A;  3HDA P;  3HBV P;  5I2Z A;  1BKC A;  3ELM A;  4H1Q A;  1GXD A;  3WV2 A;  3DTK A;  1H71 P;  3N2V A;  1BSW A;  3O2X A;  3VI1 A;  1SLN A;  1A85 A;  1JAN A;  2O3E A;  1CK7 A;  2X7M A;  2V4B A;  4JPA A;  1QIC A;  2XS3 A;  4FVL A;  1IAB A;  2OW9 A;  3P1V A;  2JT5 A;  1OM7 A;  3CKI A;  5L7F A;  3AYK A;  2J83 A;  2POJ A;  2OY2 A;  1YQY A;  1JK3 A;  1HOV A;  2OW0 A;  4AUO A;  1K7I A;  1IAA A;  3DTE A;  3EHX A;  3EDZ A;  4IUW A;  2FV9 A;  2OW2 A;  1K7Q A;  1BQO A;  3HY7 A;  1SAT A;  2KRJ A;  5BPA A;  1GKD A;  3U1R A;  3RTT A;  1R1H A;  1UTT A;  1I1I P;  3TT4 A;  5I0L A;  2X3A A;  1EAK A;  1OZ9 A;  1YOU A;  2ERP A;  4CTH A;  1J7N A;  1I73 A;  1OO9 A;  1BKC E;  4JQG A;  1FBL A;  1PWP A;  3LJZ A;  1G05 A;  2W13 A;  1L6J A;  3F18 A;  1HFS A;  2OXW A;  4PKT A;  3LIR A;  2WO9 A;  3AYU A;  1OMJ A;  1Y93 A;  1UEA A;  4GR3 A;  3F16 A;  1R54 A;  4WZV A;  3LKA A;  4XM8 A;  1PWW A;  3B8Z A;  3LUM A;  1D8M A;  3EWJ A;  1G49 A;  3EDG A;  4H30 A;  1DMT A;  3DSL A;  1IAC A;  1SRP A;  1CQR A;  3E8R A;  1GO8 P;  1B3D A;  3DTI A;  4R3V A;  5D1U A;  1GO7 P;  4FXY P;  3B2Z A;  4H3X A;  3ZUK A;  2MZH A;  1UMT A;  1GE7 A;  1C3I A;  1C7K A;  1MMQ A;  1K7G A;  2OXZ A;  3HY9 A;  1ZXC A;  1ZP5 A;  4DD8 A;  1I76 A;  1XFW A;  3OHL A;  4I35 A;  4J4M A;  1D5J A;  5D3C A;  2E3X A;  1XM5 A;  1FLS A;  830C A;  3F17 A;  3F19 A;  3LMC A;  2DDY A;  1HFC A;  3LE9 A;  1FM1 A;  1GE6 A;  1ND1 A;  5I3M A;  1JAO A;  2J0T A;  4PKV A;  3MA2 A;  4H76 A;  1XFV A;  3L0T A;  3P24 A;  5I12 A;  4I03 A;  2YUF A;  1XFY A;  4PKW A;  2RJP A;  1OS9 A;  1ZS0 A;  3G42 A;  1AF0 A;  4GR8 A;  5D2B A;  4L6T A;  5B5O A;  3TS4 A;  4JP4 A;  1AST A;  3USN A;  1Y8J A;  3B92 A;  2SRT A;  3BA0 A;  5BOY A;  4JIJ A;  3TSK A;  1KUF A;  2JNP A;  4XM6 A;  5CZM A;  2L0R A;  1SLM A;  2MLS A;  1XAX A;  2DDF A;  1PWV A;  2OVX A;  2MZE A;  3K7L A;  4ZR5 A;  1YP1 A;  1XUR A;  2WOA A;  1JAP A;  1BUD A;  2JT6 A;  1A86 A;  5D1T A;  4GR0 A;  2JIH A;  1O0Q A;  1CGE A;  2XS4 A;  4G9L A;  1JH1 A;  1CXV A;  1QUA A;  2FV5 A;  2Y6D A;  1YCM A;  1KUK A;  3OHO A;  2N8R A;  4WKI A;  4GQL A;  1ZVX A;  3RTS A;  4DF9 A;  2CKI A;  2ERQ A;  1BUV M;  4IN9 A;  1JAQ A;  3LK8 A;  2W14 A;  3LJT A;  4L63 A;  966C A;  1S4B P;  1XFX A;  3AIG A;  3ZVS A;  4PKR A;  1BM6 A;  5B5P A;  1C8T A;  1HTD A; 
#chains in the Genus database with same CATH homology
 1G9K A;  2W12 A;  1JKY A;  3KRY A;  3DPF A;  5I4O A;  2RJQ A;  3I7I A;  3HDB A;  3HYG A;  3KEK A;  4L7A A;  1BKC I;  1XFU A;  1EUB A;  4PKQ A;  2AIG P;  1MMP A;  1DTH A;  2YB9 A;  1KAP P;  3EDH A;  3LEA A;  1KUH A;  2OZR A;  4H2E A;  3ZXH A;  4XM7 A;  3KME A;  1R1J A;  2MZI A;  1USN A;  1R55 A;  2HU6 A;  4PKS A;  4H84 A;  4GF1 A;  1UTZ A;  2Z2D A;  1JJ9 A;  2OY4 A;  4GUY A;  4FXQ A;  1AKL A;  1UMS A;  4HMA A;  1IAD A;  3GBO A;  4AYK A;  5JMY A;  1IAG A;  3KHI A;  2CLT A;  2K9C A;  5L79 A;  3VTG A;  4EFS A;  4WF6 A;  3LIL A;  3HB2 P;  2OXU A;  3LJG A;  3KEC A;  2DW0 A;  1CGF A;  1SU3 A;  4JA1 A;  4PKU A;  2D1N A;  2W15 A;  2DW2 A;  4ILW D;  2D1O A;  3DWB A;  4L19 A;  1GKC A;  3LGP A;  1QIB A;  1QJJ A;  2AYK A;  4ON1 A;  1PWU A;  3UVC A;  4H49 A;  1BIW A;  1XUC A;  4A7B A;  4AXQ A;  456C A;  1RM8 A;  4HX3 A;  5H8X A;  1JIW P;  2TCL A;  3O64 A;  1CIZ A;  1D7X A;  5D1S A;  4DPE A;  3WV1 A;  1KUG A;  4GWN A;  3I7G A;  1KUI A;  5CXA A;  1CGL A;  2USN A;  3F15 A;  3LIK A;  4Q1L A;  1ZXV A;  1OM8 A;  1QJI A;  3Q2H A;  1BQQ M;  1EB6 A;  1OS2 A;  4H82 A;  2YIG A;  3K7N A;  5CUH A;  2PJT A;  3EDI A;  1MNC A;  3DNG A;  4FU4 A;  2OVZ A;  1B8Y A;  2W0D A;  4DV8 A;  2I47 A;  4AIG A;  2X3C A;  4IJO A;  4XCT A;  1G4K A;  1SMP A;  2QPJ A;  1ROS A;  1OM6 A;  2O36 A;  1MMB A;  1G12 A;  3LQ0 A;  1Z3J A;  3N2U A;  4QKZ A;  3WV3 A;  1Y0V A;  1ATL A;  2MLR A;  2DW1 A;  1WNI A;  1QIA A;  2K2G A;  2OW1 A;  1GE5 A;  2ERO A;  1XFZ A;  1O0T A;  5BOT A;  2A8H A;  3LUN A;  4G0D A;  4GWM A;  4XBH A;  3HBU P;  3G5C A;  1CAQ A;  1BZS A;  1MMR A;  2JSD A;  1HY7 A;  1Q3A A;  3V96 B;  1R1I A;  4WK7 A;  1KBC A;  3DL1 A;  3L0V A;  3TVC A;  1RMZ A;  3NX7 A;  4WKE A;  2X3B A;  1XUD A;  3SHI A;  1D8F A;  3F1A A;  5LAB A;  1HV5 A;  2Y6C A;  3KEJ A;  3LQB A;  2OI0 A;  3EHY A;  2WO8 A;  3DPE A;  1AYK A;  3KWV C;  1PWQ A;  1ZTQ A;  2E2D A;  3Q2G A;  1JIZ A;  3KMC A;  4A3W A;  5D7W A;  5I43 A;  1IAE A;  3HDA P;  3HBV P;  5I2Z A;  1BKC A;  3ELM A;  4H1Q A;  1GXD A;  3WV2 A;  3DTK A;  1H71 P;  3N2V A;  1BSW A;  3O2X A;  3VI1 A;  1SLN A;  1A85 A;  1JAN A;  2O3E A;  1CK7 A;  2X7M A;  2V4B A;  4JPA A;  1QIC A;  2XS3 A;  4FVL A;  1IAB A;  2OW9 A;  3P1V A;  2JT5 A;  1OM7 A;  3CKI A;  5L7F A;  3AYK A;  2J83 A;  2POJ A;  2OY2 A;  1YQY A;  1JK3 A;  1HOV A;  2OW0 A;  4AUO A;  1K7I A;  1IAA A;  3DTE A;  3EHX A;  3EDZ A;  4IUW A;  2FV9 A;  2OW2 A;  1K7Q A;  1BQO A;  3HY7 A;  1SAT A;  2KRJ A;  5BPA A;  1GKD A;  3U1R A;  3RTT A;  1R1H A;  1UTT A;  1I1I P;  3TT4 A;  5I0L A;  2X3A A;  1EAK A;  1YOU A;  2ERP A;  4CTH A;  1J7N A;  1I73 A;  1OO9 A;  1BKC E;  4JQG A;  3LJZ A;  1FBL A;  1PWP A;  1G05 A;  2W13 A;  1L6J A;  3F18 A;  1HFS A;  2OXW A;  4PKT A;  3LIR A;  2WO9 A;  3AYU A;  1OMJ A;  1Y93 A;  1UEA A;  4GR3 A;  3F16 A;  1R54 A;  4WZV A;  3LKA A;  4XM8 A;  1PWW A;  3B8Z A;  3LUM A;  1D8M A;  3EWJ A;  1G49 A;  3EDG A;  4H30 A;  1DMT A;  3DSL A;  1IAC A;  1SRP A;  1CQR A;  3E8R A;  1GO8 P;  1B3D A;  3DTI A;  4R3V A;  5D1U A;  1GO7 P;  4FXY P;  3B2Z A;  4H3X A;  3ZUK A;  2MZH A;  1UMT A;  1GE7 A;  1C3I A;  1C7K A;  1MMQ A;  1K7G A;  2OXZ A;  3HY9 A;  1ZXC A;  1ZP5 A;  4DD8 A;  1I76 A;  1XFW A;  3OHL A;  4I35 A;  4J4M A;  1D5J A;  5D3C A;  2E3X A;  1FLS A;  830C A;  3F17 A;  3F19 A;  3LMC A;  2DDY A;  1HFC A;  3LE9 A;  1FM1 A;  1GE6 A;  1ND1 A;  5I3M A;  1JAO A;  2J0T A;  4PKV A;  3MA2 A;  4H76 A;  1XFV A;  3L0T A;  3P24 A;  5I12 A;  4I03 A;  2YUF A;  1XFY A;  4PKW A;  2RJP A;  1OS9 A;  1ZS0 A;  3G42 A;  1AF0 A;  4GR8 A;  5D2B A;  4L6T A;  5B5O A;  3TS4 A;  4JP4 A;  1AST A;  3USN A;  1Y8J A;  3B92 A;  2SRT A;  3BA0 A;  5BOY A;  4JIJ A;  3TSK A;  1KUF A;  2JNP A;  4XM6 A;  5CZM A;  2L0R A;  1SLM A;  2MLS A;  2DDF A;  1PWV A;  2OVX A;  2MZE A;  3K7L A;  4ZR5 A;  1YP1 A;  1XUR A;  2WOA A;  1JAP A;  1BUD A;  2JT6 A;  1A86 A;  5D1T A;  4GR0 A;  2JIH A;  1O0Q A;  1CGE A;  2XS4 A;  4G9L A;  1JH1 A;  1CXV A;  1QUA A;  2FV5 A;  2Y6D A;  1YCM A;  1KUK A;  3OHO A;  2N8R A;  4WKI A;  4GQL A;  1ZVX A;  3RTS A;  4DF9 A;  2CKI A;  2ERQ A;  1BUV M;  4IN9 A;  1JAQ A;  3LK8 A;  2W14 A;  3LJT A;  4L63 A;  966C A;  1S4B P;  1XFX A;  3AIG A;  3ZVS A;  4PKR A;  1BM6 A;  5B5P A;  1C8T A;  1HTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...