3LJZA

Crystal structure of human mmp-13 complexed with an amino-2-indanol compound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
161
Chain Sequence
ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPDDDVQGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Collagenase 3
publication title Structure analysis reveals the flexibility of the ADAMTS-5 active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 161
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ljzA00
1PWQA 1R1HA 1SATA 1XUCA 3LJGA 4DF9A 2W13A 4ON1A 3B2ZA 4Q1LA 4GQLA 4H82A 4FVLA 3KRYA 3F17A 1JIZA 1OO9A 2OY2A 1A86A 5I2ZA 2J0TA 4PKRA 3UVCA 4AUOA 5I12A 1XFZA 1AYKA 1XFYA 1JAOA 1HFCA 2RJPA 2MLSA 2J83A 2JNPA 3LGPA 2WO8A 1KAPP 1ZS0A 3DSLA 966CA 2JT6A 5D2BA 2W12A 3EHYA 2OW1A 4XM7A 1XURA 3G42A 3U1RA 2RJQA 3ZVSA 1WNIA 4H1QA 4QKZA 1C3IA 2O3EA 1HY7A 4GR8A 1FM1A 4ZR5A 2K9CA 3KEKA 4GWNA 3LJTA 2AYKA 2Z2DA 3OHOA 3TS4A 1GE5A 1O0QA 3G5CA 2QPJA 1D5JA 1O0TA 3AIGA 3HDAP 2D1OA 2XS4A 4ILWD 1JIWP 1UMTA 1QIBA 1K7IA 2OVZA 3V96B 1SMPA 5I0LA 1ZVXA 5D1UA 4PKUA 2MLRA 3F15A 5H8XA 1KUKA 3AYUA 1JK3A 1PWWA 1ND1A 2I47A 4GWMA 3K7LA 4AIGA 2OI0A 4AXQA 3KECA 1B3DA 3LJZA 2POJA 4GR3A 3RTSA 4DD8A 1IACA 3KMEA 1K7QA 1BIWA 3DNGA 1QJJA 4PKVA 1BZSA 1UTZA 1G05A 3LQ0A 4L63A 5I4OA 1FBLA 3LUNA 1ZTQA 5B5PA 1XFWA 1MMRA 2CLTA 2V4BA 1RMZA 3ZXHA 1IADA 1G9KA 4XM8A 4G0DA 2E2DA 4XM6A 5CUHA 4AYKA 3Q2HA 1A85A 1ZXVA 1PWPA 1J7NA 4J4MA 3DL1A 5D3CA 4IJOA 1BKCA 3Q2GA 1ZXCA 2SRTA 5BPAA 1IABA 1ASTA 3KMCA 4DV8A 1BM6A 1G49A 3DPEA 4XBHA 2X7MA 1OM8A 1MNCA 3HY9A 3WV1A 2YB9A 1MMBA 1S4BP 4GF1A 3KEJA 3ELMA 1BKCI 1Y8JA 830CA 2JSDA 2X3BA 1QUAA 4CTHA 2OXWA 3HDBA 3EDHA 4H3XA 3LILA 5I3MA 2N8RA 4I35A 5L79A 2MZIA 1SLNA 4GUYA 5CXAA 3TSKA 3AYKA 3P1VA 1BSWA 4JP4A 4WZVA 1CGFA 2ERPA 5L7FA 1CGLA 5LABA 4FXYP 1XFUA 1GXDA 1CK7A 1YP1A 1R1JA 1USNA 1Y0VA 2XS3A 1H71P 2PJTA 1GE7A 2JIHA 2X3CA 3GBOA 3OHLA 1C7KA 2KRJA 1KBCA 3L0TA 2DW2A 1UEAA 4A7BA 5JMYA 4H84A 1HTDA 1D8FA 4H2EA 4GR0A 4IN9A 1JJ9A 2DW1A 1RM8A 2TCLA 1D8MA 1R55A 1KUHA 3NX7A 1BQOA 3BA0A 3L0VA 5D7WA 4HMAA 4EFSA 3LE9A 4PKTA 2JT5A 1BUDA 3F16A 1DMTA 2CKIA 1MMPA 1YOUA 1EUBA 1CQRA 2OXUA 3N2UA 1ZP5A 4H76A 1BUVM 3RTTA 4WKEA 456CA 5BOYA 2E3XA 1ATLA 1CXVA 5D1TA 1OS9A 3LEAA 4L6TA 4A3WA 1AKLA 2EROA 2OVXA 2USNA 1PWVA 1QICA 1BQQM 4JPAA 2W15A 1JKYA 4HX3A 4FU4A 4PKWA 4WF6A 1R1IA 2ERQA 3F19A 1HOVA 3I7GA 1PWUA 3P24A 1IAEA 1I73A 4PKQA 1K7GA 5B5OA 2FV5A 1QJIA 3EDZA 1XFXA 3B8ZA 1AF0A 1SU3A 1XUDA 1FLSA 1HV5A 3I7IA 3O2XA 3EDIA 2DDYA 2OZRA 1C8TA 1I1IP 1Q3AA 3B92A 1B8YA 1BKCE 3LMCA 1OMJA 1UMSA 4JA1A 2A8HA 1OM7A 1JAPA 3EWJA 3VTGA 4DPEA 5D1SA 5I43A 3TT4A 3LUMA 4H30A 1KUGA 4JQGA 1KUFA 3EDGA 4R3VA 2Y6DA 2OXZA 3LQBA 1OS2A 3MA2A 4IUWA 2OW9A 3F1AA 2D1NA 4JIJA 4PKSA 4WKIA 2X3AA 2Y6CA 1JAQA 3WV3A 1YCMA 3LIRA 1OM6A 3KWVC 2MZHA 1SLMA 1CAQA 1Z3JA 2DDFA 1GE6A 1QIAA 1DTHA 1D7XA 3EHXA 2OW0A 1EB6A 1HFSA 3LKAA 1IAAA 1EAKA 1L6JA 3HBUP 4H49A 3LIKA 2MZEA 3SHIA 2WOAA 3DWBA 1JH1A 1ROSA 1CGEA 5CZMA 1R54A 2AIGP 1KUIA 3F18A 1UTTA 2O36A 1Y93A 2L0RA 1GKDA 3E8RA 3ZUKA 1YQYA 2OY4A 3DPFA 4WK7A 3USNA 1CIZA 1MMQA 1JANA 2HU6A 3O64A 1G4KA 2OW2A 2WO9A 2W0DA 1G12A 2K2GA 3N2VA 3VI1A 5BOTA 3CKIA 3KHIA 3HY7A 2DW0A 1GO7P 2FV9A 4FXQA 2YIGA 1GO8P 3WV2A 1I76A 3K7NA 3LK8A 1GKCA 1IAGA 2W14A 4I03A 3HB2P 3TVCA 3HYGA 4L19A 1XFVA 1SRPA 3HBVP 4G9LA 4XCTA
chains in the Genus database with same CATH superfamily
1PWQA 1R1HA 1SATA 1XUCA 3LJGA 4DF9A 2W13A 4ON1A 3B2ZA 4Q1LA 4GQLA 4H82A 4FVLA 3KRYA 4L7AA 3F17A 1JIZA 1OO9A 2OY2A 1A86A 5I2ZA 2J0TA 4PKRA 3UVCA 4AUOA 5I12A 1XFZA 1AYKA 1XFYA 1JAOA 1HFCA 2RJPA 2MLSA 2J83A 2JNPA 3LGPA 2WO8A 1KAPP 1ZS0A 2YUFA 3DSLA 966CA 2JT6A 5D2BA 3DTEA 2W12A 3EHYA 2OW1A 4XM7A 1XURA 3G42A 3U1RA 2RJQA 3ZVSA 1WNIA 4H1QA 4QKZA 1C3IA 2O3EA 1HY7A 4GR8A 1FM1A 4ZR5A 2K9CA 3KEKA 4GWNA 3LJTA 2AYKA 2Z2DA 3OHOA 3TS4A 1GE5A 1O0QA 3G5CA 2QPJA 1D5JA 1O0TA 3AIGA 3HDAP 2D1OA 2XS4A 4ILWD 1JIWP 1UMTA 1QIBA 1K7IA 2OVZA 3V96B 1SMPA 5I0LA 1ZVXA 5D1UA 4PKUA 2MLRA 3F15A 5H8XA 1KUKA 3AYUA 1JK3A 1PWWA 1ND1A 2I47A 4GWMA 3K7LA 4AIGA 2OI0A 4AXQA 3KECA 1B3DA 3LJZA 2POJA 4GR3A 3RTSA 4DD8A 1IACA 3KMEA 1K7QA 1BIWA 3DNGA 1QJJA 4PKVA 1BZSA 1UTZA 1G05A 3LQ0A 4L63A 5I4OA 1FBLA 3LUNA 1ZTQA 5B5PA 1XFWA 1MMRA 2CLTA 2V4BA 1RMZA 3ZXHA 1IADA 1G9KA 4XM8A 4G0DA 2E2DA 4XM6A 5CUHA 3DTIA 4AYKA 3Q2HA 1A85A 1ZXVA 1PWPA 1J7NA 4J4MA 3DL1A 5D3CA 4IJOA 1BKCA 3Q2GA 1ZXCA 2SRTA 5BPAA 1IABA 1ASTA 3KMCA 4DV8A 1BM6A 1G49A 3DPEA 4XBHA 2X7MA 1OM8A 1MNCA 3HY9A 3WV1A 2YB9A 1MMBA 1S4BP 4GF1A 3KEJA 3ELMA 1BKCI 1Y8JA 830CA 2JSDA 2X3BA 1QUAA 4CTHA 2OXWA 3HDBA 3EDHA 4H3XA 3LILA 5I3MA 2N8RA 4I35A 5L79A 2MZIA 1SLNA 4GUYA 5CXAA 3TSKA 3AYKA 3P1VA 1BSWA 4JP4A 4WZVA 1XM5A 1CGFA 2ERPA 5L7FA 1CGLA 5LABA 4FXYP 1XFUA 1GXDA 1CK7A 1YP1A 1R1JA 1USNA 1Y0VA 2XS3A 1H71P 2PJTA 1GE7A 2JIHA 2X3CA 3GBOA 3OHLA 1C7KA 2KRJA 1KBCA 3L0TA 2DW2A 1UEAA 4A7BA 5JMYA 4H84A 1HTDA 1D8FA 4H2EA 4GR0A 4IN9A 1JJ9A 2DW1A 1RM8A 2TCLA 1D8MA 1R55A 1KUHA 3NX7A 1BQOA 3BA0A 3L0VA 5D7WA 4HMAA 4EFSA 3LE9A 4PKTA 2JT5A 1BUDA 3F16A 1DMTA 2CKIA 1MMPA 1YOUA 1EUBA 1CQRA 2OXUA 3N2UA 1ZP5A 4H76A 1BUVM 3RTTA 4WKEA 456CA 5BOYA 2E3XA 1ATLA 1CXVA 5D1TA 1OS9A 3LEAA 4L6TA 4A3WA 1AKLA 2EROA 2OVXA 2USNA 1PWVA 1QICA 1BQQM 4JPAA 2W15A 1JKYA 4HX3A 4FU4A 4PKWA 4WF6A 1R1IA 2ERQA 3F19A 1HOVA 3I7GA 1PWUA 3P24A 1IAEA 1I73A 4PKQA 1K7GA 5B5OA 2FV5A 1QJIA 1XAXA 3EDZA 1XFXA 3B8ZA 1AF0A 1SU3A 1XUDA 1FLSA 1HV5A 3I7IA 3O2XA 3EDIA 2DDYA 2OZRA 1C8TA 1I1IP 1Q3AA 3B92A 1B8YA 1BKCE 3LMCA 1OMJA 1UMSA 4JA1A 2A8HA 1OM7A 1JAPA 3EWJA 3VTGA 4DPEA 5D1SA 5I43A 3TT4A 3LUMA 4H30A 1KUGA 4JQGA 1KUFA 3EDGA 4R3VA 2Y6DA 2OXZA 3LQBA 1OS2A 3MA2A 4IUWA 2OW9A 3F1AA 2D1NA 4JIJA 4PKSA 4WKIA 2X3AA 2Y6CA 1JAQA 3WV3A 1YCMA 3LIRA 1OM6A 3KWVC 1OZ9A 2MZHA 1SLMA 1CAQA 1Z3JA 2DDFA 1GE6A 1QIAA 1DTHA 1D7XA 3EHXA 2OW0A 1EB6A 1HFSA 3LKAA 1IAAA 1EAKA 1L6JA 3HBUP 4H49A 3LIKA 2MZEA 3SHIA 2WOAA 3DWBA 1JH1A 1ROSA 1CGEA 5CZMA 1R54A 2AIGP 1KUIA 3F18A 1UTTA 2O36A 1Y93A 2L0RA 1GKDA 3E8RA 3ZUKA 1YQYA 2OY4A 3DPFA 4WK7A 3USNA 1CIZA 1MMQA 1JANA 2HU6A 3O64A 1G4KA 2OW2A 2WO9A 2W0DA 1G12A 3DTKA 2K2GA 3N2VA 3VI1A 5BOTA 3CKIA 3KHIA 3HY7A 2DW0A 1GO7P 2FV9A 4FXQA 2YIGA 1GO8P 3WV2A 1I76A 3K7NA 3LK8A 1GKCA 1IAGA 2W14A 4I03A 3HB2P 3TVCA 3HYGA 4L19A 1TVIA 1SRPA 1XFVA 3HBVP 4G9LA 4XCTA
chains in the Genus database with same CATH topology
1PWQA 1R1HA 1SATA 1XUCA 3LJGA 4DF9A 2W13A 4ON1A 3B2ZA 4Q1LA 4GQLA 4H82A 4FVLA 3KRYA 4L7AA 3F17A 1JIZA 1OO9A 2OY2A 1A86A 5I2ZA 2J0TA 4PKRA 3UVCA 4AUOA 5I12A 1XFZA 1AYKA 1XFYA 1JAOA 1HFCA 2RJPA 2MLSA 2J83A 2JNPA 3LGPA 2WO8A 1KAPP 1ZS0A 2YUFA 3DSLA 966CA 2JT6A 5D2BA 3DTEA 2W12A 3EHYA 2OW1A 4XM7A 1XURA 3G42A 3U1RA 2RJQA 3ZVSA 1WNIA 4H1QA 4QKZA 1C3IA 2O3EA 1HY7A 4GR8A 1FM1A 4ZR5A 2K9CA 3KEKA 4GWNA 3LJTA 2AYKA 2Z2DA 3OHOA 3TS4A 1GE5A 1O0QA 3G5CA 2QPJA 1D5JA 1O0TA 3AIGA 3HDAP 2D1OA 2XS4A 4ILWD 1JIWP 1UMTA 1QIBA 1K7IA 2OVZA 3V96B 1SMPA 5I0LA 1ZVXA 5D1UA 4PKUA 2MLRA 3F15A 5H8XA 1KUKA 3AYUA 1JK3A 1PWWA 1ND1A 2I47A 4GWMA 3K7LA 4AIGA 2OI0A 4AXQA 3KECA 1B3DA 3LJZA 2POJA 4GR3A 3RTSA 4DD8A 1IACA 3KMEA 1K7QA 1BIWA 3DNGA 1QJJA 4PKVA 1BZSA 1UTZA 1G05A 3LQ0A 4L63A 5I4OA 1FBLA 3LUNA 1ZTQA 5B5PA 1XFWA 1MMRA 2CLTA 2V4BA 1RMZA 3ZXHA 1IADA 1G9KA 4XM8A 4G0DA 2E2DA 4XM6A 5CUHA 3DTIA 4AYKA 3Q2HA 1A85A 1ZXVA 1PWPA 1J7NA 4J4MA 3DL1A 5D3CA 4IJOA 1BKCA 3Q2GA 1ZXCA 2SRTA 5BPAA 1IABA 1ASTA 3KMCA 4DV8A 1BM6A 1G49A 3DPEA 4XBHA 2X7MA 1OM8A 1MNCA 3HY9A 3WV1A 2YB9A 1MMBA 1S4BP 4GF1A 3KEJA 3ELMA 1BKCI 1Y8JA 830CA 2JSDA 2X3BA 1QUAA 4CTHA 2OXWA 3HDBA 3EDHA 4H3XA 3LILA 5I3MA 2N8RA 4I35A 5L79A 2MZIA 1SLNA 4GUYA 5CXAA 3TSKA 3AYKA 3P1VA 1BSWA 4JP4A 4WZVA 1CGFA 2ERPA 5L7FA 1CGLA 5LABA 4FXYP 1XFUA 1GXDA 1CK7A 1YP1A 1R1JA 1USNA 1Y0VA 2XS3A 1H71P 2PJTA 1GE7A 2JIHA 2X3CA 3GBOA 3OHLA 1C7KA 2KRJA 1KBCA 3L0TA 2DW2A 1UEAA 4A7BA 5JMYA 4H84A 1HTDA 1D8FA 4H2EA 4GR0A 4IN9A 1JJ9A 2DW1A 1RM8A 2TCLA 1D8MA 1R55A 1KUHA 3NX7A 1BQOA 3BA0A 3L0VA 5D7WA 4HMAA 4EFSA 3LE9A 4PKTA 2JT5A 1BUDA 3F16A 1DMTA 2CKIA 1MMPA 1YOUA 1EUBA 1CQRA 2OXUA 3N2UA 1ZP5A 4H76A 1BUVM 3RTTA 4WKEA 456CA 5BOYA 2E3XA 1ATLA 1CXVA 5D1TA 1OS9A 3LEAA 4L6TA 4A3WA 1AKLA 2EROA 2OVXA 2USNA 1PWVA 1QICA 1BQQM 4JPAA 2W15A 1JKYA 4HX3A 4FU4A 4PKWA 4WF6A 1R1IA 2ERQA 3F19A 1HOVA 3I7GA 1PWUA 3P24A 1IAEA 1I73A 4PKQA 1K7GA 5B5OA 2FV5A 1QJIA 3EDZA 1XFXA 3B8ZA 1AF0A 1SU3A 1XUDA 1FLSA 1HV5A 3I7IA 3O2XA 3EDIA 2DDYA 2OZRA 1C8TA 1I1IP 1Q3AA 3B92A 1B8YA 1BKCE 3LMCA 1OMJA 1UMSA 4JA1A 2A8HA 1OM7A 1JAPA 3EWJA 3VTGA 4DPEA 5D1SA 5I43A 3TT4A 3LUMA 4H30A 1KUGA 4JQGA 1KUFA 3EDGA 4R3VA 2Y6DA 2OXZA 3LQBA 1OS2A 3MA2A 4IUWA 2OW9A 3F1AA 2D1NA 4JIJA 4PKSA 4WKIA 2X3AA 2Y6CA 1JAQA 3WV3A 1YCMA 3LIRA 1OM6A 3KWVC 2MZHA 1SLMA 1CAQA 1Z3JA 2DDFA 1GE6A 1QIAA 1DTHA 1D7XA 3EHXA 2OW0A 1EB6A 1HFSA 3LKAA 1IAAA 1EAKA 1L6JA 3HBUP 4H49A 3LIKA 2MZEA 3SHIA 2WOAA 3DWBA 1JH1A 1ROSA 1CGEA 5CZMA 1R54A 2AIGP 1KUIA 3F18A 1UTTA 2O36A 1Y93A 2L0RA 1GKDA 3E8RA 3ZUKA 1YQYA 2OY4A 3DPFA 4WK7A 3USNA 1CIZA 1MMQA 1JANA 2HU6A 3O64A 1G4KA 2OW2A 2WO9A 2W0DA 1G12A 3DTKA 2K2GA 3N2VA 3VI1A 5BOTA 3CKIA 3KHIA 3HY7A 2DW0A 1GO7P 2FV9A 4FXQA 2YIGA 1GO8P 3WV2A 1I76A 3K7NA 3LK8A 1GKCA 1IAGA 2W14A 4I03A 3HB2P 3TVCA 3HYGA 4L19A 1XFVA 1SRPA 3HBVP 4G9LA 4XCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWQ A;  1R1H A;  1SAT A;  1XUC A;  3LJG A;  4DF9 A;  2W13 A;  4ON1 A;  3B2Z A;  4Q1L A;  4GQL A;  4H82 A;  4FVL A;  3KRY A;  3F17 A;  1JIZ A;  1OO9 A;  2OY2 A;  1A86 A;  5I2Z A;  2J0T A;  4PKR A;  3UVC A;  4AUO A;  5I12 A;  1XFZ A;  1AYK A;  1XFY A;  1JAO A;  1HFC A;  2RJP A;  2MLS A;  2J83 A;  2JNP A;  3LGP A;  2WO8 A;  1KAP P;  1ZS0 A;  3DSL A;  966C A;  2JT6 A;  5D2B A;  2W12 A;  3EHY A;  2OW1 A;  4XM7 A;  1XUR A;  3G42 A;  3U1R A;  2RJQ A;  3ZVS A;  1WNI A;  4H1Q A;  4QKZ A;  1C3I A;  2O3E A;  1HY7 A;  4GR8 A;  1FM1 A;  4ZR5 A;  2K9C A;  3KEK A;  4GWN A;  3LJT A;  2AYK A;  2Z2D A;  3OHO A;  3TS4 A;  1GE5 A;  1O0Q A;  3G5C A;  2QPJ A;  1D5J A;  1O0T A;  3AIG A;  3HDA P;  2D1O A;  2XS4 A;  4ILW D;  1JIW P;  1UMT A;  1QIB A;  1K7I A;  2OVZ A;  3V96 B;  1SMP A;  5I0L A;  1ZVX A;  5D1U A;  4PKU A;  2MLR A;  3F15 A;  5H8X A;  1KUK A;  3AYU A;  1JK3 A;  1PWW A;  1ND1 A;  2I47 A;  4GWM A;  3K7L A;  4AIG A;  2OI0 A;  4AXQ A;  3KEC A;  1B3D A;  3LJZ A;  2POJ A;  4GR3 A;  3RTS A;  4DD8 A;  1IAC A;  3KME A;  1K7Q A;  1BIW A;  3DNG A;  1QJJ A;  4PKV A;  1BZS A;  1UTZ A;  1G05 A;  3LQ0 A;  4L63 A;  5I4O A;  1FBL A;  3LUN A;  1ZTQ A;  5B5P A;  1XFW A;  1MMR A;  2CLT A;  2V4B A;  1RMZ A;  3ZXH A;  1IAD A;  1G9K A;  4XM8 A;  4G0D A;  2E2D A;  4XM6 A;  5CUH A;  4AYK A;  3Q2H A;  1A85 A;  1ZXV A;  1PWP A;  1J7N A;  4J4M A;  3DL1 A;  5D3C A;  4IJO A;  1BKC A;  3Q2G A;  1ZXC A;  2SRT A;  5BPA A;  1IAB A;  1AST A;  3KMC A;  4DV8 A;  1BM6 A;  1G49 A;  3DPE A;  4XBH A;  2X7M A;  1OM8 A;  1MNC A;  3HY9 A;  3WV1 A;  2YB9 A;  1MMB A;  1S4B P;  4GF1 A;  3KEJ A;  3ELM A;  1BKC I;  1Y8J A;  830C A;  2JSD A;  2X3B A;  1QUA A;  4CTH A;  2OXW A;  3HDB A;  3EDH A;  4H3X A;  3LIL A;  5I3M A;  2N8R A;  4I35 A;  5L79 A;  2MZI A;  1SLN A;  4GUY A;  5CXA A;  3TSK A;  3AYK A;  3P1V A;  1BSW A;  4JP4 A;  4WZV A;  1CGF A;  2ERP A;  5L7F A;  1CGL A;  5LAB A;  4FXY P;  1XFU A;  1GXD A;  1CK7 A;  1YP1 A;  1R1J A;  1USN A;  1Y0V A;  2XS3 A;  1H71 P;  2PJT A;  1GE7 A;  2JIH A;  2X3C A;  3GBO A;  3OHL A;  1C7K A;  2KRJ A;  1KBC A;  3L0T A;  2DW2 A;  1UEA A;  4A7B A;  5JMY A;  4H84 A;  1HTD A;  1D8F A;  4H2E A;  4GR0 A;  4IN9 A;  1JJ9 A;  2DW1 A;  1RM8 A;  2TCL A;  1D8M A;  1R55 A;  1KUH A;  3NX7 A;  1BQO A;  3BA0 A;  3L0V A;  5D7W A;  4HMA A;  4EFS A;  3LE9 A;  4PKT A;  2JT5 A;  1BUD A;  3F16 A;  1DMT A;  2CKI A;  1MMP A;  1YOU A;  1EUB A;  1CQR A;  2OXU A;  3N2U A;  1ZP5 A;  4H76 A;  1BUV M;  3RTT A;  4WKE A;  456C A;  5BOY A;  2E3X A;  1ATL A;  1CXV A;  5D1T A;  1OS9 A;  3LEA A;  4L6T A;  4A3W A;  1AKL A;  2ERO A;  2OVX A;  2USN A;  1PWV A;  1QIC A;  1BQQ M;  4JPA A;  2W15 A;  1JKY A;  4HX3 A;  4FU4 A;  4PKW A;  4WF6 A;  1R1I A;  2ERQ A;  3F19 A;  1HOV A;  3I7G A;  1PWU A;  3P24 A;  1IAE A;  1I73 A;  4PKQ A;  1K7G A;  5B5O A;  2FV5 A;  1QJI A;  3EDZ A;  1XFX A;  3B8Z A;  1AF0 A;  1SU3 A;  1XUD A;  1FLS A;  1HV5 A;  3I7I A;  3O2X A;  3EDI A;  2DDY A;  2OZR A;  1C8T A;  1I1I P;  1Q3A A;  3B92 A;  1B8Y A;  1BKC E;  3LMC A;  1OMJ A;  1UMS A;  4JA1 A;  2A8H A;  1OM7 A;  1JAP A;  3EWJ A;  3VTG A;  4DPE A;  5D1S A;  5I43 A;  3TT4 A;  3LUM A;  4H30 A;  1KUG A;  4JQG A;  1KUF A;  3EDG A;  4R3V A;  2Y6D A;  2OXZ A;  3LQB A;  1OS2 A;  3MA2 A;  4IUW A;  2OW9 A;  3F1A A;  2D1N A;  4JIJ A;  4PKS A;  4WKI A;  2X3A A;  2Y6C A;  1JAQ A;  3WV3 A;  1YCM A;  3LIR A;  1OM6 A;  3KWV C;  2MZH A;  1SLM A;  1CAQ A;  1Z3J A;  2DDF A;  1GE6 A;  1QIA A;  1DTH A;  1D7X A;  3EHX A;  2OW0 A;  1EB6 A;  1HFS A;  3LKA A;  1IAA A;  1EAK A;  1L6J A;  3HBU P;  4H49 A;  3LIK A;  2MZE A;  3SHI A;  2WOA A;  3DWB A;  1JH1 A;  1ROS A;  1CGE A;  5CZM A;  1R54 A;  2AIG P;  1KUI A;  3F18 A;  1UTT A;  2O36 A;  1Y93 A;  2L0R A;  1GKD A;  3E8R A;  3ZUK A;  1YQY A;  2OY4 A;  3DPF A;  4WK7 A;  3USN A;  1CIZ A;  1MMQ A;  1JAN A;  2HU6 A;  3O64 A;  1G4K A;  2OW2 A;  2WO9 A;  2W0D A;  1G12 A;  2K2G A;  3N2V A;  3VI1 A;  5BOT A;  3CKI A;  3KHI A;  3HY7 A;  2DW0 A;  1GO7 P;  2FV9 A;  4FXQ A;  2YIG A;  1GO8 P;  3WV2 A;  1I76 A;  3K7N A;  3LK8 A;  1GKC A;  1IAG A;  2W14 A;  4I03 A;  3HB2 P;  3TVC A;  3HYG A;  4L19 A;  1XFV A;  1SRP A;  3HBV P;  4G9L A;  4XCT A; 
#chains in the Genus database with same CATH topology
 1PWQ A;  1R1H A;  1SAT A;  1XUC A;  3LJG A;  4DF9 A;  2W13 A;  4ON1 A;  3B2Z A;  4Q1L A;  4GQL A;  4H82 A;  4FVL A;  3KRY A;  4L7A A;  3F17 A;  1JIZ A;  1OO9 A;  2OY2 A;  1A86 A;  5I2Z A;  2J0T A;  4PKR A;  3UVC A;  4AUO A;  5I12 A;  1XFZ A;  1AYK A;  1XFY A;  1JAO A;  1HFC A;  2RJP A;  2MLS A;  2J83 A;  2JNP A;  3LGP A;  2WO8 A;  1KAP P;  1ZS0 A;  2YUF A;  3DSL A;  966C A;  2JT6 A;  5D2B A;  3DTE A;  2W12 A;  3EHY A;  2OW1 A;  4XM7 A;  1XUR A;  3G42 A;  3U1R A;  2RJQ A;  3ZVS A;  1WNI A;  4H1Q A;  4QKZ A;  1C3I A;  2O3E A;  1HY7 A;  4GR8 A;  1FM1 A;  4ZR5 A;  2K9C A;  3KEK A;  4GWN A;  3LJT A;  2AYK A;  2Z2D A;  3OHO A;  3TS4 A;  1GE5 A;  1O0Q A;  3G5C A;  2QPJ A;  1D5J A;  1O0T A;  3AIG A;  3HDA P;  2D1O A;  2XS4 A;  4ILW D;  1JIW P;  1UMT A;  1QIB A;  1K7I A;  2OVZ A;  3V96 B;  1SMP A;  5I0L A;  1ZVX A;  5D1U A;  4PKU A;  2MLR A;  3F15 A;  5H8X A;  1KUK A;  3AYU A;  1JK3 A;  1PWW A;  1ND1 A;  2I47 A;  4GWM A;  3K7L A;  4AIG A;  2OI0 A;  4AXQ A;  3KEC A;  1B3D A;  3LJZ A;  2POJ A;  4GR3 A;  3RTS A;  4DD8 A;  1IAC A;  3KME A;  1K7Q A;  1BIW A;  3DNG A;  1QJJ A;  4PKV A;  1BZS A;  1UTZ A;  1G05 A;  3LQ0 A;  4L63 A;  5I4O A;  1FBL A;  3LUN A;  1ZTQ A;  5B5P A;  1XFW A;  1MMR A;  2CLT A;  2V4B A;  1RMZ A;  3ZXH A;  1IAD A;  1G9K A;  4XM8 A;  4G0D A;  2E2D A;  4XM6 A;  5CUH A;  3DTI A;  4AYK A;  3Q2H A;  1A85 A;  1ZXV A;  1PWP A;  1J7N A;  4J4M A;  3DL1 A;  5D3C A;  4IJO A;  1BKC A;  3Q2G A;  1ZXC A;  2SRT A;  5BPA A;  1IAB A;  1AST A;  3KMC A;  4DV8 A;  1BM6 A;  1G49 A;  3DPE A;  4XBH A;  2X7M A;  1OM8 A;  1MNC A;  3HY9 A;  3WV1 A;  2YB9 A;  1MMB A;  1S4B P;  4GF1 A;  3KEJ A;  3ELM A;  1BKC I;  1Y8J A;  830C A;  2JSD A;  2X3B A;  1QUA A;  4CTH A;  2OXW A;  3HDB A;  3EDH A;  4H3X A;  3LIL A;  5I3M A;  2N8R A;  4I35 A;  5L79 A;  2MZI A;  1SLN A;  4GUY A;  5CXA A;  3TSK A;  3AYK A;  3P1V A;  1BSW A;  4JP4 A;  4WZV A;  1XM5 A;  1CGF A;  2ERP A;  5L7F A;  1CGL A;  5LAB A;  4FXY P;  1XFU A;  1GXD A;  1CK7 A;  1YP1 A;  1R1J A;  1USN A;  1Y0V A;  2XS3 A;  1H71 P;  2PJT A;  1GE7 A;  2JIH A;  2X3C A;  3GBO A;  3OHL A;  1C7K A;  2KRJ A;  1KBC A;  3L0T A;  2DW2 A;  1UEA A;  4A7B A;  5JMY A;  4H84 A;  1HTD A;  1D8F A;  4H2E A;  4GR0 A;  4IN9 A;  1JJ9 A;  2DW1 A;  1RM8 A;  2TCL A;  1D8M A;  1R55 A;  1KUH A;  3NX7 A;  1BQO A;  3BA0 A;  3L0V A;  5D7W A;  4HMA A;  4EFS A;  3LE9 A;  4PKT A;  2JT5 A;  1BUD A;  3F16 A;  1DMT A;  2CKI A;  1MMP A;  1YOU A;  1EUB A;  1CQR A;  2OXU A;  3N2U A;  1ZP5 A;  4H76 A;  1BUV M;  3RTT A;  4WKE A;  456C A;  5BOY A;  2E3X A;  1ATL A;  1CXV A;  5D1T A;  1OS9 A;  3LEA A;  4L6T A;  4A3W A;  1AKL A;  2ERO A;  2OVX A;  2USN A;  1PWV A;  1QIC A;  1BQQ M;  4JPA A;  2W15 A;  1JKY A;  4HX3 A;  4FU4 A;  4PKW A;  4WF6 A;  1R1I A;  2ERQ A;  3F19 A;  1HOV A;  3I7G A;  1PWU A;  3P24 A;  1IAE A;  1I73 A;  4PKQ A;  1K7G A;  5B5O A;  2FV5 A;  1QJI A;  1XAX A;  3EDZ A;  1XFX A;  3B8Z A;  1AF0 A;  1SU3 A;  1XUD A;  1FLS A;  1HV5 A;  3I7I A;  3O2X A;  3EDI A;  2DDY A;  2OZR A;  1C8T A;  1I1I P;  1Q3A A;  3B92 A;  1B8Y A;  1BKC E;  3LMC A;  1OMJ A;  1UMS A;  4JA1 A;  2A8H A;  1OM7 A;  1JAP A;  3EWJ A;  3VTG A;  4DPE A;  5D1S A;  5I43 A;  3TT4 A;  3LUM A;  4H30 A;  1KUG A;  4JQG A;  1KUF A;  3EDG A;  4R3V A;  2Y6D A;  2OXZ A;  3LQB A;  1OS2 A;  3MA2 A;  4IUW A;  2OW9 A;  3F1A A;  2D1N A;  4JIJ A;  4PKS A;  4WKI A;  2X3A A;  2Y6C A;  1JAQ A;  3WV3 A;  1YCM A;  3LIR A;  1OM6 A;  3KWV C;  1OZ9 A;  2MZH A;  1SLM A;  1CAQ A;  1Z3J A;  2DDF A;  1GE6 A;  1QIA A;  1DTH A;  1D7X A;  3EHX A;  2OW0 A;  1EB6 A;  1HFS A;  3LKA A;  1IAA A;  1EAK A;  1L6J A;  3HBU P;  4H49 A;  3LIK A;  2MZE A;  3SHI A;  2WOA A;  3DWB A;  1JH1 A;  1ROS A;  1CGE A;  5CZM A;  1R54 A;  2AIG P;  1KUI A;  3F18 A;  1UTT A;  2O36 A;  1Y93 A;  2L0R A;  1GKD A;  3E8R A;  3ZUK A;  1YQY A;  2OY4 A;  3DPF A;  4WK7 A;  3USN A;  1CIZ A;  1MMQ A;  1JAN A;  2HU6 A;  3O64 A;  1G4K A;  2OW2 A;  2WO9 A;  2W0D A;  1G12 A;  3DTK A;  2K2G A;  3N2V A;  3VI1 A;  5BOT A;  3CKI A;  3KHI A;  3HY7 A;  2DW0 A;  1GO7 P;  2FV9 A;  4FXQ A;  2YIG A;  1GO8 P;  3WV2 A;  1I76 A;  3K7N A;  3LK8 A;  1GKC A;  1IAG A;  2W14 A;  4I03 A;  3HB2 P;  3TVC A;  3HYG A;  4L19 A;  1TVI A;  1SRP A;  1XFV A;  3HBV P;  4G9L A;  4XCT A; 
#chains in the Genus database with same CATH homology
 1PWQ A;  1R1H A;  1SAT A;  1XUC A;  3LJG A;  4DF9 A;  2W13 A;  4ON1 A;  3B2Z A;  4Q1L A;  4GQL A;  4H82 A;  4FVL A;  3KRY A;  4L7A A;  3F17 A;  1JIZ A;  1OO9 A;  2OY2 A;  1A86 A;  5I2Z A;  2J0T A;  4PKR A;  3UVC A;  4AUO A;  5I12 A;  1XFZ A;  1AYK A;  1XFY A;  1JAO A;  1HFC A;  2RJP A;  2MLS A;  2J83 A;  2JNP A;  3LGP A;  2WO8 A;  1KAP P;  1ZS0 A;  2YUF A;  3DSL A;  966C A;  2JT6 A;  5D2B A;  3DTE A;  2W12 A;  3EHY A;  2OW1 A;  4XM7 A;  1XUR A;  3G42 A;  3U1R A;  2RJQ A;  3ZVS A;  1WNI A;  4H1Q A;  4QKZ A;  1C3I A;  2O3E A;  1HY7 A;  4GR8 A;  1FM1 A;  4ZR5 A;  2K9C A;  3KEK A;  4GWN A;  3LJT A;  2AYK A;  2Z2D A;  3OHO A;  3TS4 A;  1GE5 A;  1O0Q A;  3G5C A;  2QPJ A;  1D5J A;  1O0T A;  3AIG A;  3HDA P;  2D1O A;  2XS4 A;  4ILW D;  1JIW P;  1UMT A;  1QIB A;  1K7I A;  2OVZ A;  3V96 B;  1SMP A;  5I0L A;  1ZVX A;  5D1U A;  4PKU A;  2MLR A;  3F15 A;  5H8X A;  1KUK A;  3AYU A;  1JK3 A;  1PWW A;  1ND1 A;  2I47 A;  4GWM A;  3K7L A;  4AIG A;  2OI0 A;  4AXQ A;  3KEC A;  1B3D A;  3LJZ A;  2POJ A;  4GR3 A;  3RTS A;  4DD8 A;  1IAC A;  3KME A;  1K7Q A;  1BIW A;  3DNG A;  1QJJ A;  4PKV A;  1BZS A;  1UTZ A;  1G05 A;  3LQ0 A;  4L63 A;  5I4O A;  1FBL A;  3LUN A;  1ZTQ A;  5B5P A;  1XFW A;  1MMR A;  2CLT A;  2V4B A;  1RMZ A;  3ZXH A;  1IAD A;  1G9K A;  4XM8 A;  4G0D A;  2E2D A;  4XM6 A;  5CUH A;  3DTI A;  4AYK A;  3Q2H A;  1A85 A;  1ZXV A;  1PWP A;  1J7N A;  4J4M A;  3DL1 A;  5D3C A;  4IJO A;  1BKC A;  3Q2G A;  1ZXC A;  2SRT A;  5BPA A;  1IAB A;  1AST A;  3KMC A;  4DV8 A;  1BM6 A;  1G49 A;  3DPE A;  4XBH A;  2X7M A;  1OM8 A;  1MNC A;  3HY9 A;  3WV1 A;  2YB9 A;  1MMB A;  1S4B P;  4GF1 A;  3KEJ A;  3ELM A;  1BKC I;  1Y8J A;  830C A;  2JSD A;  2X3B A;  1QUA A;  4CTH A;  2OXW A;  3HDB A;  3EDH A;  4H3X A;  3LIL A;  5I3M A;  2N8R A;  4I35 A;  5L79 A;  2MZI A;  1SLN A;  4GUY A;  5CXA A;  3TSK A;  3AYK A;  3P1V A;  1BSW A;  4JP4 A;  4WZV A;  1CGF A;  2ERP A;  5L7F A;  1CGL A;  5LAB A;  4FXY P;  1XFU A;  1GXD A;  1CK7 A;  1YP1 A;  1R1J A;  1USN A;  1Y0V A;  2XS3 A;  1H71 P;  2PJT A;  1GE7 A;  2JIH A;  2X3C A;  3GBO A;  3OHL A;  1C7K A;  2KRJ A;  1KBC A;  3L0T A;  2DW2 A;  1UEA A;  4A7B A;  5JMY A;  4H84 A;  1HTD A;  1D8F A;  4H2E A;  4GR0 A;  4IN9 A;  1JJ9 A;  2DW1 A;  1RM8 A;  2TCL A;  1D8M A;  1R55 A;  1KUH A;  3NX7 A;  1BQO A;  3BA0 A;  3L0V A;  5D7W A;  4HMA A;  4EFS A;  3LE9 A;  4PKT A;  2JT5 A;  1BUD A;  3F16 A;  1DMT A;  2CKI A;  1MMP A;  1YOU A;  1EUB A;  1CQR A;  2OXU A;  3N2U A;  1ZP5 A;  4H76 A;  1BUV M;  3RTT A;  4WKE A;  456C A;  5BOY A;  2E3X A;  1ATL A;  1CXV A;  5D1T A;  1OS9 A;  3LEA A;  4L6T A;  4A3W A;  1AKL A;  2ERO A;  2OVX A;  2USN A;  1PWV A;  1QIC A;  1BQQ M;  4JPA A;  2W15 A;  1JKY A;  4HX3 A;  4FU4 A;  4PKW A;  4WF6 A;  1R1I A;  2ERQ A;  3F19 A;  1HOV A;  3I7G A;  1PWU A;  3P24 A;  1IAE A;  1I73 A;  4PKQ A;  1K7G A;  5B5O A;  2FV5 A;  1QJI A;  3EDZ A;  1XFX A;  3B8Z A;  1AF0 A;  1SU3 A;  1XUD A;  1FLS A;  1HV5 A;  3I7I A;  3O2X A;  3EDI A;  2DDY A;  2OZR A;  1C8T A;  1I1I P;  1Q3A A;  3B92 A;  1B8Y A;  1BKC E;  3LMC A;  1OMJ A;  1UMS A;  4JA1 A;  2A8H A;  1OM7 A;  1JAP A;  3EWJ A;  3VTG A;  4DPE A;  5D1S A;  5I43 A;  3TT4 A;  3LUM A;  4H30 A;  1KUG A;  4JQG A;  1KUF A;  3EDG A;  4R3V A;  2Y6D A;  2OXZ A;  3LQB A;  1OS2 A;  3MA2 A;  4IUW A;  2OW9 A;  3F1A A;  2D1N A;  4JIJ A;  4PKS A;  4WKI A;  2X3A A;  2Y6C A;  1JAQ A;  3WV3 A;  1YCM A;  3LIR A;  1OM6 A;  3KWV C;  2MZH A;  1SLM A;  1CAQ A;  1Z3J A;  2DDF A;  1GE6 A;  1QIA A;  1DTH A;  1D7X A;  3EHX A;  2OW0 A;  1EB6 A;  1HFS A;  3LKA A;  1IAA A;  1EAK A;  1L6J A;  3HBU P;  4H49 A;  3LIK A;  2MZE A;  3SHI A;  2WOA A;  3DWB A;  1JH1 A;  1ROS A;  1CGE A;  5CZM A;  1R54 A;  2AIG P;  1KUI A;  3F18 A;  1UTT A;  2O36 A;  1Y93 A;  2L0R A;  1GKD A;  3E8R A;  3ZUK A;  1YQY A;  2OY4 A;  3DPF A;  4WK7 A;  3USN A;  1CIZ A;  1MMQ A;  1JAN A;  2HU6 A;  3O64 A;  1G4K A;  2OW2 A;  2WO9 A;  2W0D A;  1G12 A;  3DTK A;  2K2G A;  3N2V A;  3VI1 A;  5BOT A;  3CKI A;  3KHI A;  3HY7 A;  2DW0 A;  1GO7 P;  2FV9 A;  4FXQ A;  2YIG A;  1GO8 P;  3WV2 A;  1I76 A;  3K7N A;  3LK8 A;  1GKC A;  1IAG A;  2W14 A;  4I03 A;  3HB2 P;  3TVC A;  3HYG A;  4L19 A;  1XFV A;  1SRP A;  3HBV P;  4G9L A;  4XCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...