1BUDA

Acutolysin a from snake venom of agkistrodon acutus at ph 5.0
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
FQRYMEIVIVVDHSMVKKYNGDSDSIKAWVYEMINTITESYSYLKIDISLSGLEIWSGKDLIDVEASAGNTLKSFGEWRAKDLIHRISHDNAQLLTATDFDGATIGLAYVASMCNPKRSVGVIQDHSSVNRLVAITLAHEMAHNLGVSHDEGSCSCGGKSCIMSPSISDETIKYFSDCSYIQCRDYISKENPPCILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (ACUTOLYSIN A)
publication title Crystal structures of acutolysin A, a three-disulfide hemorrhagic zinc metalloproteinase from the snake venom of Agkistrodon acutus.
pubmed doi rcsb
total genus 73
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 1998-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1budA00
3LILA 1JJ9A 2K9CA 3EHXA 1UMTA 1BQQM 1R55A 1Y93A 1G49A 1BUDA 2RJQA 3WV1A 1XFUA 1JH1A 2OY2A 3B8ZA 1KUHA 1A86A 4H1QA 3CKIA 2N8RA 1CGEA 4IJOA 3USNA 2JT6A 1O0QA 1ND1A 3ZXHA 1SATA 3F15A 1BKCA 3LUNA 4FXQA 1JANA 1HTDA 3HBUP 1RMZA 4AYKA 4IUWA 2WO9A 3KEJA 3MA2A 4WZVA 4L19A 2I47A 1OMJA 5CUHA 3VI1A 2E2DA 1YOUA 1GE6A 2JIHA 1HFCA 1JIWP 4H30A 3I7GA 1FLSA 1XFVA 4G0DA 2RJPA 4XM7A 4H2EA 4XM8A 2O3EA 4H3XA 1YCMA 1S4BP 2ERQA 2DW1A 4WKIA 1GKCA 2XS3A 5L7FA 3Q2GA 1B3DA 4JP4A 3LIKA 3LJGA 1R1HA 1BQOA 3TS4A 1D7XA 1I76A 2SRTA 2W13A 1GE5A 1OM8A 1Y8JA 4AIGA 2X3AA 5I2ZA 1FM1A 1ZS0A 1OM6A 3L0VA 4I35A 1CGFA 1GO7P 3LQ0A 1D8MA 1KUFA 3G42A 1OM7A 1CIZA 3G5CA 2OI0A 2K2GA 1C3IA 2DDFA 3TSKA 1QUAA 1SLNA 1B8YA 2OVZA 1MMRA 1R54A 1ASTA 1DMTA 1ZP5A 2MLRA 3RTSA 3TT4A 1QICA 2W15A 2POJA 1XFYA 2W14A 1AKLA 2AYKA 4HMAA 3U1RA 4G9LA 4PKVA 3AYKA 1R1JA 3HDAP 5JMYA 3LEAA 4DV8A 2DDYA 1Z3JA 1A85A 1PWPA 1G9KA 1XFZA 1BZSA 3UVCA 2OZRA 1L6JA 4PKWA 3KWVC 3EHYA 1AYKA 1XUDA 2JSDA 3EWJA 1IAGA 5I43A 1SRPA 3B92A 1QJIA 2Y6DA 4GR3A 4HX3A 2OVXA 1DTHA 5D1UA 1R1IA 1ATLA 3F16A 3VTGA 2FV9A 1KUGA 1CXVA 3GBOA 1AF0A 1BKCI 1QIBA 2TCLA 3N2VA 3OHOA 3HYGA 3LK8A 2X3CA 1SMPA 2KRJA 2HU6A 1ROSA 3I7IA 4JPAA 3LJZA 4JIJA 3F19A 5I0LA 1G12A 1GO8P 1XFWA 4AUOA 2W0DA 3DL1A 1JAQA 2A8HA 4WF6A 1IACA 1ZTQA 2XS4A 3DSLA 3N2UA 2PJTA 4L6TA 4XCTA 2USNA 2JNPA 4PKQA 1ZVXA 3LMCA 1BUVM 3Q2HA 5CXAA 3ZVSA 2FV5A 1UTZA 2X3BA 3EDZA 4J4MA 4WKEA 5D1SA 5CZMA 1GKDA 3O64A 4FVLA 3EDHA 1XFXA 1D8FA 1XUCA 1GE7A 4I03A 2JT5A 2Y6CA 5BOTA 2WO8A 1YP1A 4XM6A 2OXUA 1FBLA 3NX7A 1G4KA 5H8XA 4PKSA 3KEKA 1WNIA 2MLSA 2OXWA 3LGPA 4H84A 3BA0A 2OW9A 2X7MA 2CKIA 1CAQA 1MMPA 1EAKA 3LKAA 4GR8A 1HOVA 3LQBA 3HBVP 3HB2P 3AIGA 1D5JA 2L0RA 2AIGP 2W12A 4H49A 4JQGA 4GWMA 5BPAA 4IN9A 3L0TA 2EROA 4DF9A 3V96B 3F18A 1K7GA 2J0TA 1O0TA 3HY9A 1RM8A 3B2ZA 2CLTA 3ZUKA 4AXQA 1SLMA 5BOYA 3AYUA 2ERPA 1SU3A 1I73A 1C7KA 3EDGA 5D7WA 4EFSA 1QIAA 5D3CA 2O36A 5B5PA 4GR0A 3LUMA 2DW2A 5D1TA 3KRYA 4PKTA 1CQRA 3KHIA 3LE9A 1IAEA 1UTTA 2D1NA 1IAAA 3KECA 3DWBA 1ZXVA 4WK7A 4A7BA 4XBHA 4Q1LA 1HV5A 3EDIA 2OW2A 3HY7A 5B5OA 1EUBA 1PWUA 1QJJA 4GWNA 3K7NA 5LABA 2OW0A 1PWQA 4GUYA 2WOAA 1EB6A 4JA1A 4R3VA 1OS9A 2MZIA 1YQYA 4DPEA 3KMEA 4ILWD 2Z2DA 3E8RA 1UMSA 2MZHA 1IABA 3F1AA 1HY7A 1MMQA 5I3MA 1KUKA 1I1IP 1MMBA 1G05A 2V4BA 4GQLA 1J7NA 3F17A 3DPEA 4GF1A 5L79A 2D1OA 3DNGA 2OY4A 1JAPA 1OS2A 1BSWA 2E3XA 4A3WA 5D2BA 4PKUA 5I4OA 3OHLA 5I12A 1XURA 1JAOA 1BIWA 3TVCA 3O2XA 3K7LA 4ZR5A 3WV2A 1K7IA 1MNCA 4FU4A 1USNA 3LJTA 4QKZA 4ON1A 2J83A 1BKCE 3DPFA 1IADA 1UEAA 4PKRA 1ZXCA 4DD8A 1KUIA 1JKYA 2YIGA 4CTHA 1GXDA 2YB9A 3RTTA 1K7QA 1JIZA 2QPJA 1CGLA 1JK3A 966CA 1KAPP 1Y0VA 1HFSA 2OW1A 1H71P 1KBCA 4FXYP 4H76A 1C8TA 3P24A 3HDBA 3P1VA 1OO9A 1BM6A 4H82A 3LIRA 1PWVA 1PWWA 830CA 2DW0A 456CA 3ELMA 2MZEA 4L63A 1CK7A 3WV3A 3KMCA 1Q3AA 3SHIA 2OXZA
chains in the Genus database with same CATH superfamily
3LILA 1JJ9A 2K9CA 3EHXA 1UMTA 1BQQM 1R55A 1Y93A 1G49A 1BUDA 2RJQA 3WV1A 1XFUA 1JH1A 2OY2A 3B8ZA 1KUHA 1A86A 4H1QA 3CKIA 2N8RA 1CGEA 4IJOA 3USNA 2JT6A 1O0QA 1ND1A 3ZXHA 1SATA 3F15A 1BKCA 3LUNA 4FXQA 1JANA 1HTDA 3HBUP 1RMZA 4AYKA 1XM5A 4IUWA 2WO9A 3KEJA 3MA2A 4WZVA 4L19A 2I47A 3DTKA 1OMJA 5CUHA 3VI1A 2E2DA 1YOUA 1GE6A 2JIHA 1HFCA 1JIWP 4H30A 3I7GA 1FLSA 1XFVA 4G0DA 2RJPA 4XM7A 4H2EA 4XM8A 2O3EA 4H3XA 1YCMA 1S4BP 2ERQA 2DW1A 4WKIA 1GKCA 2XS3A 5L7FA 3Q2GA 1B3DA 4JP4A 3LIKA 3LJGA 1R1HA 1BQOA 3TS4A 3DTIA 1TVIA 1D7XA 1I76A 2SRTA 2W13A 1GE5A 1OM8A 1Y8JA 4AIGA 2X3AA 5I2ZA 1FM1A 1ZS0A 3DTEA 1OM6A 3L0VA 4I35A 1XAXA 1CGFA 1GO7P 3LQ0A 1D8MA 1KUFA 3G42A 1OM7A 1CIZA 3G5CA 2OI0A 2K2GA 1C3IA 2DDFA 3TSKA 1QUAA 1SLNA 1B8YA 2OVZA 1MMRA 1R54A 1ASTA 1DMTA 1ZP5A 2MLRA 3RTSA 3TT4A 1QICA 2W15A 4L7AA 2POJA 1XFYA 2W14A 1AKLA 2AYKA 4HMAA 3U1RA 4G9LA 4PKVA 3AYKA 1R1JA 3HDAP 5JMYA 3LEAA 4DV8A 2DDYA 1Z3JA 1A85A 1PWPA 1G9KA 1XFZA 1BZSA 3UVCA 2OZRA 1L6JA 4PKWA 3KWVC 3EHYA 1AYKA 1XUDA 2JSDA 3EWJA 1IAGA 5I43A 1SRPA 3B92A 1QJIA 2Y6DA 4GR3A 4HX3A 2OVXA 1DTHA 5D1UA 1R1IA 1ATLA 2YUFA 3F16A 3VTGA 2FV9A 1KUGA 1CXVA 3GBOA 1AF0A 1BKCI 1QIBA 2TCLA 3N2VA 3OHOA 3HYGA 3LK8A 2X3CA 1SMPA 2KRJA 2HU6A 1ROSA 3I7IA 4JPAA 3LJZA 4JIJA 3F19A 5I0LA 1G12A 1GO8P 1XFWA 4AUOA 2W0DA 3DL1A 1JAQA 2A8HA 4WF6A 1IACA 1ZTQA 2XS4A 3DSLA 3N2UA 2PJTA 4L6TA 4XCTA 2USNA 2JNPA 4PKQA 1ZVXA 3LMCA 1BUVM 3Q2HA 5CXAA 3ZVSA 1OZ9A 2FV5A 1UTZA 2X3BA 3EDZA 4J4MA 4WKEA 5D1SA 5CZMA 1GKDA 3O64A 4FVLA 3EDHA 1XFXA 1D8FA 1XUCA 1GE7A 4I03A 2JT5A 2Y6CA 5BOTA 2WO8A 1YP1A 4XM6A 2OXUA 1FBLA 3NX7A 1G4KA 5H8XA 4PKSA 3KEKA 1WNIA 2MLSA 2OXWA 3LGPA 4H84A 3BA0A 2OW9A 2X7MA 2CKIA 1CAQA 1MMPA 1EAKA 3LKAA 4GR8A 1HOVA 3LQBA 3HBVP 3HB2P 3AIGA 1D5JA 2L0RA 2AIGP 2W12A 4H49A 4JQGA 4GWMA 5BPAA 4IN9A 3L0TA 2EROA 4DF9A 3V96B 3F18A 1K7GA 2J0TA 1O0TA 3HY9A 1RM8A 3B2ZA 2CLTA 3ZUKA 4AXQA 1SLMA 5BOYA 3AYUA 2ERPA 1SU3A 1I73A 1C7KA 3EDGA 5D7WA 4EFSA 1QIAA 5D3CA 2O36A 5B5PA 4GR0A 3LUMA 2DW2A 5D1TA 3KRYA 4PKTA 1CQRA 3KHIA 3LE9A 1IAEA 1UTTA 2D1NA 1IAAA 3KECA 3DWBA 1ZXVA 4WK7A 4A7BA 4XBHA 4Q1LA 1HV5A 3EDIA 2OW2A 3HY7A 5B5OA 1EUBA 1PWUA 1QJJA 4GWNA 3K7NA 5LABA 2OW0A 1PWQA 4GUYA 2WOAA 1EB6A 4JA1A 4R3VA 1OS9A 2MZIA 1YQYA 4DPEA 3KMEA 4ILWD 2Z2DA 3E8RA 1UMSA 2MZHA 1IABA 3F1AA 1HY7A 1MMQA 5I3MA 1KUKA 1I1IP 1MMBA 1G05A 2V4BA 4GQLA 1J7NA 3F17A 3DPEA 4GF1A 5L79A 2D1OA 3DNGA 2OY4A 1JAPA 1OS2A 1BSWA 2E3XA 4A3WA 5D2BA 4PKUA 5I4OA 3OHLA 5I12A 1XURA 1JAOA 1BIWA 3TVCA 3O2XA 3K7LA 4ZR5A 3WV2A 1K7IA 1MNCA 4FU4A 1USNA 3LJTA 4QKZA 4ON1A 2J83A 1BKCE 3DPFA 1IADA 1UEAA 4PKRA 1ZXCA 4DD8A 1KUIA 1JKYA 2YIGA 4CTHA 1GXDA 2YB9A 3RTTA 1K7QA 1JIZA 2QPJA 1CGLA 1JK3A 966CA 1KAPP 1Y0VA 1HFSA 2OW1A 1H71P 1KBCA 4FXYP 4H76A 1C8TA 3P24A 3HDBA 3P1VA 1OO9A 1BM6A 4H82A 3LIRA 1PWVA 1PWWA 830CA 2DW0A 456CA 3ELMA 2MZEA 4L63A 1CK7A 3WV3A 3KMCA 1Q3AA 3SHIA 2OXZA
chains in the Genus database with same CATH topology
3LILA 1JJ9A 2K9CA 3EHXA 1UMTA 1BQQM 1R55A 1Y93A 1G49A 1BUDA 2RJQA 3WV1A 1XFUA 1JH1A 2OY2A 3B8ZA 1KUHA 1A86A 4H1QA 3CKIA 2N8RA 1CGEA 4IJOA 3USNA 2JT6A 1O0QA 1ND1A 3ZXHA 1SATA 3F15A 1BKCA 3LUNA 4FXQA 1JANA 1HTDA 3HBUP 1RMZA 4AYKA 4IUWA 2WO9A 3KEJA 3MA2A 4WZVA 4L19A 2I47A 3DTKA 1OMJA 5CUHA 3VI1A 2E2DA 1YOUA 1GE6A 2JIHA 1HFCA 1JIWP 4H30A 3I7GA 1FLSA 1XFVA 4G0DA 2RJPA 4XM7A 4H2EA 4XM8A 2O3EA 4H3XA 1YCMA 1S4BP 2ERQA 2DW1A 4WKIA 1GKCA 2XS3A 5L7FA 3Q2GA 1B3DA 4JP4A 3LIKA 3LJGA 1R1HA 1BQOA 3TS4A 3DTIA 1D7XA 1I76A 2SRTA 2W13A 1GE5A 1OM8A 1Y8JA 4AIGA 2X3AA 5I2ZA 1FM1A 1ZS0A 3DTEA 1OM6A 3L0VA 4I35A 1CGFA 1GO7P 3LQ0A 1D8MA 1KUFA 3G42A 1OM7A 1CIZA 3G5CA 2OI0A 2K2GA 1C3IA 2DDFA 3TSKA 1QUAA 1SLNA 1B8YA 2OVZA 1MMRA 1R54A 1ASTA 1DMTA 1ZP5A 2MLRA 3RTSA 3TT4A 1QICA 2W15A 4L7AA 2POJA 1XFYA 2W14A 1AKLA 2AYKA 4HMAA 3U1RA 4G9LA 4PKVA 3AYKA 1R1JA 3HDAP 5JMYA 3LEAA 4DV8A 2DDYA 1Z3JA 1A85A 1PWPA 1G9KA 1XFZA 1BZSA 3UVCA 2OZRA 1L6JA 4PKWA 3KWVC 3EHYA 1AYKA 1XUDA 2JSDA 3EWJA 1IAGA 5I43A 1SRPA 3B92A 1QJIA 2Y6DA 4GR3A 4HX3A 2OVXA 1DTHA 5D1UA 1R1IA 1ATLA 2YUFA 3F16A 3VTGA 2FV9A 1KUGA 1CXVA 3GBOA 1AF0A 1BKCI 1QIBA 2TCLA 3N2VA 3OHOA 3HYGA 3LK8A 2X3CA 1SMPA 2KRJA 2HU6A 1ROSA 3I7IA 4JPAA 3LJZA 4JIJA 3F19A 5I0LA 1G12A 1GO8P 1XFWA 4AUOA 2W0DA 3DL1A 1JAQA 2A8HA 4WF6A 1IACA 1ZTQA 2XS4A 3DSLA 3N2UA 2PJTA 4L6TA 4XCTA 2USNA 2JNPA 4PKQA 1ZVXA 3LMCA 1BUVM 3Q2HA 5CXAA 3ZVSA 2FV5A 1UTZA 2X3BA 3EDZA 4J4MA 4WKEA 5D1SA 5CZMA 1GKDA 3O64A 4FVLA 3EDHA 1XFXA 1D8FA 1XUCA 1GE7A 4I03A 2JT5A 2Y6CA 5BOTA 2WO8A 1YP1A 4XM6A 2OXUA 1FBLA 3NX7A 1G4KA 5H8XA 4PKSA 3KEKA 1WNIA 2MLSA 2OXWA 3LGPA 4H84A 3BA0A 2OW9A 2X7MA 2CKIA 1CAQA 1MMPA 1EAKA 3LKAA 4GR8A 1HOVA 3LQBA 3HBVP 3HB2P 3AIGA 1D5JA 2L0RA 2AIGP 2W12A 4H49A 4JQGA 4GWMA 5BPAA 4IN9A 3L0TA 2EROA 4DF9A 3V96B 3F18A 1K7GA 2J0TA 1O0TA 3HY9A 1RM8A 3B2ZA 2CLTA 3ZUKA 4AXQA 1SLMA 5BOYA 3AYUA 2ERPA 1SU3A 1I73A 1C7KA 3EDGA 5D7WA 4EFSA 1QIAA 5D3CA 2O36A 5B5PA 4GR0A 3LUMA 2DW2A 5D1TA 3KRYA 4PKTA 1CQRA 3KHIA 3LE9A 1IAEA 1UTTA 2D1NA 1IAAA 3KECA 3DWBA 1ZXVA 4WK7A 4A7BA 4XBHA 4Q1LA 1HV5A 3EDIA 2OW2A 3HY7A 5B5OA 1EUBA 1PWUA 1QJJA 4GWNA 3K7NA 5LABA 2OW0A 1PWQA 4GUYA 2WOAA 1EB6A 4JA1A 4R3VA 1OS9A 2MZIA 1YQYA 4DPEA 3KMEA 4ILWD 2Z2DA 3E8RA 1UMSA 2MZHA 1IABA 3F1AA 1HY7A 1MMQA 5I3MA 1KUKA 1I1IP 1MMBA 1G05A 2V4BA 4GQLA 1J7NA 3F17A 3DPEA 4GF1A 5L79A 2D1OA 3DNGA 2OY4A 1JAPA 1OS2A 1BSWA 2E3XA 4A3WA 5D2BA 4PKUA 5I4OA 3OHLA 5I12A 1XURA 1JAOA 1BIWA 3TVCA 3O2XA 3K7LA 4ZR5A 3WV2A 1K7IA 1MNCA 4FU4A 1USNA 3LJTA 4QKZA 4ON1A 2J83A 1BKCE 3DPFA 1IADA 1UEAA 4PKRA 1ZXCA 4DD8A 1KUIA 1JKYA 2YIGA 4CTHA 1GXDA 2YB9A 3RTTA 1K7QA 1JIZA 2QPJA 1CGLA 1JK3A 966CA 1KAPP 1Y0VA 1HFSA 2OW1A 1H71P 1KBCA 4FXYP 4H76A 1C8TA 3P24A 3HDBA 3P1VA 1OO9A 1BM6A 4H82A 3LIRA 1PWVA 1PWWA 830CA 2DW0A 456CA 3ELMA 2MZEA 4L63A 1CK7A 3WV3A 3KMCA 1Q3AA 3SHIA 2OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIL A;  1JJ9 A;  2K9C A;  3EHX A;  1UMT A;  1BQQ M;  1R55 A;  1Y93 A;  1G49 A;  1BUD A;  2RJQ A;  3WV1 A;  1XFU A;  1JH1 A;  2OY2 A;  3B8Z A;  1KUH A;  1A86 A;  4H1Q A;  3CKI A;  2N8R A;  1CGE A;  4IJO A;  3USN A;  2JT6 A;  1O0Q A;  1ND1 A;  3ZXH A;  1SAT A;  3F15 A;  1BKC A;  3LUN A;  4FXQ A;  1JAN A;  1HTD A;  3HBU P;  1RMZ A;  4AYK A;  4IUW A;  2WO9 A;  3KEJ A;  3MA2 A;  4WZV A;  4L19 A;  2I47 A;  1OMJ A;  5CUH A;  3VI1 A;  2E2D A;  1YOU A;  1GE6 A;  2JIH A;  1HFC A;  1JIW P;  4H30 A;  3I7G A;  1FLS A;  1XFV A;  4G0D A;  2RJP A;  4XM7 A;  4H2E A;  4XM8 A;  2O3E A;  4H3X A;  1YCM A;  1S4B P;  2ERQ A;  2DW1 A;  4WKI A;  1GKC A;  2XS3 A;  5L7F A;  3Q2G A;  1B3D A;  4JP4 A;  3LIK A;  3LJG A;  1R1H A;  1BQO A;  3TS4 A;  1D7X A;  1I76 A;  2SRT A;  2W13 A;  1GE5 A;  1OM8 A;  1Y8J A;  4AIG A;  2X3A A;  5I2Z A;  1FM1 A;  1ZS0 A;  1OM6 A;  3L0V A;  4I35 A;  1CGF A;  1GO7 P;  3LQ0 A;  1D8M A;  1KUF A;  3G42 A;  1OM7 A;  1CIZ A;  3G5C A;  2OI0 A;  2K2G A;  1C3I A;  2DDF A;  3TSK A;  1QUA A;  1SLN A;  1B8Y A;  2OVZ A;  1MMR A;  1R54 A;  1AST A;  1DMT A;  1ZP5 A;  2MLR A;  3RTS A;  3TT4 A;  1QIC A;  2W15 A;  2POJ A;  1XFY A;  2W14 A;  1AKL A;  2AYK A;  4HMA A;  3U1R A;  4G9L A;  4PKV A;  3AYK A;  1R1J A;  3HDA P;  5JMY A;  3LEA A;  4DV8 A;  2DDY A;  1Z3J A;  1A85 A;  1PWP A;  1G9K A;  1XFZ A;  1BZS A;  3UVC A;  2OZR A;  1L6J A;  4PKW A;  3KWV C;  3EHY A;  1AYK A;  1XUD A;  2JSD A;  3EWJ A;  1IAG A;  5I43 A;  1SRP A;  3B92 A;  1QJI A;  2Y6D A;  4GR3 A;  4HX3 A;  2OVX A;  1DTH A;  5D1U A;  1R1I A;  1ATL A;  3F16 A;  3VTG A;  2FV9 A;  1KUG A;  1CXV A;  3GBO A;  1AF0 A;  1BKC I;  1QIB A;  2TCL A;  3N2V A;  3OHO A;  3HYG A;  3LK8 A;  2X3C A;  1SMP A;  2KRJ A;  2HU6 A;  1ROS A;  3I7I A;  4JPA A;  3LJZ A;  4JIJ A;  3F19 A;  5I0L A;  1G12 A;  1GO8 P;  1XFW A;  4AUO A;  2W0D A;  3DL1 A;  1JAQ A;  2A8H A;  4WF6 A;  1IAC A;  1ZTQ A;  2XS4 A;  3DSL A;  3N2U A;  2PJT A;  4L6T A;  4XCT A;  2USN A;  2JNP A;  4PKQ A;  1ZVX A;  3LMC A;  1BUV M;  3Q2H A;  5CXA A;  3ZVS A;  2FV5 A;  1UTZ A;  2X3B A;  3EDZ A;  4J4M A;  4WKE A;  5D1S A;  5CZM A;  1GKD A;  3O64 A;  4FVL A;  3EDH A;  1XFX A;  1D8F A;  1XUC A;  1GE7 A;  4I03 A;  2JT5 A;  2Y6C A;  5BOT A;  2WO8 A;  1YP1 A;  4XM6 A;  2OXU A;  1FBL A;  3NX7 A;  1G4K A;  5H8X A;  4PKS A;  3KEK A;  1WNI A;  2MLS A;  2OXW A;  3LGP A;  4H84 A;  3BA0 A;  2OW9 A;  2X7M A;  2CKI A;  1CAQ A;  1MMP A;  1EAK A;  3LKA A;  4GR8 A;  1HOV A;  3LQB A;  3HBV P;  3HB2 P;  3AIG A;  1D5J A;  2L0R A;  2AIG P;  2W12 A;  4H49 A;  4JQG A;  4GWM A;  5BPA A;  4IN9 A;  3L0T A;  2ERO A;  4DF9 A;  3V96 B;  3F18 A;  1K7G A;  2J0T A;  1O0T A;  3HY9 A;  1RM8 A;  3B2Z A;  2CLT A;  3ZUK A;  4AXQ A;  1SLM A;  5BOY A;  3AYU A;  2ERP A;  1SU3 A;  1I73 A;  1C7K A;  3EDG A;  5D7W A;  4EFS A;  1QIA A;  5D3C A;  2O36 A;  5B5P A;  4GR0 A;  3LUM A;  2DW2 A;  5D1T A;  3KRY A;  4PKT A;  1CQR A;  3KHI A;  3LE9 A;  1IAE A;  1UTT A;  2D1N A;  1IAA A;  3KEC A;  3DWB A;  1ZXV A;  4WK7 A;  4A7B A;  4XBH A;  4Q1L A;  1HV5 A;  3EDI A;  2OW2 A;  3HY7 A;  5B5O A;  1EUB A;  1PWU A;  1QJJ A;  4GWN A;  3K7N A;  5LAB A;  2OW0 A;  1PWQ A;  4GUY A;  2WOA A;  1EB6 A;  4JA1 A;  4R3V A;  1OS9 A;  2MZI A;  1YQY A;  4DPE A;  3KME A;  4ILW D;  2Z2D A;  3E8R A;  1UMS A;  2MZH A;  1IAB A;  3F1A A;  1HY7 A;  1MMQ A;  5I3M A;  1KUK A;  1I1I P;  1MMB A;  1G05 A;  2V4B A;  4GQL A;  1J7N A;  3F17 A;  3DPE A;  4GF1 A;  5L79 A;  2D1O A;  3DNG A;  2OY4 A;  1JAP A;  1OS2 A;  1BSW A;  2E3X A;  4A3W A;  5D2B A;  4PKU A;  5I4O A;  3OHL A;  5I12 A;  1XUR A;  1JAO A;  1BIW A;  3TVC A;  3O2X A;  3K7L A;  4ZR5 A;  3WV2 A;  1K7I A;  1MNC A;  4FU4 A;  1USN A;  3LJT A;  4QKZ A;  4ON1 A;  2J83 A;  1BKC E;  3DPF A;  1IAD A;  1UEA A;  4PKR A;  1ZXC A;  4DD8 A;  1KUI A;  1JKY A;  2YIG A;  4CTH A;  1GXD A;  2YB9 A;  3RTT A;  1K7Q A;  1JIZ A;  2QPJ A;  1CGL A;  1JK3 A;  966C A;  1KAP P;  1Y0V A;  1HFS A;  2OW1 A;  1H71 P;  1KBC A;  4FXY P;  4H76 A;  1C8T A;  3P24 A;  3HDB A;  3P1V A;  1OO9 A;  1BM6 A;  4H82 A;  3LIR A;  1PWV A;  1PWW A;  830C A;  2DW0 A;  456C A;  3ELM A;  2MZE A;  4L63 A;  1CK7 A;  3WV3 A;  3KMC A;  1Q3A A;  3SHI A;  2OXZ A; 
#chains in the Genus database with same CATH topology
 3LIL A;  1JJ9 A;  2K9C A;  3EHX A;  1UMT A;  1BQQ M;  1R55 A;  1Y93 A;  1G49 A;  1BUD A;  2RJQ A;  3WV1 A;  1XFU A;  1JH1 A;  2OY2 A;  3B8Z A;  1KUH A;  1A86 A;  4H1Q A;  3CKI A;  2N8R A;  1CGE A;  4IJO A;  3USN A;  2JT6 A;  1O0Q A;  1ND1 A;  3ZXH A;  1SAT A;  3F15 A;  1BKC A;  3LUN A;  4FXQ A;  1JAN A;  1HTD A;  3HBU P;  1RMZ A;  4AYK A;  1XM5 A;  4IUW A;  2WO9 A;  3KEJ A;  3MA2 A;  4WZV A;  4L19 A;  2I47 A;  3DTK A;  1OMJ A;  5CUH A;  3VI1 A;  2E2D A;  1YOU A;  1GE6 A;  2JIH A;  1HFC A;  1JIW P;  4H30 A;  3I7G A;  1FLS A;  1XFV A;  4G0D A;  2RJP A;  4XM7 A;  4H2E A;  4XM8 A;  2O3E A;  4H3X A;  1YCM A;  1S4B P;  2ERQ A;  2DW1 A;  4WKI A;  1GKC A;  2XS3 A;  5L7F A;  3Q2G A;  1B3D A;  4JP4 A;  3LIK A;  3LJG A;  1R1H A;  1BQO A;  3TS4 A;  3DTI A;  1TVI A;  1D7X A;  1I76 A;  2SRT A;  2W13 A;  1GE5 A;  1OM8 A;  1Y8J A;  4AIG A;  2X3A A;  5I2Z A;  1FM1 A;  1ZS0 A;  3DTE A;  1OM6 A;  3L0V A;  4I35 A;  1XAX A;  1CGF A;  1GO7 P;  3LQ0 A;  1D8M A;  1KUF A;  3G42 A;  1OM7 A;  1CIZ A;  3G5C A;  2OI0 A;  2K2G A;  1C3I A;  2DDF A;  3TSK A;  1QUA A;  1SLN A;  1B8Y A;  2OVZ A;  1MMR A;  1R54 A;  1AST A;  1DMT A;  1ZP5 A;  2MLR A;  3RTS A;  3TT4 A;  1QIC A;  2W15 A;  4L7A A;  2POJ A;  1XFY A;  2W14 A;  1AKL A;  2AYK A;  4HMA A;  3U1R A;  4G9L A;  4PKV A;  3AYK A;  1R1J A;  3HDA P;  5JMY A;  3LEA A;  4DV8 A;  2DDY A;  1Z3J A;  1A85 A;  1PWP A;  1G9K A;  1XFZ A;  1BZS A;  3UVC A;  2OZR A;  1L6J A;  4PKW A;  3KWV C;  3EHY A;  1AYK A;  1XUD A;  2JSD A;  3EWJ A;  1IAG A;  5I43 A;  1SRP A;  3B92 A;  1QJI A;  2Y6D A;  4GR3 A;  4HX3 A;  2OVX A;  1DTH A;  5D1U A;  1R1I A;  1ATL A;  2YUF A;  3F16 A;  3VTG A;  2FV9 A;  1KUG A;  1CXV A;  3GBO A;  1AF0 A;  1BKC I;  1QIB A;  2TCL A;  3N2V A;  3OHO A;  3HYG A;  3LK8 A;  2X3C A;  1SMP A;  2KRJ A;  2HU6 A;  1ROS A;  3I7I A;  4JPA A;  3LJZ A;  4JIJ A;  3F19 A;  5I0L A;  1G12 A;  1GO8 P;  1XFW A;  4AUO A;  2W0D A;  3DL1 A;  1JAQ A;  2A8H A;  4WF6 A;  1IAC A;  1ZTQ A;  2XS4 A;  3DSL A;  3N2U A;  2PJT A;  4L6T A;  4XCT A;  2USN A;  2JNP A;  4PKQ A;  1ZVX A;  3LMC A;  1BUV M;  3Q2H A;  5CXA A;  3ZVS A;  1OZ9 A;  2FV5 A;  1UTZ A;  2X3B A;  3EDZ A;  4J4M A;  4WKE A;  5D1S A;  5CZM A;  1GKD A;  3O64 A;  4FVL A;  3EDH A;  1XFX A;  1D8F A;  1XUC A;  1GE7 A;  4I03 A;  2JT5 A;  2Y6C A;  5BOT A;  2WO8 A;  1YP1 A;  4XM6 A;  2OXU A;  1FBL A;  3NX7 A;  1G4K A;  5H8X A;  4PKS A;  3KEK A;  1WNI A;  2MLS A;  2OXW A;  3LGP A;  4H84 A;  3BA0 A;  2OW9 A;  2X7M A;  2CKI A;  1CAQ A;  1MMP A;  1EAK A;  3LKA A;  4GR8 A;  1HOV A;  3LQB A;  3HBV P;  3HB2 P;  3AIG A;  1D5J A;  2L0R A;  2AIG P;  2W12 A;  4H49 A;  4JQG A;  4GWM A;  5BPA A;  4IN9 A;  3L0T A;  2ERO A;  4DF9 A;  3V96 B;  3F18 A;  1K7G A;  2J0T A;  1O0T A;  3HY9 A;  1RM8 A;  3B2Z A;  2CLT A;  3ZUK A;  4AXQ A;  1SLM A;  5BOY A;  3AYU A;  2ERP A;  1SU3 A;  1I73 A;  1C7K A;  3EDG A;  5D7W A;  4EFS A;  1QIA A;  5D3C A;  2O36 A;  5B5P A;  4GR0 A;  3LUM A;  2DW2 A;  5D1T A;  3KRY A;  4PKT A;  1CQR A;  3KHI A;  3LE9 A;  1IAE A;  1UTT A;  2D1N A;  1IAA A;  3KEC A;  3DWB A;  1ZXV A;  4WK7 A;  4A7B A;  4XBH A;  4Q1L A;  1HV5 A;  3EDI A;  2OW2 A;  3HY7 A;  5B5O A;  1EUB A;  1PWU A;  1QJJ A;  4GWN A;  3K7N A;  5LAB A;  2OW0 A;  1PWQ A;  4GUY A;  2WOA A;  1EB6 A;  4JA1 A;  4R3V A;  1OS9 A;  2MZI A;  1YQY A;  4DPE A;  3KME A;  4ILW D;  2Z2D A;  3E8R A;  1UMS A;  2MZH A;  1IAB A;  3F1A A;  1HY7 A;  1MMQ A;  5I3M A;  1KUK A;  1I1I P;  1MMB A;  1G05 A;  2V4B A;  4GQL A;  1J7N A;  3F17 A;  3DPE A;  4GF1 A;  5L79 A;  2D1O A;  3DNG A;  2OY4 A;  1JAP A;  1OS2 A;  1BSW A;  2E3X A;  4A3W A;  5D2B A;  4PKU A;  5I4O A;  3OHL A;  5I12 A;  1XUR A;  1JAO A;  1BIW A;  3TVC A;  3O2X A;  3K7L A;  4ZR5 A;  3WV2 A;  1K7I A;  1MNC A;  4FU4 A;  1USN A;  3LJT A;  4QKZ A;  4ON1 A;  2J83 A;  1BKC E;  3DPF A;  1IAD A;  1UEA A;  4PKR A;  1ZXC A;  4DD8 A;  1KUI A;  1JKY A;  2YIG A;  4CTH A;  1GXD A;  2YB9 A;  3RTT A;  1K7Q A;  1JIZ A;  2QPJ A;  1CGL A;  1JK3 A;  966C A;  1KAP P;  1Y0V A;  1HFS A;  2OW1 A;  1H71 P;  1KBC A;  4FXY P;  4H76 A;  1C8T A;  3P24 A;  3HDB A;  3P1V A;  1OO9 A;  1BM6 A;  4H82 A;  3LIR A;  1PWV A;  1PWW A;  830C A;  2DW0 A;  456C A;  3ELM A;  2MZE A;  4L63 A;  1CK7 A;  3WV3 A;  3KMC A;  1Q3A A;  3SHI A;  2OXZ A; 
#chains in the Genus database with same CATH homology
 3LIL A;  1JJ9 A;  2K9C A;  3EHX A;  1UMT A;  1BQQ M;  1R55 A;  1Y93 A;  1G49 A;  1BUD A;  2RJQ A;  3WV1 A;  1XFU A;  1JH1 A;  2OY2 A;  3B8Z A;  1KUH A;  1A86 A;  4H1Q A;  3CKI A;  2N8R A;  1CGE A;  4IJO A;  3USN A;  2JT6 A;  1O0Q A;  1ND1 A;  3ZXH A;  1SAT A;  3F15 A;  1BKC A;  3LUN A;  4FXQ A;  1JAN A;  1HTD A;  3HBU P;  1RMZ A;  4AYK A;  4IUW A;  2WO9 A;  3KEJ A;  3MA2 A;  4WZV A;  4L19 A;  2I47 A;  3DTK A;  1OMJ A;  5CUH A;  3VI1 A;  2E2D A;  1YOU A;  1GE6 A;  2JIH A;  1HFC A;  1JIW P;  4H30 A;  3I7G A;  1FLS A;  1XFV A;  4G0D A;  2RJP A;  4XM7 A;  4H2E A;  4XM8 A;  2O3E A;  4H3X A;  1YCM A;  1S4B P;  2ERQ A;  2DW1 A;  4WKI A;  1GKC A;  2XS3 A;  5L7F A;  3Q2G A;  1B3D A;  4JP4 A;  3LIK A;  3LJG A;  1R1H A;  1BQO A;  3TS4 A;  3DTI A;  1D7X A;  1I76 A;  2SRT A;  2W13 A;  1GE5 A;  1OM8 A;  1Y8J A;  4AIG A;  2X3A A;  5I2Z A;  1FM1 A;  1ZS0 A;  3DTE A;  1OM6 A;  3L0V A;  4I35 A;  1CGF A;  1GO7 P;  3LQ0 A;  1D8M A;  1KUF A;  3G42 A;  1OM7 A;  1CIZ A;  3G5C A;  2OI0 A;  2K2G A;  1C3I A;  2DDF A;  3TSK A;  1QUA A;  1SLN A;  1B8Y A;  2OVZ A;  1MMR A;  1R54 A;  1AST A;  1DMT A;  1ZP5 A;  2MLR A;  3RTS A;  3TT4 A;  1QIC A;  2W15 A;  4L7A A;  2POJ A;  1XFY A;  2W14 A;  1AKL A;  2AYK A;  4HMA A;  3U1R A;  4G9L A;  4PKV A;  3AYK A;  1R1J A;  3HDA P;  5JMY A;  3LEA A;  4DV8 A;  2DDY A;  1Z3J A;  1A85 A;  1PWP A;  1G9K A;  1XFZ A;  1BZS A;  3UVC A;  2OZR A;  1L6J A;  4PKW A;  3KWV C;  3EHY A;  1AYK A;  1XUD A;  2JSD A;  3EWJ A;  1IAG A;  5I43 A;  1SRP A;  3B92 A;  1QJI A;  2Y6D A;  4GR3 A;  4HX3 A;  2OVX A;  1DTH A;  5D1U A;  1R1I A;  1ATL A;  2YUF A;  3F16 A;  3VTG A;  2FV9 A;  1KUG A;  1CXV A;  3GBO A;  1AF0 A;  1BKC I;  1QIB A;  2TCL A;  3N2V A;  3OHO A;  3HYG A;  3LK8 A;  2X3C A;  1SMP A;  2KRJ A;  2HU6 A;  1ROS A;  3I7I A;  4JPA A;  3LJZ A;  4JIJ A;  3F19 A;  5I0L A;  1G12 A;  1GO8 P;  1XFW A;  4AUO A;  2W0D A;  3DL1 A;  1JAQ A;  2A8H A;  4WF6 A;  1IAC A;  1ZTQ A;  2XS4 A;  3DSL A;  3N2U A;  2PJT A;  4L6T A;  4XCT A;  2USN A;  2JNP A;  4PKQ A;  1ZVX A;  3LMC A;  1BUV M;  3Q2H A;  5CXA A;  3ZVS A;  2FV5 A;  1UTZ A;  2X3B A;  3EDZ A;  4J4M A;  4WKE A;  5D1S A;  5CZM A;  1GKD A;  3O64 A;  4FVL A;  3EDH A;  1XFX A;  1D8F A;  1XUC A;  1GE7 A;  4I03 A;  2JT5 A;  2Y6C A;  5BOT A;  2WO8 A;  1YP1 A;  4XM6 A;  2OXU A;  1FBL A;  3NX7 A;  1G4K A;  5H8X A;  4PKS A;  3KEK A;  1WNI A;  2MLS A;  2OXW A;  3LGP A;  4H84 A;  3BA0 A;  2OW9 A;  2X7M A;  2CKI A;  1CAQ A;  1MMP A;  1EAK A;  3LKA A;  4GR8 A;  1HOV A;  3LQB A;  3HBV P;  3HB2 P;  3AIG A;  1D5J A;  2L0R A;  2AIG P;  2W12 A;  4H49 A;  4JQG A;  4GWM A;  5BPA A;  4IN9 A;  3L0T A;  2ERO A;  4DF9 A;  3V96 B;  3F18 A;  1K7G A;  2J0T A;  1O0T A;  3HY9 A;  1RM8 A;  3B2Z A;  2CLT A;  3ZUK A;  4AXQ A;  1SLM A;  5BOY A;  3AYU A;  2ERP A;  1SU3 A;  1I73 A;  1C7K A;  3EDG A;  5D7W A;  4EFS A;  1QIA A;  5D3C A;  2O36 A;  5B5P A;  4GR0 A;  3LUM A;  2DW2 A;  5D1T A;  3KRY A;  4PKT A;  1CQR A;  3KHI A;  3LE9 A;  1IAE A;  1UTT A;  2D1N A;  1IAA A;  3KEC A;  3DWB A;  1ZXV A;  4WK7 A;  4A7B A;  4XBH A;  4Q1L A;  1HV5 A;  3EDI A;  2OW2 A;  3HY7 A;  5B5O A;  1EUB A;  1PWU A;  1QJJ A;  4GWN A;  3K7N A;  5LAB A;  2OW0 A;  1PWQ A;  4GUY A;  2WOA A;  1EB6 A;  4JA1 A;  4R3V A;  1OS9 A;  2MZI A;  1YQY A;  4DPE A;  3KME A;  4ILW D;  2Z2D A;  3E8R A;  1UMS A;  2MZH A;  1IAB A;  3F1A A;  1HY7 A;  1MMQ A;  5I3M A;  1KUK A;  1I1I P;  1MMB A;  1G05 A;  2V4B A;  4GQL A;  1J7N A;  3F17 A;  3DPE A;  4GF1 A;  5L79 A;  2D1O A;  3DNG A;  2OY4 A;  1JAP A;  1OS2 A;  1BSW A;  2E3X A;  4A3W A;  5D2B A;  4PKU A;  5I4O A;  3OHL A;  5I12 A;  1XUR A;  1JAO A;  1BIW A;  3TVC A;  3O2X A;  3K7L A;  4ZR5 A;  3WV2 A;  1K7I A;  1MNC A;  4FU4 A;  1USN A;  3LJT A;  4QKZ A;  4ON1 A;  2J83 A;  1BKC E;  3DPF A;  1IAD A;  1UEA A;  4PKR A;  1ZXC A;  4DD8 A;  1KUI A;  1JKY A;  2YIG A;  4CTH A;  1GXD A;  2YB9 A;  3RTT A;  1K7Q A;  1JIZ A;  2QPJ A;  1CGL A;  1JK3 A;  966C A;  1KAP P;  1Y0V A;  1HFS A;  2OW1 A;  1H71 P;  1KBC A;  4FXY P;  4H76 A;  1C8T A;  3P24 A;  3HDB A;  3P1V A;  1OO9 A;  1BM6 A;  4H82 A;  3LIR A;  1PWV A;  1PWW A;  830C A;  2DW0 A;  456C A;  3ELM A;  2MZE A;  4L63 A;  1CK7 A;  3WV3 A;  3KMC A;  1Q3A A;  3SHI A;  2OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...