1JAOA

Complex of 3-mercapto-2-benzylpropanoyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLO PROTEINASE-8 (MET80 FORM)
publication title X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jaoA00
1DTHA 1G4KA 3LKAA 1K7QA 1R54A 4L19A 4H1QA 3WV1A 2Z2DA 4J4MA 2D1OA 1YQYA 3LQBA 3O2XA 1AKLA 3EHYA 2OXUA 3LGPA 1BZSA 3HDBA 1WNIA 4R3VA 3EHXA 1GE7A 3K7NA 3WV2A 1BIWA 3NX7A 3LILA 4IJOA 1MMBA 1JIZA 2E2DA 4IN9A 4IUWA 4JQGA 4GWMA 1CGFA 3F16A 1JAQA 4EFSA 4XM8A 1OS9A 2MZHA 3LJZA 5I3MA 1GE5A 1SLMA 3F18A 2TCLA 1ZXVA 1QUAA 4XM6A 1XUDA 4AXQA 3G42A 1HY7A 1QJJA 4GR0A 2O3EA 1IACA 3Q2GA 1GO7P 2X3CA 1AF0A 3ZVSA 4AYKA 4WZVA 5D7WA 3LIRA 3DL1A 3KEJA 3USNA 1PWVA 1C7KA 4CTHA 2YIGA 5L79A 3KWVC 3VI1A 2OW0A 2JSDA 3HY9A 1D5JA 2ERQA 1D7XA 2Y6CA 3I7IA 4XBHA 1GKCA 4DV8A 1G9KA 1OO9A 2RJQA 1BKCE 1Y0VA 4PKWA 2XS4A 1ZTQA 2W13A 1RMZA 3HBVP 1QJIA 2FV5A 3K7LA 3KMEA 2RJPA 1OM8A 4ON1A 1ATLA 1G49A 1QIBA 2DW1A 1CGLA 1CXVA 1GKDA 1JJ9A 3DPFA 3RTSA 4AUOA 1HV5A 1IABA 3F15A 3DPEA 2WOAA 1I73A 2YB9A 1KUHA 5D1TA 4I35A 4GWNA 3KHIA 1JAOA 4DPEA 1MMPA 2V4BA 1UTTA 5I12A 1CAQA 2J83A 3HYGA 2OI0A 2I47A 4ILWD 4ZR5A 3UVCA 3VTGA 1EAKA 3DNGA 1L6JA 5D1UA 1BKCI 1FLSA 4FXQA 1ZP5A 4GR8A 2D1NA 1MMRA 2MZIA 1SU3A 4WK7A 1YP1A 1I76A 1BM6A 2WO9A 3BA0A 2O36A 4H3XA 1R1IA 1KUGA 1XURA 4XCTA 2L0RA 1I1IP 5I2ZA 1R1HA 1OS2A 1XUCA 3V96B 3F19A 3B92A 5I43A 3AYKA 4WKIA 1S4BP 2WO8A 4PKUA 830CA 4QKZA 4JA1A 2POJA 2OY4A 3AYUA 3LQ0A 3N2UA 1PWWA 3DSLA 1GE6A 3O64A 4JIJA 1IAGA 1MMQA 3LJGA 3TS4A 4DF9A 1K7IA 1KUKA 3N2VA 3OHOA 3G5CA 4PKVA 3F17A 1BKCA 3LUNA 5CZMA 1Q3AA 3L0TA 4WKEA 1OM6A 5B5PA 1JKYA 2K9CA 2OXZA 1ZVXA 2K2GA 3WV3A 1SMPA 1YCMA 3ZXHA 2MLRA 2JIHA 1UEAA 2W15A 4Q1LA 5D1SA 5D3CA 3HDAP 2X7MA 3P24A 2HU6A 5D2BA 1QICA 5H8XA 966CA 2KRJA 3TVCA 1BQQM 1FBLA 1CK7A 1EB6A 1G05A 5I0LA 3EWJA 3HBUP 1HOVA 1SRPA 1BSWA 5JMYA 4WF6A 1HTDA 3LUMA 4H84A 1HFCA 2PJTA 4L6TA 5L7FA 1MNCA 3ZUKA 3TSKA 1BUVM 2MLSA 2JNPA 1PWQA 4I03A 2DW0A 1GO8P 2W0DA 4PKSA 3L0VA 4PKTA 1D8FA 1J7NA 1XFVA 1D8MA 4FU4A 3B2ZA 3CKIA 4G0DA 3RTTA 5LABA 4AIGA 1DMTA 1B3DA 1R55A 2W14A 3Q2HA 1PWUA 2OW9A 4G9LA 1KUIA 1HFSA 3SHIA 1ND1A 4GR3A 4HX3A 1Y93A 3EDHA 5BPAA 1O0QA 2DW2A 2OZRA 3KRYA 1JANA 1EUBA 2Y6DA 4H82A 2E3XA 2CKIA 2X3BA 3LEAA 2AIGP 2JT5A 2EROA 2MZEA 1XFWA 4A7BA 2AYKA 1C3IA 3F1AA 3B8ZA 1CIZA 1R1JA 1UMSA 1CQRA 3LK8A 1KBCA 2OVZA 2QPJA 1UMTA 1USNA 4H30A 4PKQA 1JAPA 3DWBA 1PWPA 3AIGA 1SATA 3EDGA 4HMAA 4PKRA 1XFUA 1RM8A 1K7GA 1IAAA 5CXAA 1A85A 2DDYA 5B5OA 3LIKA 3MA2A 2USNA 3I7GA 1AYKA 1BQOA 3OHLA 5BOYA 5CUHA 2N8RA 4DD8A 4XM7A 456CA 1O0TA 4GUYA 5I4OA 1OMJA 1QIAA 3HY7A 1G12A 1KUFA 2CLTA 4FVLA 1JK3A 4L63A 1C8TA 2JT6A 1YOUA 4FXYP 3KMCA 1A86A 1H71P 2W12A 2XS3A 3EDZA 3GBOA 2OW2A 1BUDA 2FV9A 4H2EA 3LE9A 4GF1A 1Z3JA 1IAEA 1Y8JA 1ROSA 1XFXA 1IADA 3LJTA 2DDFA 1KAPP 3LMCA 2ERPA 2SRTA 3HB2P 4JP4A 1GXDA 1B8YA 1JH1A 1ZXCA 3KEKA 3EDIA 1ASTA 4GQLA 2X3AA 1FM1A 5BOTA 1ZS0A 1OM7A 1UTZA 4H49A 4H76A 2A8HA 4A3WA 2OXWA 3TT4A 3E8RA 1XFZA 3P1VA 2OVXA 1SLNA 2J0TA 2OW1A 1XFYA 1CGEA 3U1RA 3KECA 4JPAA 2OY2A 1JIWP 3ELMA
chains in the Genus database with same CATH superfamily
1DTHA 1G4KA 3LKAA 1K7QA 1R54A 4L19A 4H1QA 3WV1A 2Z2DA 4J4MA 2D1OA 1YQYA 3LQBA 3O2XA 1AKLA 3EHYA 2OXUA 3LGPA 1BZSA 3HDBA 1WNIA 4R3VA 3EHXA 1GE7A 3K7NA 3WV2A 1BIWA 3NX7A 3LILA 4IJOA 1MMBA 1JIZA 2E2DA 4IN9A 4IUWA 4JQGA 4GWMA 1CGFA 3F16A 1JAQA 4EFSA 4XM8A 1OS9A 2MZHA 3LJZA 5I3MA 1GE5A 1SLMA 3F18A 2TCLA 1ZXVA 1QUAA 4XM6A 1XUDA 4AXQA 3G42A 1HY7A 1QJJA 4GR0A 2O3EA 1IACA 3Q2GA 1GO7P 2X3CA 1AF0A 3ZVSA 4AYKA 4WZVA 5D7WA 3LIRA 3DL1A 3KEJA 3USNA 1PWVA 1C7KA 4CTHA 2YIGA 5L79A 3KWVC 3VI1A 2OW0A 2JSDA 3HY9A 1D5JA 2ERQA 1D7XA 3I7IA 2Y6CA 1XAXA 4XBHA 1GKCA 4DV8A 1G9KA 1OO9A 2RJQA 1BKCE 1Y0VA 4PKWA 2XS4A 1ZTQA 2W13A 1RMZA 3HBVP 1QJIA 2FV5A 3K7LA 3KMEA 2RJPA 1OM8A 3DTEA 4ON1A 1ATLA 1G49A 1QIBA 2DW1A 1CGLA 1CXVA 1GKDA 1JJ9A 3DPFA 3RTSA 4AUOA 1HV5A 1IABA 3F15A 3DPEA 3DTIA 2WOAA 1I73A 2YB9A 1KUHA 5D1TA 4I35A 1OZ9A 4GWNA 3KHIA 1JAOA 4DPEA 1MMPA 2V4BA 1UTTA 5I12A 1CAQA 2J83A 3HYGA 2OI0A 2I47A 4ILWD 4ZR5A 3UVCA 3VTGA 1EAKA 1TVIA 3DNGA 1L6JA 5D1UA 1BKCI 1FLSA 4FXQA 4L7AA 1ZP5A 4GR8A 2D1NA 1MMRA 2MZIA 1SU3A 4WK7A 1YP1A 1I76A 3DTKA 1BM6A 2WO9A 3BA0A 2O36A 4H3XA 1R1IA 1KUGA 1XURA 4XCTA 2L0RA 1I1IP 5I2ZA 1R1HA 1OS2A 1XUCA 3V96B 3F19A 3B92A 5I43A 3AYKA 4WKIA 1S4BP 2WO8A 4PKUA 830CA 4QKZA 4JA1A 2POJA 2OY4A 3AYUA 3LQ0A 3N2UA 1PWWA 3DSLA 1GE6A 3O64A 4JIJA 1IAGA 1MMQA 3LJGA 3TS4A 4DF9A 1K7IA 1KUKA 3N2VA 3OHOA 3G5CA 4PKVA 3F17A 1BKCA 3LUNA 5CZMA 1Q3AA 3L0TA 4WKEA 1OM6A 5B5PA 1JKYA 2K9CA 2OXZA 1ZVXA 2K2GA 3WV3A 1SMPA 1YCMA 3ZXHA 2MLRA 2JIHA 1UEAA 2W15A 4Q1LA 5D1SA 5D3CA 3HDAP 2X7MA 3P24A 2HU6A 5D2BA 1QICA 5H8XA 966CA 2KRJA 3TVCA 1BQQM 1FBLA 1CK7A 1EB6A 1G05A 5I0LA 3EWJA 3HBUP 1HOVA 1SRPA 1BSWA 5JMYA 4WF6A 1HTDA 3LUMA 4H84A 1HFCA 2PJTA 4L6TA 5L7FA 1MNCA 3ZUKA 3TSKA 1BUVM 2MLSA 2JNPA 2YUFA 1PWQA 4I03A 2DW0A 1GO8P 2W0DA 4PKSA 3L0VA 4PKTA 1D8FA 1J7NA 1XFVA 1D8MA 4FU4A 3B2ZA 3CKIA 4G0DA 3RTTA 5LABA 4AIGA 1DMTA 1B3DA 1R55A 2W14A 3Q2HA 1PWUA 2OW9A 4G9LA 1KUIA 1HFSA 3SHIA 1ND1A 4GR3A 4HX3A 1Y93A 3EDHA 5BPAA 1O0QA 2DW2A 2OZRA 3KRYA 1JANA 1EUBA 2Y6DA 4H82A 2E3XA 2CKIA 2X3BA 3LEAA 2AIGP 2JT5A 2EROA 2MZEA 1XFWA 4A7BA 2AYKA 1C3IA 3F1AA 3B8ZA 1CIZA 1R1JA 1UMSA 1CQRA 3LK8A 1KBCA 2OVZA 2QPJA 1UMTA 1USNA 4H30A 4PKQA 1JAPA 3DWBA 1PWPA 3AIGA 1SATA 3EDGA 4HMAA 4PKRA 1XFUA 1RM8A 1K7GA 1IAAA 5CXAA 1A85A 2DDYA 5B5OA 3LIKA 3MA2A 2USNA 3I7GA 1AYKA 1BQOA 3OHLA 5BOYA 5CUHA 2N8RA 4DD8A 4XM7A 456CA 1O0TA 4GUYA 5I4OA 1OMJA 1QIAA 3HY7A 1G12A 1KUFA 2CLTA 4FVLA 1JK3A 4L63A 1C8TA 2JT6A 1YOUA 4FXYP 3KMCA 1A86A 1H71P 2W12A 2XS3A 3EDZA 3GBOA 2OW2A 1BUDA 2FV9A 1XM5A 4H2EA 3LE9A 4GF1A 1Z3JA 1IAEA 1Y8JA 1ROSA 1XFXA 1IADA 3LJTA 2DDFA 1KAPP 3LMCA 2ERPA 2SRTA 3HB2P 4JP4A 1GXDA 1B8YA 1JH1A 1ZXCA 3KEKA 3EDIA 1ASTA 4GQLA 2X3AA 1FM1A 5BOTA 1ZS0A 1OM7A 1UTZA 4H49A 4H76A 2A8HA 4A3WA 2OXWA 3TT4A 3E8RA 1XFZA 3P1VA 2OVXA 1SLNA 2J0TA 2OW1A 1XFYA 1CGEA 3U1RA 3KECA 4JPAA 2OY2A 1JIWP 3ELMA
chains in the Genus database with same CATH topology
1DTHA 1G4KA 3LKAA 1K7QA 1R54A 4L19A 4H1QA 3WV1A 2Z2DA 4J4MA 2D1OA 1YQYA 3LQBA 3O2XA 1AKLA 3EHYA 2OXUA 3LGPA 1BZSA 3HDBA 1WNIA 4R3VA 3EHXA 1GE7A 3K7NA 3WV2A 1BIWA 3NX7A 3LILA 4IJOA 1MMBA 1JIZA 2E2DA 4IN9A 4IUWA 4JQGA 4GWMA 1CGFA 3F16A 1JAQA 4EFSA 4XM8A 1OS9A 2MZHA 3LJZA 5I3MA 1GE5A 1SLMA 3F18A 2TCLA 1ZXVA 1QUAA 4XM6A 1XUDA 4AXQA 3G42A 1HY7A 1QJJA 4GR0A 2O3EA 1IACA 3Q2GA 1GO7P 2X3CA 1AF0A 3ZVSA 4AYKA 4WZVA 5D7WA 3LIRA 3DL1A 3KEJA 3USNA 1PWVA 1C7KA 4CTHA 2YIGA 5L79A 3KWVC 3VI1A 2OW0A 2JSDA 3HY9A 1D5JA 2ERQA 1D7XA 2Y6CA 3I7IA 4XBHA 1GKCA 4DV8A 1G9KA 1OO9A 2RJQA 1BKCE 1Y0VA 4PKWA 2XS4A 1ZTQA 2W13A 1RMZA 3HBVP 1QJIA 2FV5A 3K7LA 3KMEA 2RJPA 1OM8A 3DTEA 4ON1A 1ATLA 1G49A 1QIBA 2DW1A 1CGLA 1CXVA 1GKDA 1JJ9A 3DPFA 3RTSA 4AUOA 1HV5A 1IABA 3F15A 3DPEA 3DTIA 2WOAA 1I73A 2YB9A 1KUHA 5D1TA 4I35A 4GWNA 3KHIA 1JAOA 4DPEA 1MMPA 2V4BA 1UTTA 5I12A 1CAQA 2J83A 3HYGA 2OI0A 2I47A 4ILWD 4ZR5A 3UVCA 3VTGA 1EAKA 3DNGA 1L6JA 5D1UA 1BKCI 1FLSA 4FXQA 4L7AA 1ZP5A 4GR8A 2D1NA 1MMRA 2MZIA 1SU3A 4WK7A 1YP1A 1I76A 3DTKA 1BM6A 2WO9A 3BA0A 2O36A 4H3XA 1R1IA 1KUGA 1XURA 4XCTA 2L0RA 1I1IP 5I2ZA 1R1HA 1OS2A 1XUCA 3V96B 3F19A 3B92A 5I43A 3AYKA 4WKIA 1S4BP 2WO8A 4PKUA 830CA 4QKZA 4JA1A 2POJA 2OY4A 3AYUA 3LQ0A 3N2UA 1PWWA 3DSLA 1GE6A 3O64A 4JIJA 1IAGA 1MMQA 3LJGA 3TS4A 4DF9A 1K7IA 1KUKA 3N2VA 3OHOA 3G5CA 4PKVA 3F17A 1BKCA 3LUNA 5CZMA 1Q3AA 3L0TA 4WKEA 1OM6A 5B5PA 1JKYA 2K9CA 2OXZA 1ZVXA 2K2GA 3WV3A 1SMPA 1YCMA 3ZXHA 2MLRA 2JIHA 1UEAA 2W15A 4Q1LA 5D1SA 5D3CA 3HDAP 2X7MA 3P24A 2HU6A 5D2BA 1QICA 5H8XA 966CA 2KRJA 3TVCA 1BQQM 1FBLA 1CK7A 1EB6A 1G05A 5I0LA 3EWJA 3HBUP 1HOVA 1SRPA 1BSWA 5JMYA 4WF6A 1HTDA 3LUMA 4H84A 1HFCA 2PJTA 4L6TA 5L7FA 1MNCA 3ZUKA 3TSKA 1BUVM 2MLSA 2JNPA 2YUFA 1PWQA 4I03A 2DW0A 1GO8P 2W0DA 4PKSA 3L0VA 4PKTA 1D8FA 1J7NA 1XFVA 1D8MA 4FU4A 3B2ZA 3CKIA 4G0DA 3RTTA 5LABA 4AIGA 1DMTA 1B3DA 1R55A 2W14A 3Q2HA 1PWUA 2OW9A 4G9LA 1KUIA 1HFSA 3SHIA 1ND1A 4GR3A 4HX3A 1Y93A 3EDHA 5BPAA 1O0QA 2DW2A 2OZRA 3KRYA 1JANA 1EUBA 2Y6DA 4H82A 2E3XA 2CKIA 2X3BA 3LEAA 2AIGP 2JT5A 2EROA 2MZEA 1XFWA 4A7BA 2AYKA 1C3IA 3F1AA 3B8ZA 1CIZA 1R1JA 1UMSA 1CQRA 3LK8A 1KBCA 2OVZA 2QPJA 1UMTA 1USNA 4H30A 4PKQA 1JAPA 3DWBA 1PWPA 3AIGA 1SATA 3EDGA 4HMAA 4PKRA 1XFUA 1RM8A 1K7GA 1IAAA 5CXAA 1A85A 2DDYA 5B5OA 3LIKA 3MA2A 2USNA 3I7GA 1AYKA 1BQOA 3OHLA 5BOYA 5CUHA 2N8RA 4DD8A 4XM7A 456CA 1O0TA 4GUYA 5I4OA 1OMJA 1QIAA 3HY7A 1G12A 1KUFA 2CLTA 4FVLA 1JK3A 4L63A 1C8TA 2JT6A 1YOUA 4FXYP 3KMCA 1A86A 1H71P 2W12A 2XS3A 3EDZA 3GBOA 2OW2A 1BUDA 2FV9A 4H2EA 3LE9A 4GF1A 1Z3JA 1IAEA 1Y8JA 1ROSA 1XFXA 1IADA 3LJTA 2DDFA 1KAPP 3LMCA 2ERPA 2SRTA 3HB2P 4JP4A 1GXDA 1B8YA 1JH1A 1ZXCA 3KEKA 3EDIA 1ASTA 4GQLA 2X3AA 1FM1A 5BOTA 1ZS0A 1OM7A 1UTZA 4H49A 4H76A 2A8HA 4A3WA 2OXWA 3TT4A 3E8RA 1XFZA 3P1VA 2OVXA 1SLNA 2J0TA 2OW1A 1XFYA 1CGEA 3U1RA 3KECA 4JPAA 2OY2A 1JIWP 3ELMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTH A;  1G4K A;  3LKA A;  1K7Q A;  1R54 A;  4L19 A;  4H1Q A;  3WV1 A;  2Z2D A;  4J4M A;  2D1O A;  1YQY A;  3LQB A;  3O2X A;  1AKL A;  3EHY A;  2OXU A;  3LGP A;  1BZS A;  3HDB A;  1WNI A;  4R3V A;  3EHX A;  1GE7 A;  3K7N A;  3WV2 A;  1BIW A;  3NX7 A;  3LIL A;  4IJO A;  1MMB A;  1JIZ A;  2E2D A;  4IN9 A;  4IUW A;  4JQG A;  4GWM A;  1CGF A;  3F16 A;  1JAQ A;  4EFS A;  4XM8 A;  1OS9 A;  2MZH A;  3LJZ A;  5I3M A;  1GE5 A;  1SLM A;  3F18 A;  2TCL A;  1ZXV A;  1QUA A;  4XM6 A;  1XUD A;  4AXQ A;  3G42 A;  1HY7 A;  1QJJ A;  4GR0 A;  2O3E A;  1IAC A;  3Q2G A;  1GO7 P;  2X3C A;  1AF0 A;  3ZVS A;  4AYK A;  4WZV A;  5D7W A;  3LIR A;  3DL1 A;  3KEJ A;  3USN A;  1PWV A;  1C7K A;  4CTH A;  2YIG A;  5L79 A;  3KWV C;  3VI1 A;  2OW0 A;  2JSD A;  3HY9 A;  1D5J A;  2ERQ A;  1D7X A;  2Y6C A;  3I7I A;  4XBH A;  1GKC A;  4DV8 A;  1G9K A;  1OO9 A;  2RJQ A;  1BKC E;  1Y0V A;  4PKW A;  2XS4 A;  1ZTQ A;  2W13 A;  1RMZ A;  3HBV P;  1QJI A;  2FV5 A;  3K7L A;  3KME A;  2RJP A;  1OM8 A;  4ON1 A;  1ATL A;  1G49 A;  1QIB A;  2DW1 A;  1CGL A;  1CXV A;  1GKD A;  1JJ9 A;  3DPF A;  3RTS A;  4AUO A;  1HV5 A;  1IAB A;  3F15 A;  3DPE A;  2WOA A;  1I73 A;  2YB9 A;  1KUH A;  5D1T A;  4I35 A;  4GWN A;  3KHI A;  1JAO A;  4DPE A;  1MMP A;  2V4B A;  1UTT A;  5I12 A;  1CAQ A;  2J83 A;  3HYG A;  2OI0 A;  2I47 A;  4ILW D;  4ZR5 A;  3UVC A;  3VTG A;  1EAK A;  3DNG A;  1L6J A;  5D1U A;  1BKC I;  1FLS A;  4FXQ A;  1ZP5 A;  4GR8 A;  2D1N A;  1MMR A;  2MZI A;  1SU3 A;  4WK7 A;  1YP1 A;  1I76 A;  1BM6 A;  2WO9 A;  3BA0 A;  2O36 A;  4H3X A;  1R1I A;  1KUG A;  1XUR A;  4XCT A;  2L0R A;  1I1I P;  5I2Z A;  1R1H A;  1OS2 A;  1XUC A;  3V96 B;  3F19 A;  3B92 A;  5I43 A;  3AYK A;  4WKI A;  1S4B P;  2WO8 A;  4PKU A;  830C A;  4QKZ A;  4JA1 A;  2POJ A;  2OY4 A;  3AYU A;  3LQ0 A;  3N2U A;  1PWW A;  3DSL A;  1GE6 A;  3O64 A;  4JIJ A;  1IAG A;  1MMQ A;  3LJG A;  3TS4 A;  4DF9 A;  1K7I A;  1KUK A;  3N2V A;  3OHO A;  3G5C A;  4PKV A;  3F17 A;  1BKC A;  3LUN A;  5CZM A;  1Q3A A;  3L0T A;  4WKE A;  1OM6 A;  5B5P A;  1JKY A;  2K9C A;  2OXZ A;  1ZVX A;  2K2G A;  3WV3 A;  1SMP A;  1YCM A;  3ZXH A;  2MLR A;  2JIH A;  1UEA A;  2W15 A;  4Q1L A;  5D1S A;  5D3C A;  3HDA P;  2X7M A;  3P24 A;  2HU6 A;  5D2B A;  1QIC A;  5H8X A;  966C A;  2KRJ A;  3TVC A;  1BQQ M;  1FBL A;  1CK7 A;  1EB6 A;  1G05 A;  5I0L A;  3EWJ A;  3HBU P;  1HOV A;  1SRP A;  1BSW A;  5JMY A;  4WF6 A;  1HTD A;  3LUM A;  4H84 A;  1HFC A;  2PJT A;  4L6T A;  5L7F A;  1MNC A;  3ZUK A;  3TSK A;  1BUV M;  2MLS A;  2JNP A;  1PWQ A;  4I03 A;  2DW0 A;  1GO8 P;  2W0D A;  4PKS A;  3L0V A;  4PKT A;  1D8F A;  1J7N A;  1XFV A;  1D8M A;  4FU4 A;  3B2Z A;  3CKI A;  4G0D A;  3RTT A;  5LAB A;  4AIG A;  1DMT A;  1B3D A;  1R55 A;  2W14 A;  3Q2H A;  1PWU A;  2OW9 A;  4G9L A;  1KUI A;  1HFS A;  3SHI A;  1ND1 A;  4GR3 A;  4HX3 A;  1Y93 A;  3EDH A;  5BPA A;  1O0Q A;  2DW2 A;  2OZR A;  3KRY A;  1JAN A;  1EUB A;  2Y6D A;  4H82 A;  2E3X A;  2CKI A;  2X3B A;  3LEA A;  2AIG P;  2JT5 A;  2ERO A;  2MZE A;  1XFW A;  4A7B A;  2AYK A;  1C3I A;  3F1A A;  3B8Z A;  1CIZ A;  1R1J A;  1UMS A;  1CQR A;  3LK8 A;  1KBC A;  2OVZ A;  2QPJ A;  1UMT A;  1USN A;  4H30 A;  4PKQ A;  1JAP A;  3DWB A;  1PWP A;  3AIG A;  1SAT A;  3EDG A;  4HMA A;  4PKR A;  1XFU A;  1RM8 A;  1K7G A;  1IAA A;  5CXA A;  1A85 A;  2DDY A;  5B5O A;  3LIK A;  3MA2 A;  2USN A;  3I7G A;  1AYK A;  1BQO A;  3OHL A;  5BOY A;  5CUH A;  2N8R A;  4DD8 A;  4XM7 A;  456C A;  1O0T A;  4GUY A;  5I4O A;  1OMJ A;  1QIA A;  3HY7 A;  1G12 A;  1KUF A;  2CLT A;  4FVL A;  1JK3 A;  4L63 A;  1C8T A;  2JT6 A;  1YOU A;  4FXY P;  3KMC A;  1A86 A;  1H71 P;  2W12 A;  2XS3 A;  3EDZ A;  3GBO A;  2OW2 A;  1BUD A;  2FV9 A;  4H2E A;  3LE9 A;  4GF1 A;  1Z3J A;  1IAE A;  1Y8J A;  1ROS A;  1XFX A;  1IAD A;  3LJT A;  2DDF A;  1KAP P;  3LMC A;  2ERP A;  2SRT A;  3HB2 P;  4JP4 A;  1GXD A;  1B8Y A;  1JH1 A;  1ZXC A;  3KEK A;  3EDI A;  1AST A;  4GQL A;  2X3A A;  1FM1 A;  5BOT A;  1ZS0 A;  1OM7 A;  1UTZ A;  4H49 A;  4H76 A;  2A8H A;  4A3W A;  2OXW A;  3TT4 A;  3E8R A;  1XFZ A;  3P1V A;  2OVX A;  1SLN A;  2J0T A;  2OW1 A;  1XFY A;  1CGE A;  3U1R A;  3KEC A;  4JPA A;  2OY2 A;  1JIW P;  3ELM A; 
#chains in the Genus database with same CATH topology
 1DTH A;  1G4K A;  3LKA A;  1K7Q A;  1R54 A;  4L19 A;  4H1Q A;  3WV1 A;  2Z2D A;  4J4M A;  2D1O A;  1YQY A;  3LQB A;  3O2X A;  1AKL A;  3EHY A;  2OXU A;  3LGP A;  1BZS A;  3HDB A;  1WNI A;  4R3V A;  3EHX A;  1GE7 A;  3K7N A;  3WV2 A;  1BIW A;  3NX7 A;  3LIL A;  4IJO A;  1MMB A;  1JIZ A;  2E2D A;  4IN9 A;  4IUW A;  4JQG A;  4GWM A;  1CGF A;  3F16 A;  1JAQ A;  4EFS A;  4XM8 A;  1OS9 A;  2MZH A;  3LJZ A;  5I3M A;  1GE5 A;  1SLM A;  3F18 A;  2TCL A;  1ZXV A;  1QUA A;  4XM6 A;  1XUD A;  4AXQ A;  3G42 A;  1HY7 A;  1QJJ A;  4GR0 A;  2O3E A;  1IAC A;  3Q2G A;  1GO7 P;  2X3C A;  1AF0 A;  3ZVS A;  4AYK A;  4WZV A;  5D7W A;  3LIR A;  3DL1 A;  3KEJ A;  3USN A;  1PWV A;  1C7K A;  4CTH A;  2YIG A;  5L79 A;  3KWV C;  3VI1 A;  2OW0 A;  2JSD A;  3HY9 A;  1D5J A;  2ERQ A;  1D7X A;  3I7I A;  2Y6C A;  1XAX A;  4XBH A;  1GKC A;  4DV8 A;  1G9K A;  1OO9 A;  2RJQ A;  1BKC E;  1Y0V A;  4PKW A;  2XS4 A;  1ZTQ A;  2W13 A;  1RMZ A;  3HBV P;  1QJI A;  2FV5 A;  3K7L A;  3KME A;  2RJP A;  1OM8 A;  3DTE A;  4ON1 A;  1ATL A;  1G49 A;  1QIB A;  2DW1 A;  1CGL A;  1CXV A;  1GKD A;  1JJ9 A;  3DPF A;  3RTS A;  4AUO A;  1HV5 A;  1IAB A;  3F15 A;  3DPE A;  3DTI A;  2WOA A;  1I73 A;  2YB9 A;  1KUH A;  5D1T A;  4I35 A;  1OZ9 A;  4GWN A;  3KHI A;  1JAO A;  4DPE A;  1MMP A;  2V4B A;  1UTT A;  5I12 A;  1CAQ A;  2J83 A;  3HYG A;  2OI0 A;  2I47 A;  4ILW D;  4ZR5 A;  3UVC A;  3VTG A;  1EAK A;  1TVI A;  3DNG A;  1L6J A;  5D1U A;  1BKC I;  1FLS A;  4FXQ A;  4L7A A;  1ZP5 A;  4GR8 A;  2D1N A;  1MMR A;  2MZI A;  1SU3 A;  4WK7 A;  1YP1 A;  1I76 A;  3DTK A;  1BM6 A;  2WO9 A;  3BA0 A;  2O36 A;  4H3X A;  1R1I A;  1KUG A;  1XUR A;  4XCT A;  2L0R A;  1I1I P;  5I2Z A;  1R1H A;  1OS2 A;  1XUC A;  3V96 B;  3F19 A;  3B92 A;  5I43 A;  3AYK A;  4WKI A;  1S4B P;  2WO8 A;  4PKU A;  830C A;  4QKZ A;  4JA1 A;  2POJ A;  2OY4 A;  3AYU A;  3LQ0 A;  3N2U A;  1PWW A;  3DSL A;  1GE6 A;  3O64 A;  4JIJ A;  1IAG A;  1MMQ A;  3LJG A;  3TS4 A;  4DF9 A;  1K7I A;  1KUK A;  3N2V A;  3OHO A;  3G5C A;  4PKV A;  3F17 A;  1BKC A;  3LUN A;  5CZM A;  1Q3A A;  3L0T A;  4WKE A;  1OM6 A;  5B5P A;  1JKY A;  2K9C A;  2OXZ A;  1ZVX A;  2K2G A;  3WV3 A;  1SMP A;  1YCM A;  3ZXH A;  2MLR A;  2JIH A;  1UEA A;  2W15 A;  4Q1L A;  5D1S A;  5D3C A;  3HDA P;  2X7M A;  3P24 A;  2HU6 A;  5D2B A;  1QIC A;  5H8X A;  966C A;  2KRJ A;  3TVC A;  1BQQ M;  1FBL A;  1CK7 A;  1EB6 A;  1G05 A;  5I0L A;  3EWJ A;  3HBU P;  1HOV A;  1SRP A;  1BSW A;  5JMY A;  4WF6 A;  1HTD A;  3LUM A;  4H84 A;  1HFC A;  2PJT A;  4L6T A;  5L7F A;  1MNC A;  3ZUK A;  3TSK A;  1BUV M;  2MLS A;  2JNP A;  2YUF A;  1PWQ A;  4I03 A;  2DW0 A;  1GO8 P;  2W0D A;  4PKS A;  3L0V A;  4PKT A;  1D8F A;  1J7N A;  1XFV A;  1D8M A;  4FU4 A;  3B2Z A;  3CKI A;  4G0D A;  3RTT A;  5LAB A;  4AIG A;  1DMT A;  1B3D A;  1R55 A;  2W14 A;  3Q2H A;  1PWU A;  2OW9 A;  4G9L A;  1KUI A;  1HFS A;  3SHI A;  1ND1 A;  4GR3 A;  4HX3 A;  1Y93 A;  3EDH A;  5BPA A;  1O0Q A;  2DW2 A;  2OZR A;  3KRY A;  1JAN A;  1EUB A;  2Y6D A;  4H82 A;  2E3X A;  2CKI A;  2X3B A;  3LEA A;  2AIG P;  2JT5 A;  2ERO A;  2MZE A;  1XFW A;  4A7B A;  2AYK A;  1C3I A;  3F1A A;  3B8Z A;  1CIZ A;  1R1J A;  1UMS A;  1CQR A;  3LK8 A;  1KBC A;  2OVZ A;  2QPJ A;  1UMT A;  1USN A;  4H30 A;  4PKQ A;  1JAP A;  3DWB A;  1PWP A;  3AIG A;  1SAT A;  3EDG A;  4HMA A;  4PKR A;  1XFU A;  1RM8 A;  1K7G A;  1IAA A;  5CXA A;  1A85 A;  2DDY A;  5B5O A;  3LIK A;  3MA2 A;  2USN A;  3I7G A;  1AYK A;  1BQO A;  3OHL A;  5BOY A;  5CUH A;  2N8R A;  4DD8 A;  4XM7 A;  456C A;  1O0T A;  4GUY A;  5I4O A;  1OMJ A;  1QIA A;  3HY7 A;  1G12 A;  1KUF A;  2CLT A;  4FVL A;  1JK3 A;  4L63 A;  1C8T A;  2JT6 A;  1YOU A;  4FXY P;  3KMC A;  1A86 A;  1H71 P;  2W12 A;  2XS3 A;  3EDZ A;  3GBO A;  2OW2 A;  1BUD A;  2FV9 A;  1XM5 A;  4H2E A;  3LE9 A;  4GF1 A;  1Z3J A;  1IAE A;  1Y8J A;  1ROS A;  1XFX A;  1IAD A;  3LJT A;  2DDF A;  1KAP P;  3LMC A;  2ERP A;  2SRT A;  3HB2 P;  4JP4 A;  1GXD A;  1B8Y A;  1JH1 A;  1ZXC A;  3KEK A;  3EDI A;  1AST A;  4GQL A;  2X3A A;  1FM1 A;  5BOT A;  1ZS0 A;  1OM7 A;  1UTZ A;  4H49 A;  4H76 A;  2A8H A;  4A3W A;  2OXW A;  3TT4 A;  3E8R A;  1XFZ A;  3P1V A;  2OVX A;  1SLN A;  2J0T A;  2OW1 A;  1XFY A;  1CGE A;  3U1R A;  3KEC A;  4JPA A;  2OY2 A;  1JIW P;  3ELM A; 
#chains in the Genus database with same CATH homology
 1DTH A;  1G4K A;  3LKA A;  1K7Q A;  1R54 A;  4L19 A;  4H1Q A;  3WV1 A;  2Z2D A;  4J4M A;  2D1O A;  1YQY A;  3LQB A;  3O2X A;  1AKL A;  3EHY A;  2OXU A;  3LGP A;  1BZS A;  3HDB A;  1WNI A;  4R3V A;  3EHX A;  1GE7 A;  3K7N A;  3WV2 A;  1BIW A;  3NX7 A;  3LIL A;  4IJO A;  1MMB A;  1JIZ A;  2E2D A;  4IN9 A;  4IUW A;  4JQG A;  4GWM A;  1CGF A;  3F16 A;  1JAQ A;  4EFS A;  4XM8 A;  1OS9 A;  2MZH A;  3LJZ A;  5I3M A;  1GE5 A;  1SLM A;  3F18 A;  2TCL A;  1ZXV A;  1QUA A;  4XM6 A;  1XUD A;  4AXQ A;  3G42 A;  1HY7 A;  1QJJ A;  4GR0 A;  2O3E A;  1IAC A;  3Q2G A;  1GO7 P;  2X3C A;  1AF0 A;  3ZVS A;  4AYK A;  4WZV A;  5D7W A;  3LIR A;  3DL1 A;  3KEJ A;  3USN A;  1PWV A;  1C7K A;  4CTH A;  2YIG A;  5L79 A;  3KWV C;  3VI1 A;  2OW0 A;  2JSD A;  3HY9 A;  1D5J A;  2ERQ A;  1D7X A;  2Y6C A;  3I7I A;  4XBH A;  1GKC A;  4DV8 A;  1G9K A;  1OO9 A;  2RJQ A;  1BKC E;  1Y0V A;  4PKW A;  2XS4 A;  1ZTQ A;  2W13 A;  1RMZ A;  3HBV P;  1QJI A;  2FV5 A;  3K7L A;  3KME A;  2RJP A;  1OM8 A;  3DTE A;  4ON1 A;  1ATL A;  1G49 A;  1QIB A;  2DW1 A;  1CGL A;  1CXV A;  1GKD A;  1JJ9 A;  3DPF A;  3RTS A;  4AUO A;  1HV5 A;  1IAB A;  3F15 A;  3DPE A;  3DTI A;  2WOA A;  1I73 A;  2YB9 A;  1KUH A;  5D1T A;  4I35 A;  4GWN A;  3KHI A;  1JAO A;  4DPE A;  1MMP A;  2V4B A;  1UTT A;  5I12 A;  1CAQ A;  2J83 A;  3HYG A;  2OI0 A;  2I47 A;  4ILW D;  4ZR5 A;  3UVC A;  3VTG A;  1EAK A;  3DNG A;  1L6J A;  5D1U A;  1BKC I;  1FLS A;  4FXQ A;  4L7A A;  1ZP5 A;  4GR8 A;  2D1N A;  1MMR A;  2MZI A;  1SU3 A;  4WK7 A;  1YP1 A;  1I76 A;  3DTK A;  1BM6 A;  2WO9 A;  3BA0 A;  2O36 A;  4H3X A;  1R1I A;  1KUG A;  1XUR A;  4XCT A;  2L0R A;  1I1I P;  5I2Z A;  1R1H A;  1OS2 A;  1XUC A;  3V96 B;  3F19 A;  3B92 A;  5I43 A;  3AYK A;  4WKI A;  1S4B P;  2WO8 A;  4PKU A;  830C A;  4QKZ A;  4JA1 A;  2POJ A;  2OY4 A;  3AYU A;  3LQ0 A;  3N2U A;  1PWW A;  3DSL A;  1GE6 A;  3O64 A;  4JIJ A;  1IAG A;  1MMQ A;  3LJG A;  3TS4 A;  4DF9 A;  1K7I A;  1KUK A;  3N2V A;  3OHO A;  3G5C A;  4PKV A;  3F17 A;  1BKC A;  3LUN A;  5CZM A;  1Q3A A;  3L0T A;  4WKE A;  1OM6 A;  5B5P A;  1JKY A;  2K9C A;  2OXZ A;  1ZVX A;  2K2G A;  3WV3 A;  1SMP A;  1YCM A;  3ZXH A;  2MLR A;  2JIH A;  1UEA A;  2W15 A;  4Q1L A;  5D1S A;  5D3C A;  3HDA P;  2X7M A;  3P24 A;  2HU6 A;  5D2B A;  1QIC A;  5H8X A;  966C A;  2KRJ A;  3TVC A;  1BQQ M;  1FBL A;  1CK7 A;  1EB6 A;  1G05 A;  5I0L A;  3EWJ A;  3HBU P;  1HOV A;  1SRP A;  1BSW A;  5JMY A;  4WF6 A;  1HTD A;  3LUM A;  4H84 A;  1HFC A;  2PJT A;  4L6T A;  5L7F A;  1MNC A;  3ZUK A;  3TSK A;  1BUV M;  2MLS A;  2JNP A;  2YUF A;  1PWQ A;  4I03 A;  2DW0 A;  1GO8 P;  2W0D A;  4PKS A;  3L0V A;  4PKT A;  1D8F A;  1J7N A;  1XFV A;  1D8M A;  4FU4 A;  3B2Z A;  3CKI A;  4G0D A;  3RTT A;  5LAB A;  4AIG A;  1DMT A;  1B3D A;  1R55 A;  2W14 A;  3Q2H A;  1PWU A;  2OW9 A;  4G9L A;  1KUI A;  1HFS A;  3SHI A;  1ND1 A;  4GR3 A;  4HX3 A;  1Y93 A;  3EDH A;  5BPA A;  1O0Q A;  2DW2 A;  2OZR A;  3KRY A;  1JAN A;  1EUB A;  2Y6D A;  4H82 A;  2E3X A;  2CKI A;  2X3B A;  3LEA A;  2AIG P;  2JT5 A;  2ERO A;  2MZE A;  1XFW A;  4A7B A;  2AYK A;  1C3I A;  3F1A A;  3B8Z A;  1CIZ A;  1R1J A;  1UMS A;  1CQR A;  3LK8 A;  1KBC A;  2OVZ A;  2QPJ A;  1UMT A;  1USN A;  4H30 A;  4PKQ A;  1JAP A;  3DWB A;  1PWP A;  3AIG A;  1SAT A;  3EDG A;  4HMA A;  4PKR A;  1XFU A;  1RM8 A;  1K7G A;  1IAA A;  5CXA A;  1A85 A;  2DDY A;  5B5O A;  3LIK A;  3MA2 A;  2USN A;  3I7G A;  1AYK A;  1BQO A;  3OHL A;  5BOY A;  5CUH A;  2N8R A;  4DD8 A;  4XM7 A;  456C A;  1O0T A;  4GUY A;  5I4O A;  1OMJ A;  1QIA A;  3HY7 A;  1G12 A;  1KUF A;  2CLT A;  4FVL A;  1JK3 A;  4L63 A;  1C8T A;  2JT6 A;  1YOU A;  4FXY P;  3KMC A;  1A86 A;  1H71 P;  2W12 A;  2XS3 A;  3EDZ A;  3GBO A;  2OW2 A;  1BUD A;  2FV9 A;  4H2E A;  3LE9 A;  4GF1 A;  1Z3J A;  1IAE A;  1Y8J A;  1ROS A;  1XFX A;  1IAD A;  3LJT A;  2DDF A;  1KAP P;  3LMC A;  2ERP A;  2SRT A;  3HB2 P;  4JP4 A;  1GXD A;  1B8Y A;  1JH1 A;  1ZXC A;  3KEK A;  3EDI A;  1AST A;  4GQL A;  2X3A A;  1FM1 A;  5BOT A;  1ZS0 A;  1OM7 A;  1UTZ A;  4H49 A;  4H76 A;  2A8H A;  4A3W A;  2OXW A;  3TT4 A;  3E8R A;  1XFZ A;  3P1V A;  2OVX A;  1SLN A;  2J0T A;  2OW1 A;  1XFY A;  1CGE A;  3U1R A;  3KEC A;  4JPA A;  2OY2 A;  1JIW P;  3ELM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...