1JAOA

Complex of 3-mercapto-2-benzylpropanoyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
b'NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLO PROTEINASE-8 (MET80 FORM)
publication title X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jaoA00
2OI0A 5CUHA 1SLNA 2CKIA 3LJGA 4ON1A 4AYKA 2Y6DA 3LEAA 1D7XA 5I3MA 1OO9A 4H1QA 3EDIA 2Y6CA 2OXWA 4HX3A 3LIKA 1HOVA 3LMCA 1GO7P 2X3BA 4XCTA 1QIAA 4GWMA 1JK3A 4H49A 2MZIA 1XFXA 4IUWA 3KRYA 1IACA 1QUAA 3V96B 1ROSA 5B5OA 2CLTA 1IAGA 2W15A 4GQLA 3DPFA 2Z2DA 3K7LA 3EWJA 1BSWA 2OY4A 1Y0VA 1G9KA 1AYKA 2W12A 1QJJA 3LUMA 1GE7A 3KMEA 4XM7A 4QKZA 2DW0A 3Q2HA 2HU6A 1IAAA 2MLSA 1WNIA 3ZXHA 456CA 3HBUP 4I35A 1YOUA 1CGEA 3OHOA 2JNPA 5LABA 4H2EA 2JT5A 3E8RA 1XFYA 3USNA 4CTHA 1I76A 1MMRA 2E3XA 1EAKA 1GXDA 1BKCI 1K7IA 5I43A 1IABA 1SATA 1OMJA 3F19A 4L6TA 3GBOA 5I2ZA 1SRPA 2KRJA 1UMTA 5CXAA 2OXZA 1G12A 5D1UA 4DV8A 1JAPA 2K9CA 2MZHA 3RTTA 1PWQA 1QJIA 1ZP5A 2OZRA 3F17A 4PKSA 2POJA 2DW1A 3MA2A 4R3VA 1D8FA 3WV2A 2X3CA 3DPEA 3F18A 1EUBA 1PWVA 1O0TA 1C3IA 4A3WA 2AYKA 5BOTA 3KEJA 1CXVA 4IJOA 3DNGA 3UVCA 3LKAA 4PKRA 1HTDA 4FU4A 1CK7A 3TVCA 3LIRA 3P1VA 1GKDA 1A85A 2WO8A 1XUDA 1BM6A 1A86A 2USNA 1HFSA 3KHIA 1BQQM 3DWBA 3TT4A 4PKVA 3KMCA 1ZS0A 5B5PA 3EDHA 1XURA 1GO8P 3B2ZA 3HDAP 1BIWA 1MMPA 2W13A 3EDGA 1BUDA 2RJPA 2D1NA 3N2UA 1CGFA 1QICA 4EFSA 1PWWA 3L0TA 4G9LA 1QIBA 3KWVC 1OS9A 3LILA 1R1JA 1SMPA 2OW2A 2OW9A 3I7IA 4AUOA 3K7NA 4FVLA 4WKIA 1XUCA 5L79A 5BPAA 1XFVA 4G0DA 4PKWA 1UEAA 3LJZA 4FXQA 1R55A 4JA1A 1FM1A 4PKTA 3B92A 1IAEA 3LJTA 4DD8A 1G49A 1AF0A 4WZVA 1MMBA 1FLSA 2ERPA 2J83A 1KAPP 2RJQA 3F16A 1ND1A 1R54A 3F15A 3TS4A 3LQBA 5BOYA 2X3AA 1XFUA 4Q1LA 1JAOA 4IN9A 2PJTA 1PWPA 4XM8A 2XS3A 1UTTA 2I47A 2OW0A 1HY7A 3F1AA 4PKUA 3KEKA 830CA 1GE5A 1OM8A 2DW2A 1KUKA 1ZXCA 966CA 1CAQA 2YIGA 1HV5A 4DPEA 1Z3JA 2TCLA 3HDBA 3B8ZA 2A8HA 4GWNA 2WO9A 3VI1A 3ELMA 2L0RA 4GF1A 3AYUA 5JMYA 1CQRA 4PKQA 2DDFA 2O36A 1XFWA 2ERQA 4HMAA 1KUIA 1Q3AA 5H8XA 2WOAA 1MNCA 1JANA 2MLRA 1ZTQA 1RM8A 1C8TA 5L7FA 1GE6A 1DMTA 2XS4A 2OXUA 3EDZA 4GUYA 1Y8JA 3HB2P 3LQ0A 1K7GA 1DTHA 1OS2A 4WF6A 3LE9A 1G4KA 1R1HA 1B3DA 1R1IA 2OW1A 4H30A 3BA0A 3LGPA 2V4BA 2FV9A 1BKCA 3HYGA 5D1SA 4H84A 1OM6A 5D1TA 4JP4A 1GKCA 1OM7A 5D7WA 2OVXA 3O2XA 2JIHA 4XBHA 4GR3A 1ZXVA 3LUNA 3NX7A 1BKCE 3HBVP 3HY7A 2W14A 3U1RA 3EHXA 4XM6A 2OVZA 1KUHA 3I7GA 4WK7A 4AIGA 1JJ9A 2EROA 3DL1A 4L19A 2JSDA 1MMQA 1UTZA 1I1IP 1JAQA 1G05A 5I12A 4WKEA 3CKIA 4ILWD 1KUGA 3AIGA 4GR8A 3N2VA 3ZVSA 1JIZA 4H76A 2MZEA 1YP1A 2OY2A 1USNA 2K2GA 3LK8A 3G5CA 3WV1A 3Q2GA 1I73A 1D5JA 1D8MA 1PWUA 5I0LA 2X7MA 4JIJA 1C7KA 5CZMA 3WV3A 3L0VA 2SRTA 2FV5A 5I4OA 3P24A 1ASTA 4JPAA 1B8YA 1KBCA 2N8RA 1CIZA 1BUVM 4A7BA 1HFCA 3SHIA 1JKYA 1JIWP 4GR0A 3KECA 3ZUKA 1XFZA 1AKLA 3EHYA 4I03A 4J4MA 1Y93A 1SLMA 1J7NA 4JQGA 1IADA 1O0QA 1JH1A 2AIGP 5D3CA 2O3EA 2J0TA 3O64A 5D2BA 1ATLA 1SU3A 3RTSA 1S4BP 3OHLA 1YQYA 1EB6A 3DSLA 4AXQA 1K7QA 4L63A 3TSKA 2E2DA 1FBLA 4H3XA 4FXYP 1UMSA 3AYKA 4DF9A 4H82A 1BQOA 2YB9A 1KUFA 1ZVXA 3HY9A 2D1OA 1L6JA 4ZR5A 1BZSA 1RMZA 2DDYA 1CGLA 1YCMA 3G42A 2JT6A 3VTGA 2W0DA 2QPJA 1H71P
chains in the Genus database with same CATH superfamily
2OI0A 5CUHA 1SLNA 2CKIA 3LJGA 4ON1A 1OZ9A 4AYKA 2Y6DA 3LEAA 1D7XA 5I3MA 1OO9A 4H1QA 3EDIA 2Y6CA 2OXWA 4HX3A 3LIKA 1HOVA 3LMCA 1GO7P 2X3BA 4XCTA 1QIAA 4GWMA 1JK3A 4H49A 2MZIA 1XFXA 4IUWA 3KRYA 1IACA 1QUAA 3V96B 1ROSA 5B5OA 2CLTA 1IAGA 2W15A 4GQLA 3DPFA 2Z2DA 3K7LA 3EWJA 1BSWA 2OY4A 1Y0VA 1G9KA 1AYKA 2W12A 1QJJA 3LUMA 1GE7A 3KMEA 4XM7A 4QKZA 2DW0A 3Q2HA 2HU6A 1IAAA 2MLSA 1WNIA 3ZXHA 456CA 3HBUP 4I35A 1YOUA 1CGEA 3OHOA 2JNPA 5LABA 4H2EA 2JT5A 3E8RA 1XFYA 3USNA 4CTHA 1I76A 1MMRA 2E3XA 1EAKA 1GXDA 1BKCI 1K7IA 5I43A 1IABA 1SATA 1OMJA 3F19A 3DTKA 4L6TA 3GBOA 5I2ZA 1SRPA 2KRJA 1UMTA 5CXAA 2OXZA 1G12A 5D1UA 4DV8A 1JAPA 2K9CA 2MZHA 3RTTA 1PWQA 1QJIA 1ZP5A 2OZRA 3F17A 4PKSA 2POJA 2DW1A 3MA2A 4R3VA 4L7AA 1D8FA 3WV2A 2X3CA 3DPEA 3F18A 1EUBA 1PWVA 1O0TA 1C3IA 4A3WA 2AYKA 5BOTA 3KEJA 1CXVA 4IJOA 3DNGA 3UVCA 3LKAA 4PKRA 1HTDA 4FU4A 1CK7A 3TVCA 3LIRA 3P1VA 1GKDA 1A85A 2WO8A 1XUDA 1BM6A 1A86A 2USNA 1HFSA 1XM5A 3KHIA 1BQQM 3DWBA 3TT4A 4PKVA 3KMCA 1ZS0A 5B5PA 3EDHA 1XURA 1GO8P 3B2ZA 3HDAP 1BIWA 1MMPA 2W13A 3EDGA 1BUDA 2RJPA 2D1NA 3N2UA 1CGFA 1QICA 4EFSA 1PWWA 3L0TA 4G9LA 1QIBA 3KWVC 1OS9A 3LILA 1R1JA 1SMPA 2OW2A 2OW9A 3I7IA 4AUOA 3K7NA 4FVLA 4WKIA 1XUCA 5L79A 5BPAA 1XFVA 4G0DA 4PKWA 1UEAA 3LJZA 4FXQA 1TVIA 1R55A 4JA1A 1FM1A 4PKTA 3B92A 1IAEA 3LJTA 4DD8A 1G49A 1AF0A 4WZVA 1MMBA 1FLSA 2ERPA 2J83A 1KAPP 2RJQA 3F16A 1ND1A 1R54A 3F15A 3TS4A 3LQBA 5BOYA 2X3AA 1XFUA 4Q1LA 1JAOA 4IN9A 2PJTA 1PWPA 4XM8A 2XS3A 1UTTA 2I47A 2OW0A 1HY7A 3F1AA 4PKUA 3KEKA 830CA 1GE5A 1OM8A 2DW2A 1KUKA 1ZXCA 966CA 1CAQA 2YIGA 1HV5A 4DPEA 1Z3JA 2TCLA 3HDBA 3B8ZA 2A8HA 4GWNA 2WO9A 3VI1A 3ELMA 2L0RA 4GF1A 3AYUA 5JMYA 1CQRA 4PKQA 2DDFA 2O36A 1XFWA 2ERQA 4HMAA 1KUIA 1Q3AA 1XAXA 5H8XA 2WOAA 1MNCA 1JANA 2MLRA 1ZTQA 1RM8A 1C8TA 5L7FA 1GE6A 1DMTA 2XS4A 3DTEA 2OXUA 3EDZA 4GUYA 1Y8JA 3HB2P 3LQ0A 1K7GA 1DTHA 1OS2A 4WF6A 3LE9A 1G4KA 1R1HA 1B3DA 1R1IA 2OW1A 4H30A 3BA0A 3LGPA 2V4BA 2FV9A 1BKCA 3HYGA 5D1SA 4H84A 1OM6A 5D1TA 4JP4A 1GKCA 1OM7A 5D7WA 2OVXA 3O2XA 2JIHA 4XBHA 4GR3A 1ZXVA 3LUNA 3NX7A 1BKCE 3HBVP 3HY7A 2W14A 3U1RA 3EHXA 4XM6A 2OVZA 1KUHA 3I7GA 4WK7A 4AIGA 1JJ9A 2EROA 3DL1A 4L19A 2JSDA 1MMQA 1UTZA 1I1IP 1JAQA 1G05A 5I12A 4WKEA 3CKIA 4ILWD 1KUGA 3AIGA 4GR8A 3N2VA 3ZVSA 1JIZA 4H76A 2MZEA 1YP1A 2OY2A 1USNA 2K2GA 3LK8A 3G5CA 3WV1A 3Q2GA 1I73A 1D5JA 1D8MA 1PWUA 5I0LA 2X7MA 4JIJA 1C7KA 5CZMA 3WV3A 3L0VA 2SRTA 2FV5A 5I4OA 3P24A 1ASTA 4JPAA 1B8YA 1KBCA 2N8RA 1CIZA 1BUVM 4A7BA 1HFCA 3SHIA 1JKYA 1JIWP 4GR0A 3KECA 3ZUKA 1XFZA 1AKLA 3EHYA 4I03A 2YUFA 4J4MA 1Y93A 1SLMA 3DTIA 1J7NA 4JQGA 1IADA 1O0QA 1JH1A 2AIGP 5D3CA 2O3EA 2J0TA 3O64A 5D2BA 1ATLA 1SU3A 3RTSA 1S4BP 3OHLA 1YQYA 1EB6A 3DSLA 4AXQA 1K7QA 4L63A 3TSKA 2E2DA 1FBLA 4H3XA 4FXYP 1UMSA 3AYKA 4DF9A 4H82A 1BQOA 2YB9A 1KUFA 1ZVXA 3HY9A 2D1OA 1L6JA 4ZR5A 1BZSA 1RMZA 2DDYA 1CGLA 1YCMA 3G42A 2JT6A 3VTGA 2W0DA 2QPJA 1H71P
chains in the Genus database with same CATH topology
2OI0A 5CUHA 1SLNA 2CKIA 3LJGA 4ON1A 4AYKA 2Y6DA 3LEAA 1D7XA 5I3MA 1OO9A 4H1QA 3EDIA 2Y6CA 2OXWA 4HX3A 3LIKA 1HOVA 3LMCA 1GO7P 2X3BA 4XCTA 1QIAA 4GWMA 1JK3A 4H49A 2MZIA 1XFXA 4IUWA 3KRYA 1IACA 1QUAA 3V96B 1ROSA 5B5OA 2CLTA 1IAGA 2W15A 4GQLA 3DPFA 2Z2DA 3K7LA 3EWJA 1BSWA 2OY4A 1Y0VA 1G9KA 1AYKA 2W12A 1QJJA 3LUMA 1GE7A 3KMEA 4XM7A 4QKZA 2DW0A 3Q2HA 2HU6A 1IAAA 2MLSA 1WNIA 3ZXHA 456CA 3HBUP 4I35A 1YOUA 1CGEA 3OHOA 2JNPA 5LABA 4H2EA 2JT5A 3E8RA 1XFYA 3USNA 4CTHA 1I76A 1MMRA 2E3XA 1EAKA 1GXDA 1BKCI 1K7IA 5I43A 1IABA 1SATA 1OMJA 3F19A 3DTKA 4L6TA 3GBOA 5I2ZA 1SRPA 2KRJA 1UMTA 5CXAA 2OXZA 1G12A 5D1UA 4DV8A 1JAPA 2K9CA 2MZHA 3RTTA 1PWQA 1QJIA 1ZP5A 2OZRA 3F17A 4PKSA 2POJA 2DW1A 3MA2A 4R3VA 4L7AA 1D8FA 3WV2A 2X3CA 3DPEA 3F18A 1EUBA 1PWVA 1O0TA 1C3IA 4A3WA 2AYKA 5BOTA 3KEJA 1CXVA 4IJOA 3DNGA 3UVCA 3LKAA 4PKRA 1HTDA 4FU4A 1CK7A 3TVCA 3LIRA 3P1VA 1GKDA 1A85A 2WO8A 1XUDA 1BM6A 1A86A 2USNA 1HFSA 3KHIA 1BQQM 3DWBA 3TT4A 4PKVA 3KMCA 1ZS0A 5B5PA 3EDHA 1XURA 1GO8P 3B2ZA 3HDAP 1BIWA 1MMPA 2W13A 3EDGA 1BUDA 2RJPA 2D1NA 3N2UA 1CGFA 1QICA 4EFSA 1PWWA 3L0TA 4G9LA 1QIBA 3KWVC 1OS9A 3LILA 1R1JA 1SMPA 2OW2A 2OW9A 3I7IA 4AUOA 3K7NA 4FVLA 4WKIA 1XUCA 5L79A 5BPAA 1XFVA 4G0DA 4PKWA 1UEAA 3LJZA 4FXQA 1R55A 4JA1A 1FM1A 4PKTA 3B92A 1IAEA 3LJTA 4DD8A 1G49A 1AF0A 4WZVA 1MMBA 1FLSA 2ERPA 2J83A 1KAPP 2RJQA 3F16A 1ND1A 1R54A 3F15A 3TS4A 3LQBA 5BOYA 2X3AA 1XFUA 4Q1LA 1JAOA 4IN9A 2PJTA 1PWPA 4XM8A 2XS3A 1UTTA 2I47A 2OW0A 1HY7A 3F1AA 4PKUA 3KEKA 830CA 1GE5A 1OM8A 2DW2A 1KUKA 1ZXCA 966CA 1CAQA 2YIGA 1HV5A 4DPEA 1Z3JA 2TCLA 3HDBA 3B8ZA 2A8HA 4GWNA 2WO9A 3VI1A 3ELMA 2L0RA 4GF1A 3AYUA 5JMYA 1CQRA 4PKQA 2DDFA 2O36A 1XFWA 2ERQA 4HMAA 1KUIA 1Q3AA 5H8XA 2WOAA 1MNCA 1JANA 2MLRA 1ZTQA 1RM8A 1C8TA 5L7FA 1GE6A 1DMTA 2XS4A 3DTEA 2OXUA 3EDZA 4GUYA 1Y8JA 3HB2P 3LQ0A 1K7GA 1DTHA 1OS2A 4WF6A 3LE9A 1G4KA 1R1HA 1B3DA 1R1IA 2OW1A 4H30A 3BA0A 3LGPA 2V4BA 2FV9A 1BKCA 3HYGA 5D1SA 4H84A 1OM6A 5D1TA 4JP4A 1GKCA 1OM7A 5D7WA 2OVXA 3O2XA 2JIHA 4XBHA 4GR3A 1ZXVA 3LUNA 3NX7A 1BKCE 3HBVP 3HY7A 2W14A 3U1RA 3EHXA 4XM6A 2OVZA 1KUHA 3I7GA 4WK7A 4AIGA 1JJ9A 2EROA 3DL1A 4L19A 2JSDA 1MMQA 1UTZA 1I1IP 1JAQA 1G05A 5I12A 4WKEA 3CKIA 4ILWD 1KUGA 3AIGA 4GR8A 3N2VA 3ZVSA 1JIZA 4H76A 2MZEA 1YP1A 2OY2A 1USNA 2K2GA 3LK8A 3G5CA 3WV1A 3Q2GA 1I73A 1D5JA 1D8MA 1PWUA 5I0LA 2X7MA 4JIJA 1C7KA 5CZMA 3WV3A 3L0VA 2SRTA 2FV5A 5I4OA 3P24A 1ASTA 4JPAA 1B8YA 1KBCA 2N8RA 1CIZA 1BUVM 4A7BA 1HFCA 3SHIA 1JKYA 1JIWP 4GR0A 3KECA 3ZUKA 1XFZA 1AKLA 3EHYA 4I03A 2YUFA 4J4MA 1Y93A 1SLMA 3DTIA 1J7NA 4JQGA 1IADA 1O0QA 1JH1A 2AIGP 5D3CA 2O3EA 2J0TA 3O64A 5D2BA 1ATLA 1SU3A 3RTSA 1S4BP 3OHLA 1YQYA 1EB6A 3DSLA 4AXQA 1K7QA 4L63A 3TSKA 2E2DA 1FBLA 4H3XA 4FXYP 1UMSA 3AYKA 4DF9A 4H82A 1BQOA 2YB9A 1KUFA 1ZVXA 3HY9A 2D1OA 1L6JA 4ZR5A 1BZSA 1RMZA 2DDYA 1CGLA 1YCMA 3G42A 2JT6A 3VTGA 2W0DA 2QPJA 1H71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI0 A;  5CUH A;  1SLN A;  2CKI A;  3LJG A;  4ON1 A;  4AYK A;  2Y6D A;  3LEA A;  1D7X A;  5I3M A;  1OO9 A;  4H1Q A;  3EDI A;  2Y6C A;  2OXW A;  4HX3 A;  3LIK A;  1HOV A;  3LMC A;  1GO7 P;  2X3B A;  4XCT A;  1QIA A;  4GWM A;  1JK3 A;  4H49 A;  2MZI A;  1XFX A;  4IUW A;  3KRY A;  1IAC A;  1QUA A;  3V96 B;  1ROS A;  5B5O A;  2CLT A;  1IAG A;  2W15 A;  4GQL A;  3DPF A;  2Z2D A;  3K7L A;  3EWJ A;  1BSW A;  2OY4 A;  1Y0V A;  1G9K A;  1AYK A;  2W12 A;  1QJJ A;  3LUM A;  1GE7 A;  3KME A;  4XM7 A;  4QKZ A;  2DW0 A;  3Q2H A;  2HU6 A;  1IAA A;  2MLS A;  1WNI A;  3ZXH A;  456C A;  3HBU P;  4I35 A;  1YOU A;  1CGE A;  3OHO A;  2JNP A;  5LAB A;  4H2E A;  2JT5 A;  3E8R A;  1XFY A;  3USN A;  4CTH A;  1I76 A;  1MMR A;  2E3X A;  1EAK A;  1GXD A;  1BKC I;  1K7I A;  5I43 A;  1IAB A;  1SAT A;  1OMJ A;  3F19 A;  4L6T A;  3GBO A;  5I2Z A;  1SRP A;  2KRJ A;  1UMT A;  5CXA A;  2OXZ A;  1G12 A;  5D1U A;  4DV8 A;  1JAP A;  2K9C A;  2MZH A;  3RTT A;  1PWQ A;  1QJI A;  1ZP5 A;  2OZR A;  3F17 A;  4PKS A;  2POJ A;  2DW1 A;  3MA2 A;  4R3V A;  1D8F A;  3WV2 A;  2X3C A;  3DPE A;  3F18 A;  1EUB A;  1PWV A;  1O0T A;  1C3I A;  4A3W A;  2AYK A;  5BOT A;  3KEJ A;  1CXV A;  4IJO A;  3DNG A;  3UVC A;  3LKA A;  4PKR A;  1HTD A;  4FU4 A;  1CK7 A;  3TVC A;  3LIR A;  3P1V A;  1GKD A;  1A85 A;  2WO8 A;  1XUD A;  1BM6 A;  1A86 A;  2USN A;  1HFS A;  3KHI A;  1BQQ M;  3DWB A;  3TT4 A;  4PKV A;  3KMC A;  1ZS0 A;  5B5P A;  3EDH A;  1XUR A;  1GO8 P;  3B2Z A;  3HDA P;  1BIW A;  1MMP A;  2W13 A;  3EDG A;  1BUD A;  2RJP A;  2D1N A;  3N2U A;  1CGF A;  1QIC A;  4EFS A;  1PWW A;  3L0T A;  4G9L A;  1QIB A;  3KWV C;  1OS9 A;  3LIL A;  1R1J A;  1SMP A;  2OW2 A;  2OW9 A;  3I7I A;  4AUO A;  3K7N A;  4FVL A;  4WKI A;  1XUC A;  5L79 A;  5BPA A;  1XFV A;  4G0D A;  4PKW A;  1UEA A;  3LJZ A;  4FXQ A;  1R55 A;  4JA1 A;  1FM1 A;  4PKT A;  3B92 A;  1IAE A;  3LJT A;  4DD8 A;  1G49 A;  1AF0 A;  4WZV A;  1MMB A;  1FLS A;  2ERP A;  2J83 A;  1KAP P;  2RJQ A;  3F16 A;  1ND1 A;  1R54 A;  3F15 A;  3TS4 A;  3LQB A;  5BOY A;  2X3A A;  1XFU A;  4Q1L A;  1JAO A;  4IN9 A;  2PJT A;  1PWP A;  4XM8 A;  2XS3 A;  1UTT A;  2I47 A;  2OW0 A;  1HY7 A;  3F1A A;  4PKU A;  3KEK A;  830C A;  1GE5 A;  1OM8 A;  2DW2 A;  1KUK A;  1ZXC A;  966C A;  1CAQ A;  2YIG A;  1HV5 A;  4DPE A;  1Z3J A;  2TCL A;  3HDB A;  3B8Z A;  2A8H A;  4GWN A;  2WO9 A;  3VI1 A;  3ELM A;  2L0R A;  4GF1 A;  3AYU A;  5JMY A;  1CQR A;  4PKQ A;  2DDF A;  2O36 A;  1XFW A;  2ERQ A;  4HMA A;  1KUI A;  1Q3A A;  5H8X A;  2WOA A;  1MNC A;  1JAN A;  2MLR A;  1ZTQ A;  1RM8 A;  1C8T A;  5L7F A;  1GE6 A;  1DMT A;  2XS4 A;  2OXU A;  3EDZ A;  4GUY A;  1Y8J A;  3HB2 P;  3LQ0 A;  1K7G A;  1DTH A;  1OS2 A;  4WF6 A;  3LE9 A;  1G4K A;  1R1H A;  1B3D A;  1R1I A;  2OW1 A;  4H30 A;  3BA0 A;  3LGP A;  2V4B A;  2FV9 A;  1BKC A;  3HYG A;  5D1S A;  4H84 A;  1OM6 A;  5D1T A;  4JP4 A;  1GKC A;  1OM7 A;  5D7W A;  2OVX A;  3O2X A;  2JIH A;  4XBH A;  4GR3 A;  1ZXV A;  3LUN A;  3NX7 A;  1BKC E;  3HBV P;  3HY7 A;  2W14 A;  3U1R A;  3EHX A;  4XM6 A;  2OVZ A;  1KUH A;  3I7G A;  4WK7 A;  4AIG A;  1JJ9 A;  2ERO A;  3DL1 A;  4L19 A;  2JSD A;  1MMQ A;  1UTZ A;  1I1I P;  1JAQ A;  1G05 A;  5I12 A;  4WKE A;  3CKI A;  4ILW D;  1KUG A;  3AIG A;  4GR8 A;  3N2V A;  3ZVS A;  1JIZ A;  4H76 A;  2MZE A;  1YP1 A;  2OY2 A;  1USN A;  2K2G A;  3LK8 A;  3G5C A;  3WV1 A;  3Q2G A;  1I73 A;  1D5J A;  1D8M A;  1PWU A;  5I0L A;  2X7M A;  4JIJ A;  1C7K A;  5CZM A;  3WV3 A;  3L0V A;  2SRT A;  2FV5 A;  5I4O A;  3P24 A;  1AST A;  4JPA A;  1B8Y A;  1KBC A;  2N8R A;  1CIZ A;  1BUV M;  4A7B A;  1HFC A;  3SHI A;  1JKY A;  1JIW P;  4GR0 A;  3KEC A;  3ZUK A;  1XFZ A;  1AKL A;  3EHY A;  4I03 A;  4J4M A;  1Y93 A;  1SLM A;  1J7N A;  4JQG A;  1IAD A;  1O0Q A;  1JH1 A;  2AIG P;  5D3C A;  2O3E A;  2J0T A;  3O64 A;  5D2B A;  1ATL A;  1SU3 A;  3RTS A;  1S4B P;  3OHL A;  1YQY A;  1EB6 A;  3DSL A;  4AXQ A;  1K7Q A;  4L63 A;  3TSK A;  2E2D A;  1FBL A;  4H3X A;  4FXY P;  1UMS A;  3AYK A;  4DF9 A;  4H82 A;  1BQO A;  2YB9 A;  1KUF A;  1ZVX A;  3HY9 A;  2D1O A;  1L6J A;  4ZR5 A;  1BZS A;  1RMZ A;  2DDY A;  1CGL A;  1YCM A;  3G42 A;  2JT6 A;  3VTG A;  2W0D A;  2QPJ A;  1H71 P; 
#chains in the Genus database with same CATH topology
 2OI0 A;  5CUH A;  1SLN A;  2CKI A;  3LJG A;  4ON1 A;  1OZ9 A;  4AYK A;  2Y6D A;  3LEA A;  1D7X A;  5I3M A;  1OO9 A;  4H1Q A;  3EDI A;  2Y6C A;  2OXW A;  4HX3 A;  3LIK A;  1HOV A;  3LMC A;  1GO7 P;  2X3B A;  4XCT A;  1QIA A;  4GWM A;  1JK3 A;  4H49 A;  2MZI A;  1XFX A;  4IUW A;  3KRY A;  1IAC A;  1QUA A;  3V96 B;  1ROS A;  5B5O A;  2CLT A;  1IAG A;  2W15 A;  4GQL A;  3DPF A;  2Z2D A;  3K7L A;  3EWJ A;  1BSW A;  2OY4 A;  1Y0V A;  1G9K A;  1AYK A;  2W12 A;  1QJJ A;  3LUM A;  1GE7 A;  3KME A;  4XM7 A;  4QKZ A;  2DW0 A;  3Q2H A;  2HU6 A;  1IAA A;  2MLS A;  1WNI A;  3ZXH A;  456C A;  3HBU P;  4I35 A;  1YOU A;  1CGE A;  3OHO A;  2JNP A;  5LAB A;  4H2E A;  2JT5 A;  3E8R A;  1XFY A;  3USN A;  4CTH A;  1I76 A;  1MMR A;  2E3X A;  1EAK A;  1GXD A;  1BKC I;  1K7I A;  5I43 A;  1IAB A;  1SAT A;  1OMJ A;  3F19 A;  3DTK A;  4L6T A;  3GBO A;  5I2Z A;  1SRP A;  2KRJ A;  1UMT A;  5CXA A;  2OXZ A;  1G12 A;  5D1U A;  4DV8 A;  1JAP A;  2K9C A;  2MZH A;  3RTT A;  1PWQ A;  1QJI A;  1ZP5 A;  2OZR A;  3F17 A;  4PKS A;  2POJ A;  2DW1 A;  3MA2 A;  4R3V A;  4L7A A;  1D8F A;  3WV2 A;  2X3C A;  3DPE A;  3F18 A;  1EUB A;  1PWV A;  1O0T A;  1C3I A;  4A3W A;  2AYK A;  5BOT A;  3KEJ A;  1CXV A;  4IJO A;  3DNG A;  3UVC A;  3LKA A;  4PKR A;  1HTD A;  4FU4 A;  1CK7 A;  3TVC A;  3LIR A;  3P1V A;  1GKD A;  1A85 A;  2WO8 A;  1XUD A;  1BM6 A;  1A86 A;  2USN A;  1HFS A;  1XM5 A;  3KHI A;  1BQQ M;  3DWB A;  3TT4 A;  4PKV A;  3KMC A;  1ZS0 A;  5B5P A;  3EDH A;  1XUR A;  1GO8 P;  3B2Z A;  3HDA P;  1BIW A;  1MMP A;  2W13 A;  3EDG A;  1BUD A;  2RJP A;  2D1N A;  3N2U A;  1CGF A;  1QIC A;  4EFS A;  1PWW A;  3L0T A;  4G9L A;  1QIB A;  3KWV C;  1OS9 A;  3LIL A;  1R1J A;  1SMP A;  2OW2 A;  2OW9 A;  3I7I A;  4AUO A;  3K7N A;  4FVL A;  4WKI A;  1XUC A;  5L79 A;  5BPA A;  1XFV A;  4G0D A;  4PKW A;  1UEA A;  3LJZ A;  4FXQ A;  1TVI A;  1R55 A;  4JA1 A;  1FM1 A;  4PKT A;  3B92 A;  1IAE A;  3LJT A;  4DD8 A;  1G49 A;  1AF0 A;  4WZV A;  1MMB A;  1FLS A;  2ERP A;  2J83 A;  1KAP P;  2RJQ A;  3F16 A;  1ND1 A;  1R54 A;  3F15 A;  3TS4 A;  3LQB A;  5BOY A;  2X3A A;  1XFU A;  4Q1L A;  1JAO A;  4IN9 A;  2PJT A;  1PWP A;  4XM8 A;  2XS3 A;  1UTT A;  2I47 A;  2OW0 A;  1HY7 A;  3F1A A;  4PKU A;  3KEK A;  830C A;  1GE5 A;  1OM8 A;  2DW2 A;  1KUK A;  1ZXC A;  966C A;  1CAQ A;  2YIG A;  1HV5 A;  4DPE A;  1Z3J A;  2TCL A;  3HDB A;  3B8Z A;  2A8H A;  4GWN A;  2WO9 A;  3VI1 A;  3ELM A;  2L0R A;  4GF1 A;  3AYU A;  5JMY A;  1CQR A;  4PKQ A;  2DDF A;  2O36 A;  1XFW A;  2ERQ A;  4HMA A;  1KUI A;  1Q3A A;  1XAX A;  5H8X A;  2WOA A;  1MNC A;  1JAN A;  2MLR A;  1ZTQ A;  1RM8 A;  1C8T A;  5L7F A;  1GE6 A;  1DMT A;  2XS4 A;  3DTE A;  2OXU A;  3EDZ A;  4GUY A;  1Y8J A;  3HB2 P;  3LQ0 A;  1K7G A;  1DTH A;  1OS2 A;  4WF6 A;  3LE9 A;  1G4K A;  1R1H A;  1B3D A;  1R1I A;  2OW1 A;  4H30 A;  3BA0 A;  3LGP A;  2V4B A;  2FV9 A;  1BKC A;  3HYG A;  5D1S A;  4H84 A;  1OM6 A;  5D1T A;  4JP4 A;  1GKC A;  1OM7 A;  5D7W A;  2OVX A;  3O2X A;  2JIH A;  4XBH A;  4GR3 A;  1ZXV A;  3LUN A;  3NX7 A;  1BKC E;  3HBV P;  3HY7 A;  2W14 A;  3U1R A;  3EHX A;  4XM6 A;  2OVZ A;  1KUH A;  3I7G A;  4WK7 A;  4AIG A;  1JJ9 A;  2ERO A;  3DL1 A;  4L19 A;  2JSD A;  1MMQ A;  1UTZ A;  1I1I P;  1JAQ A;  1G05 A;  5I12 A;  4WKE A;  3CKI A;  4ILW D;  1KUG A;  3AIG A;  4GR8 A;  3N2V A;  3ZVS A;  1JIZ A;  4H76 A;  2MZE A;  1YP1 A;  2OY2 A;  1USN A;  2K2G A;  3LK8 A;  3G5C A;  3WV1 A;  3Q2G A;  1I73 A;  1D5J A;  1D8M A;  1PWU A;  5I0L A;  2X7M A;  4JIJ A;  1C7K A;  5CZM A;  3WV3 A;  3L0V A;  2SRT A;  2FV5 A;  5I4O A;  3P24 A;  1AST A;  4JPA A;  1B8Y A;  1KBC A;  2N8R A;  1CIZ A;  1BUV M;  4A7B A;  1HFC A;  3SHI A;  1JKY A;  1JIW P;  4GR0 A;  3KEC A;  3ZUK A;  1XFZ A;  1AKL A;  3EHY A;  4I03 A;  2YUF A;  4J4M A;  1Y93 A;  1SLM A;  3DTI A;  1J7N A;  4JQG A;  1IAD A;  1O0Q A;  1JH1 A;  2AIG P;  5D3C A;  2O3E A;  2J0T A;  3O64 A;  5D2B A;  1ATL A;  1SU3 A;  3RTS A;  1S4B P;  3OHL A;  1YQY A;  1EB6 A;  3DSL A;  4AXQ A;  1K7Q A;  4L63 A;  3TSK A;  2E2D A;  1FBL A;  4H3X A;  4FXY P;  1UMS A;  3AYK A;  4DF9 A;  4H82 A;  1BQO A;  2YB9 A;  1KUF A;  1ZVX A;  3HY9 A;  2D1O A;  1L6J A;  4ZR5 A;  1BZS A;  1RMZ A;  2DDY A;  1CGL A;  1YCM A;  3G42 A;  2JT6 A;  3VTG A;  2W0D A;  2QPJ A;  1H71 P; 
#chains in the Genus database with same CATH homology
 2OI0 A;  5CUH A;  1SLN A;  2CKI A;  3LJG A;  4ON1 A;  4AYK A;  2Y6D A;  3LEA A;  1D7X A;  5I3M A;  1OO9 A;  4H1Q A;  3EDI A;  2Y6C A;  2OXW A;  4HX3 A;  3LIK A;  1HOV A;  3LMC A;  1GO7 P;  2X3B A;  4XCT A;  1QIA A;  4GWM A;  1JK3 A;  4H49 A;  2MZI A;  1XFX A;  4IUW A;  3KRY A;  1IAC A;  1QUA A;  3V96 B;  1ROS A;  5B5O A;  2CLT A;  1IAG A;  2W15 A;  4GQL A;  3DPF A;  2Z2D A;  3K7L A;  3EWJ A;  1BSW A;  2OY4 A;  1Y0V A;  1G9K A;  1AYK A;  2W12 A;  1QJJ A;  3LUM A;  1GE7 A;  3KME A;  4XM7 A;  4QKZ A;  2DW0 A;  3Q2H A;  2HU6 A;  1IAA A;  2MLS A;  1WNI A;  3ZXH A;  456C A;  3HBU P;  4I35 A;  1YOU A;  1CGE A;  3OHO A;  2JNP A;  5LAB A;  4H2E A;  2JT5 A;  3E8R A;  1XFY A;  3USN A;  4CTH A;  1I76 A;  1MMR A;  2E3X A;  1EAK A;  1GXD A;  1BKC I;  1K7I A;  5I43 A;  1IAB A;  1SAT A;  1OMJ A;  3F19 A;  3DTK A;  4L6T A;  3GBO A;  5I2Z A;  1SRP A;  2KRJ A;  1UMT A;  5CXA A;  2OXZ A;  1G12 A;  5D1U A;  4DV8 A;  1JAP A;  2K9C A;  2MZH A;  3RTT A;  1PWQ A;  1QJI A;  1ZP5 A;  2OZR A;  3F17 A;  4PKS A;  2POJ A;  2DW1 A;  3MA2 A;  4R3V A;  4L7A A;  1D8F A;  3WV2 A;  2X3C A;  3DPE A;  3F18 A;  1EUB A;  1PWV A;  1O0T A;  1C3I A;  4A3W A;  2AYK A;  5BOT A;  3KEJ A;  1CXV A;  4IJO A;  3DNG A;  3UVC A;  3LKA A;  4PKR A;  1HTD A;  4FU4 A;  1CK7 A;  3TVC A;  3LIR A;  3P1V A;  1GKD A;  1A85 A;  2WO8 A;  1XUD A;  1BM6 A;  1A86 A;  2USN A;  1HFS A;  3KHI A;  1BQQ M;  3DWB A;  3TT4 A;  4PKV A;  3KMC A;  1ZS0 A;  5B5P A;  3EDH A;  1XUR A;  1GO8 P;  3B2Z A;  3HDA P;  1BIW A;  1MMP A;  2W13 A;  3EDG A;  1BUD A;  2RJP A;  2D1N A;  3N2U A;  1CGF A;  1QIC A;  4EFS A;  1PWW A;  3L0T A;  4G9L A;  1QIB A;  3KWV C;  1OS9 A;  3LIL A;  1R1J A;  1SMP A;  2OW2 A;  2OW9 A;  3I7I A;  4AUO A;  3K7N A;  4FVL A;  4WKI A;  1XUC A;  5L79 A;  5BPA A;  1XFV A;  4G0D A;  4PKW A;  1UEA A;  3LJZ A;  4FXQ A;  1R55 A;  4JA1 A;  1FM1 A;  4PKT A;  3B92 A;  1IAE A;  3LJT A;  4DD8 A;  1G49 A;  1AF0 A;  4WZV A;  1MMB A;  1FLS A;  2ERP A;  2J83 A;  1KAP P;  2RJQ A;  3F16 A;  1ND1 A;  1R54 A;  3F15 A;  3TS4 A;  3LQB A;  5BOY A;  2X3A A;  1XFU A;  4Q1L A;  1JAO A;  4IN9 A;  2PJT A;  1PWP A;  4XM8 A;  2XS3 A;  1UTT A;  2I47 A;  2OW0 A;  1HY7 A;  3F1A A;  4PKU A;  3KEK A;  830C A;  1GE5 A;  1OM8 A;  2DW2 A;  1KUK A;  1ZXC A;  966C A;  1CAQ A;  2YIG A;  1HV5 A;  4DPE A;  1Z3J A;  2TCL A;  3HDB A;  3B8Z A;  2A8H A;  4GWN A;  2WO9 A;  3VI1 A;  3ELM A;  2L0R A;  4GF1 A;  3AYU A;  5JMY A;  1CQR A;  4PKQ A;  2DDF A;  2O36 A;  1XFW A;  2ERQ A;  4HMA A;  1KUI A;  1Q3A A;  5H8X A;  2WOA A;  1MNC A;  1JAN A;  2MLR A;  1ZTQ A;  1RM8 A;  1C8T A;  5L7F A;  1GE6 A;  1DMT A;  2XS4 A;  3DTE A;  2OXU A;  3EDZ A;  4GUY A;  1Y8J A;  3HB2 P;  3LQ0 A;  1K7G A;  1DTH A;  1OS2 A;  4WF6 A;  3LE9 A;  1G4K A;  1R1H A;  1B3D A;  1R1I A;  2OW1 A;  4H30 A;  3BA0 A;  3LGP A;  2V4B A;  2FV9 A;  1BKC A;  3HYG A;  5D1S A;  4H84 A;  1OM6 A;  5D1T A;  4JP4 A;  1GKC A;  1OM7 A;  5D7W A;  2OVX A;  3O2X A;  2JIH A;  4XBH A;  4GR3 A;  1ZXV A;  3LUN A;  3NX7 A;  1BKC E;  3HBV P;  3HY7 A;  2W14 A;  3U1R A;  3EHX A;  4XM6 A;  2OVZ A;  1KUH A;  3I7G A;  4WK7 A;  4AIG A;  1JJ9 A;  2ERO A;  3DL1 A;  4L19 A;  2JSD A;  1MMQ A;  1UTZ A;  1I1I P;  1JAQ A;  1G05 A;  5I12 A;  4WKE A;  3CKI A;  4ILW D;  1KUG A;  3AIG A;  4GR8 A;  3N2V A;  3ZVS A;  1JIZ A;  4H76 A;  2MZE A;  1YP1 A;  2OY2 A;  1USN A;  2K2G A;  3LK8 A;  3G5C A;  3WV1 A;  3Q2G A;  1I73 A;  1D5J A;  1D8M A;  1PWU A;  5I0L A;  2X7M A;  4JIJ A;  1C7K A;  5CZM A;  3WV3 A;  3L0V A;  2SRT A;  2FV5 A;  5I4O A;  3P24 A;  1AST A;  4JPA A;  1B8Y A;  1KBC A;  2N8R A;  1CIZ A;  1BUV M;  4A7B A;  1HFC A;  3SHI A;  1JKY A;  1JIW P;  4GR0 A;  3KEC A;  3ZUK A;  1XFZ A;  1AKL A;  3EHY A;  4I03 A;  2YUF A;  4J4M A;  1Y93 A;  1SLM A;  3DTI A;  1J7N A;  4JQG A;  1IAD A;  1O0Q A;  1JH1 A;  2AIG P;  5D3C A;  2O3E A;  2J0T A;  3O64 A;  5D2B A;  1ATL A;  1SU3 A;  3RTS A;  1S4B P;  3OHL A;  1YQY A;  1EB6 A;  3DSL A;  4AXQ A;  1K7Q A;  4L63 A;  3TSK A;  2E2D A;  1FBL A;  4H3X A;  4FXY P;  1UMS A;  3AYK A;  4DF9 A;  4H82 A;  1BQO A;  2YB9 A;  1KUF A;  1ZVX A;  3HY9 A;  2D1O A;  1L6J A;  4ZR5 A;  1BZS A;  1RMZ A;  2DDY A;  1CGL A;  1YCM A;  3G42 A;  2JT6 A;  3VTG A;  2W0D A;  2QPJ A;  1H71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...