1JAOA

Complex of 3-mercapto-2-benzylpropanoyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords MATRIX METALLO PROTEINASE-8 (MET80 FORM)
publication title X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jaoA00
1DTHA 4GR0A 4QKZA 1L6JA 3F19A 4GUYA 4GWNA 3U1RA 5I12A 2CLTA 3KEJA 4ON1A 2K9CA 2POJA 3DPFA 1OS2A 1IAAA 3LILA 3KEKA 2O36A 2OVZA 5CUHA 2DW0A 2OXZA 4GR3A 3N2VA 2A8HA 2D1OA 3F16A 3OHLA 4FXQA 3OHOA 1KUKA 1OM6A 1QJJA 1PWQA 3LK8A 3O2XA 2JNPA 3G5CA 2YB9A 2X3CA 4A3WA 4FVLA 1O0TA 1BSWA 3ZVSA 3NX7A 4H2EA 1KUFA 3K7NA 3LKAA 2W12A 4GQLA 1XFWA 2OW9A 3HBUP 4IUWA 1B3DA 2J0TA 2W13A 2DW1A 4JQGA 1B8YA 1IAGA 1Q3AA 2OW1A 3LJGA 1G49A 3LQ0A 4DV8A 1G9KA 2JT5A 1PWVA 3I7GA 1SATA 1GO8P 2CKIA 2WO8A 2X7MA 1JAOA 2AYKA 4AYKA 2PJTA 4I03A 1GKDA 3EDZA 1XFXA 3I7IA 3HDBA 4GR8A 3LIKA 4HMAA 1GKCA 1MNCA 4HX3A 1JAQA 1SRPA 1BUVM 4GF1A 1CGLA 3HBVP 3B2ZA 3DPEA 2ERQA 3LUMA 4JP4A 1YOUA 4Q1LA 5D1UA 2DW2A 1QIBA 1ZXCA 1GE5A 1ZS0A 3KMEA 3WV2A 3TS4A 1IACA 1AKLA 1QJIA 4WKEA 2J83A 3LJTA 1JANA 1JIWP 1HFCA 3SHIA 4H49A 1HOVA 3HB2P 830CA 1EAKA 1SMPA 1GE7A 1ZP5A 1FLSA 2V4BA 456CA 1UTTA 2KRJA 2MZHA 4R3VA 2E2DA 1BM6A 2TCLA 1CGFA 5D7WA 1JJ9A 4G0DA 1UEAA 1SU3A 4H82A 1HV5A 3GBOA 4GWMA 3RTTA 1R1IA 3F18A 2O3EA 4WK7A 5L79A 3AYKA 1CK7A 5D2BA 1HTDA 5I0LA 3F1AA 2X3BA 3B8ZA 4PKTA 4IN9A 3N2UA 1YCMA 3EDIA 1XFUA 1OMJA 1AYKA 1IABA 1ZTQA 1BKCA 4XBHA 1R54A 966CA 3F15A 1BIWA 1D5JA 3Q2GA 4H1QA 4H3XA 1R55A 3LEAA 2W0DA 2WOAA 3HY9A 1CIZA 1KUGA 2RJQA 4DF9A 4H30A 4FU4A 2W15A 4I35A 1O0QA 1OO9A 3P24A 4DPEA 2X3AA 2WO9A 4J4MA 3HY7A 1GXDA 4PKUA 3DNGA 1XURA 3KECA 1MMQA 3USNA 3G42A 3WV3A 3MA2A 1EB6A 1GO7P 3LGPA 2MLRA 4WKIA 1AF0A 1JIZA 4JA1A 3ZUKA 2RJPA 3BA0A 4L19A 1HFSA 3DWBA 3LE9A 1G05A 3LJZA 3ZXHA 1KAPP 1ROSA 5LABA 5JMYA 1I73A 1XUCA 1OM7A 4PKVA 5BOTA 2OXWA 1KBCA 1MMPA 4XM8A 4ILWD 2ERPA 1GE6A 1RM8A 1QIAA 3KMCA 1Y0VA 2HU6A 1K7GA 1ND1A 1JAPA 1CQRA 1JK3A 2N8RA 2YIGA 3UVCA 1HY7A 1I76A 1BKCE 5CZMA 3DL1A 1XFVA 2USNA 1USNA 3LQBA 3LUNA 4PKQA 2OW2A 1A85A 3K7LA 3HDAP 2FV9A 3E8RA 3L0TA 1EUBA 1PWPA 1XUDA 1UTZA 1CXVA 4XCTA 3ELMA 1ZXVA 2DDYA 1XFZA 4WZVA 1MMRA 1SLMA 1G12A 2OY4A 3CKIA 2MLSA 3LIRA 2FV5A 4WF6A 5H8XA 1ASTA 1QUAA 2SRTA 4XM6A 1YP1A 1UMSA 1JKYA 3L0VA 3V96B 2MZEA 1SLNA 4H84A 1IAEA 1PWUA 4AXQA 3EDHA 3AIGA 2XS3A 2OI0A 3F17A 1D7XA 1BZSA 4G9LA 1JH1A 1FBLA 4CTHA 4AUOA 3VI1A 1IADA 1H71P 1PWWA 1C7KA 3TSKA 1CAQA 1D8MA 3EHYA 2EROA 2JIHA 1OS9A 5B5OA 1BQOA 2OY2A 3RTSA 1WNIA 2JT6A 2OVXA 3KWVC 1Y8JA 3P1VA 4IJOA 5I2ZA 4XM7A 1D8FA 5D1TA 1A86A 3EHXA 2Y6DA 1BUDA 1K7IA 3EWJA 1J7NA 2K2GA 1FM1A 1ATLA 4EFSA 3WV1A 1UMTA 4PKSA 2OZRA 5I3MA 2E3XA 2I47A 4PKRA 1QICA 5L7FA 2Z2DA 4L63A 1DMTA 2OXUA 1R1HA 3VTGA 5B5PA 5BOYA 4PKWA 1BKCI 5D1SA 2QPJA 4ZR5A 1YQYA 1I1IP 3TT4A 3O64A 5BPAA 4DD8A 1C3IA 1MMBA 1XFYA 1S4BP 4JIJA 1G4KA 2OW0A 4L6TA 5I4OA 2AIGP 1Y93A 5CXAA 3HYGA 4A7BA 1RMZA 3EDGA 3TVCA 3DSLA 1KUIA 1Z3JA 2W14A 4FXYP 3KHIA 1R1JA 3Q2HA 3AYUA 4JPAA 2JSDA 4AIGA 1OM8A 1KUHA 3KRYA 4H76A 1K7QA 2XS4A 1C8TA 1BQQM 2DDFA 2D1NA 2MZIA 1CGEA 3B92A 5D3CA 5I43A 1ZVXA 2Y6CA 2L0RA 3LMCA
chains in the Genus database with same CATH superfamily
1DTHA 4GR0A 4QKZA 1L6JA 3F19A 4GUYA 4GWNA 3U1RA 5I12A 2CLTA 3KEJA 4ON1A 2K9CA 2POJA 3DPFA 1OS2A 1IAAA 3LILA 3KEKA 2O36A 2OVZA 5CUHA 2DW0A 2OXZA 4GR3A 3N2VA 2A8HA 2D1OA 3F16A 3OHLA 4FXQA 3OHOA 1KUKA 1OM6A 1QJJA 1PWQA 3LK8A 3O2XA 2JNPA 3G5CA 2YB9A 2X3CA 4A3WA 4FVLA 1O0TA 1BSWA 3ZVSA 3NX7A 4H2EA 1KUFA 3K7NA 3LKAA 2W12A 4GQLA 1XFWA 2OW9A 3HBUP 4IUWA 1B3DA 2J0TA 2W13A 2DW1A 4JQGA 3DTEA 1B8YA 1IAGA 1Q3AA 2OW1A 3LJGA 1G49A 3LQ0A 4DV8A 1G9KA 2JT5A 1PWVA 3I7GA 1SATA 1GO8P 2CKIA 2WO8A 2X7MA 1JAOA 2AYKA 4AYKA 2PJTA 4I03A 1GKDA 3EDZA 1XFXA 3I7IA 3HDBA 4GR8A 3LIKA 4HMAA 1GKCA 1MNCA 4HX3A 1JAQA 1SRPA 1BUVM 4GF1A 1CGLA 3HBVP 3B2ZA 3DPEA 2ERQA 3LUMA 4JP4A 1YOUA 4Q1LA 5D1UA 2DW2A 1QIBA 1ZXCA 1GE5A 1ZS0A 3KMEA 3WV2A 3TS4A 1IACA 1AKLA 1QJIA 4WKEA 2J83A 1JANA 3LJTA 1JIWP 1HFCA 3SHIA 4H49A 1HOVA 3HB2P 830CA 1EAKA 1SMPA 1GE7A 1ZP5A 1FLSA 2V4BA 456CA 1UTTA 2KRJA 2MZHA 4R3VA 2E2DA 1BM6A 2TCLA 1CGFA 5D7WA 4L7AA 1JJ9A 4G0DA 1UEAA 1SU3A 4H82A 1HV5A 3GBOA 4GWMA 3RTTA 1R1IA 1TVIA 3F18A 2O3EA 4WK7A 5L79A 3AYKA 1CK7A 5D2BA 1HTDA 5I0LA 3F1AA 2X3BA 3B8ZA 4PKTA 4IN9A 3N2UA 1YCMA 3EDIA 1XFUA 1OMJA 1XM5A 1AYKA 1IABA 1ZTQA 1BKCA 4XBHA 1R54A 966CA 3F15A 1BIWA 1D5JA 3Q2GA 4H1QA 4H3XA 1R55A 3LEAA 2W0DA 2WOAA 3HY9A 1CIZA 1KUGA 2RJQA 4DF9A 4H30A 4FU4A 2W15A 4I35A 1O0QA 1OO9A 3P24A 4DPEA 2X3AA 2WO9A 4J4MA 3HY7A 1GXDA 4PKUA 3DNGA 1XURA 3KECA 1MMQA 3USNA 3G42A 3WV3A 3MA2A 1EB6A 1GO7P 3LGPA 2MLRA 4WKIA 1AF0A 1JIZA 4JA1A 3ZUKA 2RJPA 3BA0A 4L19A 1HFSA 3DWBA 3LE9A 1G05A 3LJZA 3ZXHA 1KAPP 1ROSA 5LABA 5JMYA 1I73A 1XUCA 1OM7A 4PKVA 5BOTA 2OXWA 1KBCA 1MMPA 4XM8A 4ILWD 2ERPA 1GE6A 1RM8A 1QIAA 3KMCA 1Y0VA 2HU6A 1K7GA 1ND1A 1JAPA 1CQRA 1JK3A 2N8RA 2YIGA 1XAXA 3UVCA 1HY7A 1I76A 1BKCE 5CZMA 3DL1A 1XFVA 2USNA 1USNA 3LQBA 3LUNA 4PKQA 2OW2A 1A85A 3K7LA 3HDAP 2FV9A 3E8RA 3L0TA 1EUBA 1PWPA 1XUDA 1UTZA 1CXVA 4XCTA 3ELMA 1ZXVA 2DDYA 1XFZA 4WZVA 1MMRA 1SLMA 1G12A 2OY4A 3CKIA 2MLSA 3LIRA 2FV5A 4WF6A 5H8XA 1ASTA 1QUAA 2SRTA 4XM6A 1YP1A 1UMSA 1JKYA 3L0VA 3V96B 2MZEA 1SLNA 4H84A 1IAEA 1PWUA 4AXQA 3EDHA 3AIGA 2XS3A 2OI0A 3F17A 1D7XA 2YUFA 1OZ9A 1BZSA 4G9LA 1JH1A 1FBLA 4CTHA 4AUOA 3VI1A 1IADA 1H71P 1PWWA 1C7KA 3TSKA 1CAQA 1D8MA 3EHYA 2EROA 2JIHA 1OS9A 5B5OA 1BQOA 3DTIA 2OY2A 3RTSA 1WNIA 2JT6A 2OVXA 3KWVC 1Y8JA 3P1VA 4IJOA 5I2ZA 4XM7A 1D8FA 5D1TA 1A86A 3EHXA 2Y6DA 1BUDA 1K7IA 3EWJA 1J7NA 2K2GA 1FM1A 1ATLA 4EFSA 3WV1A 1UMTA 4PKSA 2OZRA 5I3MA 2E3XA 2I47A 4PKRA 1QICA 5L7FA 2Z2DA 4L63A 1DMTA 2OXUA 1R1HA 3VTGA 5B5PA 3DTKA 5BOYA 4PKWA 1BKCI 5D1SA 2QPJA 4ZR5A 1YQYA 1I1IP 3TT4A 3O64A 5BPAA 4DD8A 1C3IA 1MMBA 1XFYA 1S4BP 4JIJA 1G4KA 2OW0A 4L6TA 5I4OA 2AIGP 1Y93A 5CXAA 3HYGA 4A7BA 1RMZA 3EDGA 3TVCA 3DSLA 1KUIA 1Z3JA 2W14A 4FXYP 3KHIA 1R1JA 3Q2HA 3AYUA 4JPAA 2JSDA 4AIGA 1OM8A 1KUHA 3KRYA 4H76A 1K7QA 2XS4A 1C8TA 1BQQM 2DDFA 2D1NA 2MZIA 1CGEA 3B92A 5D3CA 5I43A 1ZVXA 2Y6CA 2L0RA 3LMCA
chains in the Genus database with same CATH topology
1DTHA 4GR0A 4QKZA 1L6JA 3F19A 4GUYA 4GWNA 3U1RA 5I12A 2CLTA 3KEJA 4ON1A 2K9CA 2POJA 3DPFA 1OS2A 1IAAA 3LILA 3KEKA 2O36A 2OVZA 5CUHA 2DW0A 2OXZA 4GR3A 3N2VA 2A8HA 2D1OA 3F16A 3OHLA 4FXQA 3OHOA 1KUKA 1OM6A 1QJJA 1PWQA 3LK8A 3O2XA 2JNPA 3G5CA 2YB9A 2X3CA 4A3WA 4FVLA 1O0TA 1BSWA 3ZVSA 3NX7A 4H2EA 1KUFA 3K7NA 3LKAA 2W12A 4GQLA 1XFWA 2OW9A 3HBUP 4IUWA 1B3DA 2J0TA 2W13A 2DW1A 4JQGA 3DTEA 1B8YA 1IAGA 1Q3AA 2OW1A 3LJGA 1G49A 3LQ0A 4DV8A 1G9KA 2JT5A 1PWVA 3I7GA 1SATA 1GO8P 2CKIA 2WO8A 2X7MA 1JAOA 2AYKA 4AYKA 2PJTA 4I03A 1GKDA 3EDZA 1XFXA 3I7IA 3HDBA 4GR8A 3LIKA 4HMAA 1GKCA 1MNCA 4HX3A 1JAQA 1SRPA 1BUVM 4GF1A 1CGLA 3HBVP 3B2ZA 3DPEA 2ERQA 3LUMA 4JP4A 1YOUA 4Q1LA 5D1UA 2DW2A 1QIBA 1ZXCA 1GE5A 1ZS0A 3KMEA 3WV2A 3TS4A 1IACA 1AKLA 1QJIA 4WKEA 2J83A 1JANA 3LJTA 1JIWP 1HFCA 3SHIA 4H49A 1HOVA 3HB2P 830CA 1EAKA 1SMPA 1GE7A 1ZP5A 1FLSA 2V4BA 456CA 1UTTA 2KRJA 2MZHA 4R3VA 2E2DA 1BM6A 2TCLA 1CGFA 5D7WA 4L7AA 1JJ9A 4G0DA 1UEAA 1SU3A 4H82A 1HV5A 3GBOA 4GWMA 3RTTA 1R1IA 3F18A 2O3EA 4WK7A 5L79A 3AYKA 1CK7A 5D2BA 1HTDA 5I0LA 3F1AA 2X3BA 3B8ZA 4PKTA 4IN9A 3N2UA 1YCMA 3EDIA 1XFUA 1OMJA 1AYKA 1IABA 1ZTQA 1BKCA 4XBHA 1R54A 966CA 3F15A 1BIWA 1D5JA 3Q2GA 4H1QA 4H3XA 1R55A 3LEAA 2W0DA 2WOAA 3HY9A 1CIZA 1KUGA 2RJQA 4DF9A 4H30A 4FU4A 2W15A 4I35A 1O0QA 1OO9A 3P24A 4DPEA 2X3AA 2WO9A 4J4MA 3HY7A 1GXDA 4PKUA 3DNGA 1XURA 3KECA 1MMQA 3USNA 3G42A 3WV3A 3MA2A 1EB6A 1GO7P 3LGPA 2MLRA 4WKIA 1AF0A 1JIZA 4JA1A 3ZUKA 2RJPA 3BA0A 4L19A 1HFSA 3DWBA 3LE9A 1G05A 3LJZA 3ZXHA 1KAPP 1ROSA 5LABA 5JMYA 1I73A 1XUCA 1OM7A 4PKVA 5BOTA 2OXWA 1KBCA 1MMPA 4XM8A 4ILWD 2ERPA 1GE6A 1RM8A 1QIAA 3KMCA 1Y0VA 2HU6A 1K7GA 1ND1A 1JAPA 1CQRA 1JK3A 2N8RA 2YIGA 3UVCA 1HY7A 1I76A 1BKCE 5CZMA 3DL1A 1XFVA 2USNA 1USNA 3LQBA 3LUNA 4PKQA 2OW2A 1A85A 3K7LA 3HDAP 2FV9A 3E8RA 3L0TA 1EUBA 1PWPA 1XUDA 1UTZA 1CXVA 4XCTA 3ELMA 1ZXVA 2DDYA 1XFZA 4WZVA 1MMRA 1SLMA 1G12A 2OY4A 3CKIA 2MLSA 3LIRA 2FV5A 4WF6A 5H8XA 1ASTA 1QUAA 2SRTA 4XM6A 1YP1A 1UMSA 1JKYA 3L0VA 3V96B 2MZEA 1SLNA 4H84A 1IAEA 1PWUA 4AXQA 3EDHA 3AIGA 2XS3A 2OI0A 3F17A 1D7XA 2YUFA 1BZSA 4G9LA 1JH1A 1FBLA 4CTHA 4AUOA 3VI1A 1IADA 1H71P 1PWWA 1C7KA 3TSKA 1CAQA 1D8MA 3EHYA 2EROA 2JIHA 1OS9A 5B5OA 1BQOA 3DTIA 2OY2A 3RTSA 1WNIA 2JT6A 2OVXA 3KWVC 1Y8JA 3P1VA 4IJOA 5I2ZA 4XM7A 1D8FA 5D1TA 1A86A 3EHXA 2Y6DA 1BUDA 1K7IA 3EWJA 1J7NA 2K2GA 1FM1A 1ATLA 4EFSA 3WV1A 1UMTA 4PKSA 2OZRA 5I3MA 2E3XA 2I47A 4PKRA 1QICA 5L7FA 2Z2DA 4L63A 1DMTA 2OXUA 1R1HA 3VTGA 5B5PA 3DTKA 5BOYA 4PKWA 1BKCI 5D1SA 2QPJA 4ZR5A 1YQYA 1I1IP 3TT4A 3O64A 5BPAA 4DD8A 1C3IA 1MMBA 1XFYA 1S4BP 4JIJA 1G4KA 2OW0A 4L6TA 5I4OA 2AIGP 1Y93A 5CXAA 3HYGA 4A7BA 1RMZA 3EDGA 3TVCA 3DSLA 1KUIA 1Z3JA 2W14A 4FXYP 3KHIA 1R1JA 3Q2HA 3AYUA 4JPAA 2JSDA 4AIGA 1OM8A 1KUHA 3KRYA 4H76A 1K7QA 2XS4A 1C8TA 1BQQM 2DDFA 2D1NA 2MZIA 1CGEA 3B92A 5D3CA 5I43A 1ZVXA 2Y6CA 2L0RA 3LMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTH A;  4GR0 A;  4QKZ A;  1L6J A;  3F19 A;  4GUY A;  4GWN A;  3U1R A;  5I12 A;  2CLT A;  3KEJ A;  4ON1 A;  2K9C A;  2POJ A;  3DPF A;  1OS2 A;  1IAA A;  3LIL A;  3KEK A;  2O36 A;  2OVZ A;  5CUH A;  2DW0 A;  2OXZ A;  4GR3 A;  3N2V A;  2A8H A;  2D1O A;  3F16 A;  3OHL A;  4FXQ A;  3OHO A;  1KUK A;  1OM6 A;  1QJJ A;  1PWQ A;  3LK8 A;  3O2X A;  2JNP A;  3G5C A;  2YB9 A;  2X3C A;  4A3W A;  4FVL A;  1O0T A;  1BSW A;  3ZVS A;  3NX7 A;  4H2E A;  1KUF A;  3K7N A;  3LKA A;  2W12 A;  4GQL A;  1XFW A;  2OW9 A;  3HBU P;  4IUW A;  1B3D A;  2J0T A;  2W13 A;  2DW1 A;  4JQG A;  1B8Y A;  1IAG A;  1Q3A A;  2OW1 A;  3LJG A;  1G49 A;  3LQ0 A;  4DV8 A;  1G9K A;  2JT5 A;  1PWV A;  3I7G A;  1SAT A;  1GO8 P;  2CKI A;  2WO8 A;  2X7M A;  1JAO A;  2AYK A;  4AYK A;  2PJT A;  4I03 A;  1GKD A;  3EDZ A;  1XFX A;  3I7I A;  3HDB A;  4GR8 A;  3LIK A;  4HMA A;  1GKC A;  1MNC A;  4HX3 A;  1JAQ A;  1SRP A;  1BUV M;  4GF1 A;  1CGL A;  3HBV P;  3B2Z A;  3DPE A;  2ERQ A;  3LUM A;  4JP4 A;  1YOU A;  4Q1L A;  5D1U A;  2DW2 A;  1QIB A;  1ZXC A;  1GE5 A;  1ZS0 A;  3KME A;  3WV2 A;  3TS4 A;  1IAC A;  1AKL A;  1QJI A;  4WKE A;  2J83 A;  3LJT A;  1JAN A;  1JIW P;  1HFC A;  3SHI A;  4H49 A;  1HOV A;  3HB2 P;  830C A;  1EAK A;  1SMP A;  1GE7 A;  1ZP5 A;  1FLS A;  2V4B A;  456C A;  1UTT A;  2KRJ A;  2MZH A;  4R3V A;  2E2D A;  1BM6 A;  2TCL A;  1CGF A;  5D7W A;  1JJ9 A;  4G0D A;  1UEA A;  1SU3 A;  4H82 A;  1HV5 A;  3GBO A;  4GWM A;  3RTT A;  1R1I A;  3F18 A;  2O3E A;  4WK7 A;  5L79 A;  3AYK A;  1CK7 A;  5D2B A;  1HTD A;  5I0L A;  3F1A A;  2X3B A;  3B8Z A;  4PKT A;  4IN9 A;  3N2U A;  1YCM A;  3EDI A;  1XFU A;  1OMJ A;  1AYK A;  1IAB A;  1ZTQ A;  1BKC A;  4XBH A;  1R54 A;  966C A;  3F15 A;  1BIW A;  1D5J A;  3Q2G A;  4H1Q A;  4H3X A;  1R55 A;  3LEA A;  2W0D A;  2WOA A;  3HY9 A;  1CIZ A;  1KUG A;  2RJQ A;  4DF9 A;  4H30 A;  4FU4 A;  2W15 A;  4I35 A;  1O0Q A;  1OO9 A;  3P24 A;  4DPE A;  2X3A A;  2WO9 A;  4J4M A;  3HY7 A;  1GXD A;  4PKU A;  3DNG A;  1XUR A;  3KEC A;  1MMQ A;  3USN A;  3G42 A;  3WV3 A;  3MA2 A;  1EB6 A;  1GO7 P;  3LGP A;  2MLR A;  4WKI A;  1AF0 A;  1JIZ A;  4JA1 A;  3ZUK A;  2RJP A;  3BA0 A;  4L19 A;  1HFS A;  3DWB A;  3LE9 A;  1G05 A;  3LJZ A;  3ZXH A;  1KAP P;  1ROS A;  5LAB A;  5JMY A;  1I73 A;  1XUC A;  1OM7 A;  4PKV A;  5BOT A;  2OXW A;  1KBC A;  1MMP A;  4XM8 A;  4ILW D;  2ERP A;  1GE6 A;  1RM8 A;  1QIA A;  3KMC A;  1Y0V A;  2HU6 A;  1K7G A;  1ND1 A;  1JAP A;  1CQR A;  1JK3 A;  2N8R A;  2YIG A;  3UVC A;  1HY7 A;  1I76 A;  1BKC E;  5CZM A;  3DL1 A;  1XFV A;  2USN A;  1USN A;  3LQB A;  3LUN A;  4PKQ A;  2OW2 A;  1A85 A;  3K7L A;  3HDA P;  2FV9 A;  3E8R A;  3L0T A;  1EUB A;  1PWP A;  1XUD A;  1UTZ A;  1CXV A;  4XCT A;  3ELM A;  1ZXV A;  2DDY A;  1XFZ A;  4WZV A;  1MMR A;  1SLM A;  1G12 A;  2OY4 A;  3CKI A;  2MLS A;  3LIR A;  2FV5 A;  4WF6 A;  5H8X A;  1AST A;  1QUA A;  2SRT A;  4XM6 A;  1YP1 A;  1UMS A;  1JKY A;  3L0V A;  3V96 B;  2MZE A;  1SLN A;  4H84 A;  1IAE A;  1PWU A;  4AXQ A;  3EDH A;  3AIG A;  2XS3 A;  2OI0 A;  3F17 A;  1D7X A;  1BZS A;  4G9L A;  1JH1 A;  1FBL A;  4CTH A;  4AUO A;  3VI1 A;  1IAD A;  1H71 P;  1PWW A;  1C7K A;  3TSK A;  1CAQ A;  1D8M A;  3EHY A;  2ERO A;  2JIH A;  1OS9 A;  5B5O A;  1BQO A;  2OY2 A;  3RTS A;  1WNI A;  2JT6 A;  2OVX A;  3KWV C;  1Y8J A;  3P1V A;  4IJO A;  5I2Z A;  4XM7 A;  1D8F A;  5D1T A;  1A86 A;  3EHX A;  2Y6D A;  1BUD A;  1K7I A;  3EWJ A;  1J7N A;  2K2G A;  1FM1 A;  1ATL A;  4EFS A;  3WV1 A;  1UMT A;  4PKS A;  2OZR A;  5I3M A;  2E3X A;  2I47 A;  4PKR A;  1QIC A;  5L7F A;  2Z2D A;  4L63 A;  1DMT A;  2OXU A;  1R1H A;  3VTG A;  5B5P A;  5BOY A;  4PKW A;  1BKC I;  5D1S A;  2QPJ A;  4ZR5 A;  1YQY A;  1I1I P;  3TT4 A;  3O64 A;  5BPA A;  4DD8 A;  1C3I A;  1MMB A;  1XFY A;  1S4B P;  4JIJ A;  1G4K A;  2OW0 A;  4L6T A;  5I4O A;  2AIG P;  1Y93 A;  5CXA A;  3HYG A;  4A7B A;  1RMZ A;  3EDG A;  3TVC A;  3DSL A;  1KUI A;  1Z3J A;  2W14 A;  4FXY P;  3KHI A;  1R1J A;  3Q2H A;  3AYU A;  4JPA A;  2JSD A;  4AIG A;  1OM8 A;  1KUH A;  3KRY A;  4H76 A;  1K7Q A;  2XS4 A;  1C8T A;  1BQQ M;  2DDF A;  2D1N A;  2MZI A;  1CGE A;  3B92 A;  5D3C A;  5I43 A;  1ZVX A;  2Y6C A;  2L0R A;  3LMC A; 
#chains in the Genus database with same CATH topology
 1DTH A;  4GR0 A;  4QKZ A;  1L6J A;  3F19 A;  4GUY A;  4GWN A;  3U1R A;  5I12 A;  2CLT A;  3KEJ A;  4ON1 A;  2K9C A;  2POJ A;  3DPF A;  1OS2 A;  1IAA A;  3LIL A;  3KEK A;  2O36 A;  2OVZ A;  5CUH A;  2DW0 A;  2OXZ A;  4GR3 A;  3N2V A;  2A8H A;  2D1O A;  3F16 A;  3OHL A;  4FXQ A;  3OHO A;  1KUK A;  1OM6 A;  1QJJ A;  1PWQ A;  3LK8 A;  3O2X A;  2JNP A;  3G5C A;  2YB9 A;  2X3C A;  4A3W A;  4FVL A;  1O0T A;  1BSW A;  3ZVS A;  3NX7 A;  4H2E A;  1KUF A;  3K7N A;  3LKA A;  2W12 A;  4GQL A;  1XFW A;  2OW9 A;  3HBU P;  4IUW A;  1B3D A;  2J0T A;  2W13 A;  2DW1 A;  4JQG A;  3DTE A;  1B8Y A;  1IAG A;  1Q3A A;  2OW1 A;  3LJG A;  1G49 A;  3LQ0 A;  4DV8 A;  1G9K A;  2JT5 A;  1PWV A;  3I7G A;  1SAT A;  1GO8 P;  2CKI A;  2WO8 A;  2X7M A;  1JAO A;  2AYK A;  4AYK A;  2PJT A;  4I03 A;  1GKD A;  3EDZ A;  1XFX A;  3I7I A;  3HDB A;  4GR8 A;  3LIK A;  4HMA A;  1GKC A;  1MNC A;  4HX3 A;  1JAQ A;  1SRP A;  1BUV M;  4GF1 A;  1CGL A;  3HBV P;  3B2Z A;  3DPE A;  2ERQ A;  3LUM A;  4JP4 A;  1YOU A;  4Q1L A;  5D1U A;  2DW2 A;  1QIB A;  1ZXC A;  1GE5 A;  1ZS0 A;  3KME A;  3WV2 A;  3TS4 A;  1IAC A;  1AKL A;  1QJI A;  4WKE A;  2J83 A;  1JAN A;  3LJT A;  1JIW P;  1HFC A;  3SHI A;  4H49 A;  1HOV A;  3HB2 P;  830C A;  1EAK A;  1SMP A;  1GE7 A;  1ZP5 A;  1FLS A;  2V4B A;  456C A;  1UTT A;  2KRJ A;  2MZH A;  4R3V A;  2E2D A;  1BM6 A;  2TCL A;  1CGF A;  5D7W A;  4L7A A;  1JJ9 A;  4G0D A;  1UEA A;  1SU3 A;  4H82 A;  1HV5 A;  3GBO A;  4GWM A;  3RTT A;  1R1I A;  1TVI A;  3F18 A;  2O3E A;  4WK7 A;  5L79 A;  3AYK A;  1CK7 A;  5D2B A;  1HTD A;  5I0L A;  3F1A A;  2X3B A;  3B8Z A;  4PKT A;  4IN9 A;  3N2U A;  1YCM A;  3EDI A;  1XFU A;  1OMJ A;  1XM5 A;  1AYK A;  1IAB A;  1ZTQ A;  1BKC A;  4XBH A;  1R54 A;  966C A;  3F15 A;  1BIW A;  1D5J A;  3Q2G A;  4H1Q A;  4H3X A;  1R55 A;  3LEA A;  2W0D A;  2WOA A;  3HY9 A;  1CIZ A;  1KUG A;  2RJQ A;  4DF9 A;  4H30 A;  4FU4 A;  2W15 A;  4I35 A;  1O0Q A;  1OO9 A;  3P24 A;  4DPE A;  2X3A A;  2WO9 A;  4J4M A;  3HY7 A;  1GXD A;  4PKU A;  3DNG A;  1XUR A;  3KEC A;  1MMQ A;  3USN A;  3G42 A;  3WV3 A;  3MA2 A;  1EB6 A;  1GO7 P;  3LGP A;  2MLR A;  4WKI A;  1AF0 A;  1JIZ A;  4JA1 A;  3ZUK A;  2RJP A;  3BA0 A;  4L19 A;  1HFS A;  3DWB A;  3LE9 A;  1G05 A;  3LJZ A;  3ZXH A;  1KAP P;  1ROS A;  5LAB A;  5JMY A;  1I73 A;  1XUC A;  1OM7 A;  4PKV A;  5BOT A;  2OXW A;  1KBC A;  1MMP A;  4XM8 A;  4ILW D;  2ERP A;  1GE6 A;  1RM8 A;  1QIA A;  3KMC A;  1Y0V A;  2HU6 A;  1K7G A;  1ND1 A;  1JAP A;  1CQR A;  1JK3 A;  2N8R A;  2YIG A;  1XAX A;  3UVC A;  1HY7 A;  1I76 A;  1BKC E;  5CZM A;  3DL1 A;  1XFV A;  2USN A;  1USN A;  3LQB A;  3LUN A;  4PKQ A;  2OW2 A;  1A85 A;  3K7L A;  3HDA P;  2FV9 A;  3E8R A;  3L0T A;  1EUB A;  1PWP A;  1XUD A;  1UTZ A;  1CXV A;  4XCT A;  3ELM A;  1ZXV A;  2DDY A;  1XFZ A;  4WZV A;  1MMR A;  1SLM A;  1G12 A;  2OY4 A;  3CKI A;  2MLS A;  3LIR A;  2FV5 A;  4WF6 A;  5H8X A;  1AST A;  1QUA A;  2SRT A;  4XM6 A;  1YP1 A;  1UMS A;  1JKY A;  3L0V A;  3V96 B;  2MZE A;  1SLN A;  4H84 A;  1IAE A;  1PWU A;  4AXQ A;  3EDH A;  3AIG A;  2XS3 A;  2OI0 A;  3F17 A;  1D7X A;  2YUF A;  1OZ9 A;  1BZS A;  4G9L A;  1JH1 A;  1FBL A;  4CTH A;  4AUO A;  3VI1 A;  1IAD A;  1H71 P;  1PWW A;  1C7K A;  3TSK A;  1CAQ A;  1D8M A;  3EHY A;  2ERO A;  2JIH A;  1OS9 A;  5B5O A;  1BQO A;  3DTI A;  2OY2 A;  3RTS A;  1WNI A;  2JT6 A;  2OVX A;  3KWV C;  1Y8J A;  3P1V A;  4IJO A;  5I2Z A;  4XM7 A;  1D8F A;  5D1T A;  1A86 A;  3EHX A;  2Y6D A;  1BUD A;  1K7I A;  3EWJ A;  1J7N A;  2K2G A;  1FM1 A;  1ATL A;  4EFS A;  3WV1 A;  1UMT A;  4PKS A;  2OZR A;  5I3M A;  2E3X A;  2I47 A;  4PKR A;  1QIC A;  5L7F A;  2Z2D A;  4L63 A;  1DMT A;  2OXU A;  1R1H A;  3VTG A;  5B5P A;  3DTK A;  5BOY A;  4PKW A;  1BKC I;  5D1S A;  2QPJ A;  4ZR5 A;  1YQY A;  1I1I P;  3TT4 A;  3O64 A;  5BPA A;  4DD8 A;  1C3I A;  1MMB A;  1XFY A;  1S4B P;  4JIJ A;  1G4K A;  2OW0 A;  4L6T A;  5I4O A;  2AIG P;  1Y93 A;  5CXA A;  3HYG A;  4A7B A;  1RMZ A;  3EDG A;  3TVC A;  3DSL A;  1KUI A;  1Z3J A;  2W14 A;  4FXY P;  3KHI A;  1R1J A;  3Q2H A;  3AYU A;  4JPA A;  2JSD A;  4AIG A;  1OM8 A;  1KUH A;  3KRY A;  4H76 A;  1K7Q A;  2XS4 A;  1C8T A;  1BQQ M;  2DDF A;  2D1N A;  2MZI A;  1CGE A;  3B92 A;  5D3C A;  5I43 A;  1ZVX A;  2Y6C A;  2L0R A;  3LMC A; 
#chains in the Genus database with same CATH homology
 1DTH A;  4GR0 A;  4QKZ A;  1L6J A;  3F19 A;  4GUY A;  4GWN A;  3U1R A;  5I12 A;  2CLT A;  3KEJ A;  4ON1 A;  2K9C A;  2POJ A;  3DPF A;  1OS2 A;  1IAA A;  3LIL A;  3KEK A;  2O36 A;  2OVZ A;  5CUH A;  2DW0 A;  2OXZ A;  4GR3 A;  3N2V A;  2A8H A;  2D1O A;  3F16 A;  3OHL A;  4FXQ A;  3OHO A;  1KUK A;  1OM6 A;  1QJJ A;  1PWQ A;  3LK8 A;  3O2X A;  2JNP A;  3G5C A;  2YB9 A;  2X3C A;  4A3W A;  4FVL A;  1O0T A;  1BSW A;  3ZVS A;  3NX7 A;  4H2E A;  1KUF A;  3K7N A;  3LKA A;  2W12 A;  4GQL A;  1XFW A;  2OW9 A;  3HBU P;  4IUW A;  1B3D A;  2J0T A;  2W13 A;  2DW1 A;  4JQG A;  3DTE A;  1B8Y A;  1IAG A;  1Q3A A;  2OW1 A;  3LJG A;  1G49 A;  3LQ0 A;  4DV8 A;  1G9K A;  2JT5 A;  1PWV A;  3I7G A;  1SAT A;  1GO8 P;  2CKI A;  2WO8 A;  2X7M A;  1JAO A;  2AYK A;  4AYK A;  2PJT A;  4I03 A;  1GKD A;  3EDZ A;  1XFX A;  3I7I A;  3HDB A;  4GR8 A;  3LIK A;  4HMA A;  1GKC A;  1MNC A;  4HX3 A;  1JAQ A;  1SRP A;  1BUV M;  4GF1 A;  1CGL A;  3HBV P;  3B2Z A;  3DPE A;  2ERQ A;  3LUM A;  4JP4 A;  1YOU A;  4Q1L A;  5D1U A;  2DW2 A;  1QIB A;  1ZXC A;  1GE5 A;  1ZS0 A;  3KME A;  3WV2 A;  3TS4 A;  1IAC A;  1AKL A;  1QJI A;  4WKE A;  2J83 A;  1JAN A;  3LJT A;  1JIW P;  1HFC A;  3SHI A;  4H49 A;  1HOV A;  3HB2 P;  830C A;  1EAK A;  1SMP A;  1GE7 A;  1ZP5 A;  1FLS A;  2V4B A;  456C A;  1UTT A;  2KRJ A;  2MZH A;  4R3V A;  2E2D A;  1BM6 A;  2TCL A;  1CGF A;  5D7W A;  4L7A A;  1JJ9 A;  4G0D A;  1UEA A;  1SU3 A;  4H82 A;  1HV5 A;  3GBO A;  4GWM A;  3RTT A;  1R1I A;  3F18 A;  2O3E A;  4WK7 A;  5L79 A;  3AYK A;  1CK7 A;  5D2B A;  1HTD A;  5I0L A;  3F1A A;  2X3B A;  3B8Z A;  4PKT A;  4IN9 A;  3N2U A;  1YCM A;  3EDI A;  1XFU A;  1OMJ A;  1AYK A;  1IAB A;  1ZTQ A;  1BKC A;  4XBH A;  1R54 A;  966C A;  3F15 A;  1BIW A;  1D5J A;  3Q2G A;  4H1Q A;  4H3X A;  1R55 A;  3LEA A;  2W0D A;  2WOA A;  3HY9 A;  1CIZ A;  1KUG A;  2RJQ A;  4DF9 A;  4H30 A;  4FU4 A;  2W15 A;  4I35 A;  1O0Q A;  1OO9 A;  3P24 A;  4DPE A;  2X3A A;  2WO9 A;  4J4M A;  3HY7 A;  1GXD A;  4PKU A;  3DNG A;  1XUR A;  3KEC A;  1MMQ A;  3USN A;  3G42 A;  3WV3 A;  3MA2 A;  1EB6 A;  1GO7 P;  3LGP A;  2MLR A;  4WKI A;  1AF0 A;  1JIZ A;  4JA1 A;  3ZUK A;  2RJP A;  3BA0 A;  4L19 A;  1HFS A;  3DWB A;  3LE9 A;  1G05 A;  3LJZ A;  3ZXH A;  1KAP P;  1ROS A;  5LAB A;  5JMY A;  1I73 A;  1XUC A;  1OM7 A;  4PKV A;  5BOT A;  2OXW A;  1KBC A;  1MMP A;  4XM8 A;  4ILW D;  2ERP A;  1GE6 A;  1RM8 A;  1QIA A;  3KMC A;  1Y0V A;  2HU6 A;  1K7G A;  1ND1 A;  1JAP A;  1CQR A;  1JK3 A;  2N8R A;  2YIG A;  3UVC A;  1HY7 A;  1I76 A;  1BKC E;  5CZM A;  3DL1 A;  1XFV A;  2USN A;  1USN A;  3LQB A;  3LUN A;  4PKQ A;  2OW2 A;  1A85 A;  3K7L A;  3HDA P;  2FV9 A;  3E8R A;  3L0T A;  1EUB A;  1PWP A;  1XUD A;  1UTZ A;  1CXV A;  4XCT A;  3ELM A;  1ZXV A;  2DDY A;  1XFZ A;  4WZV A;  1MMR A;  1SLM A;  1G12 A;  2OY4 A;  3CKI A;  2MLS A;  3LIR A;  2FV5 A;  4WF6 A;  5H8X A;  1AST A;  1QUA A;  2SRT A;  4XM6 A;  1YP1 A;  1UMS A;  1JKY A;  3L0V A;  3V96 B;  2MZE A;  1SLN A;  4H84 A;  1IAE A;  1PWU A;  4AXQ A;  3EDH A;  3AIG A;  2XS3 A;  2OI0 A;  3F17 A;  1D7X A;  2YUF A;  1BZS A;  4G9L A;  1JH1 A;  1FBL A;  4CTH A;  4AUO A;  3VI1 A;  1IAD A;  1H71 P;  1PWW A;  1C7K A;  3TSK A;  1CAQ A;  1D8M A;  3EHY A;  2ERO A;  2JIH A;  1OS9 A;  5B5O A;  1BQO A;  3DTI A;  2OY2 A;  3RTS A;  1WNI A;  2JT6 A;  2OVX A;  3KWV C;  1Y8J A;  3P1V A;  4IJO A;  5I2Z A;  4XM7 A;  1D8F A;  5D1T A;  1A86 A;  3EHX A;  2Y6D A;  1BUD A;  1K7I A;  3EWJ A;  1J7N A;  2K2G A;  1FM1 A;  1ATL A;  4EFS A;  3WV1 A;  1UMT A;  4PKS A;  2OZR A;  5I3M A;  2E3X A;  2I47 A;  4PKR A;  1QIC A;  5L7F A;  2Z2D A;  4L63 A;  1DMT A;  2OXU A;  1R1H A;  3VTG A;  5B5P A;  3DTK A;  5BOY A;  4PKW A;  1BKC I;  5D1S A;  2QPJ A;  4ZR5 A;  1YQY A;  1I1I P;  3TT4 A;  3O64 A;  5BPA A;  4DD8 A;  1C3I A;  1MMB A;  1XFY A;  1S4B P;  4JIJ A;  1G4K A;  2OW0 A;  4L6T A;  5I4O A;  2AIG P;  1Y93 A;  5CXA A;  3HYG A;  4A7B A;  1RMZ A;  3EDG A;  3TVC A;  3DSL A;  1KUI A;  1Z3J A;  2W14 A;  4FXY P;  3KHI A;  1R1J A;  3Q2H A;  3AYU A;  4JPA A;  2JSD A;  4AIG A;  1OM8 A;  1KUH A;  3KRY A;  4H76 A;  1K7Q A;  2XS4 A;  1C8T A;  1BQQ M;  2DDF A;  2D1N A;  2MZI A;  1CGE A;  3B92 A;  5D3C A;  5I43 A;  1ZVX A;  2Y6C A;  2L0R A;  3LMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...