5I12A

Crystal structure of the catalytic domain of mmp-9 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (dc27).
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrix metalloproteinase-9,Matrix metalloproteinase-9
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2016-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i12A00
1JJ9A 4WKEA 2OW1A 2AYKA 1JK3A 1OS9A 966CA 2D1OA 5D3CA 1IACA 5JMYA 1GXDA 3LMCA 1GKDA 1ZP5A 2W14A 2JIHA 3LIKA 3SHIA 1IAEA 4HX3A 1ATLA 3HBVP 1HTDA 1CGFA 1Q3AA 3L0TA 1AYKA 3NX7A 1SLMA 2YB9A 3B92A 2W15A 4FU4A 2L0RA 3TVCA 5L79A 3ZXHA 5D7WA 1Y93A 3G5CA 4GQLA 4I35A 2FV5A 4XM8A 1ASTA 2ERQA 1K7IA 1H71P 4L63A 3VI1A 1B3DA 1KUFA 3LUNA 4AXQA 2OY4A 1ND1A 4H82A 4A7BA 4PKWA 1G12A 1QICA 1GO8P 1K7QA 3KEJA 1BZSA 1HY7A 2X7MA 1GE6A 4H2EA 3KRYA 4L19A 1KBCA 4WK7A 3G42A 3L0VA 4A3WA 3BA0A 4PKUA 4H1QA 1GO7P 4QKZA 2RJPA 1R1IA 4JP4A 4R3VA 3TS4A 3TT4A 1D8MA 4XM7A 4ILWD 5B5OA 3LJGA 1G9KA 1BKCA 3F16A 5I12A 3LQBA 4IUWA 1SMPA 5I43A 3GBOA 4GR0A 2MLRA 3EDGA 3AYUA 5D2BA 4DF9A 3LK8A 1XFYA 1D8FA 1A86A 1JIZA 2OVXA 1IAAA 1JAPA 1ZXCA 2KRJA 4FVLA 4H49A 4WKIA 2Y6CA 3KECA 2D1NA 1XFUA 2HU6A 1UMSA 3EDZA 1BKCE 4JQGA 5LABA 1QJIA 1SLNA 3O2XA 3VTGA 1ROSA 1D7XA 3LEAA 2MZIA 1B8YA 4IJOA 2JSDA 4J4MA 2OZRA 3ZUKA 2OXZA 1BQOA 1MMPA 4XM6A 4EFSA 1C7KA 1KUIA 1USNA 1A85A 3LKAA 5CUHA 4HMAA 3V96B 3P1VA 2J83A 1HFSA 4WF6A 2MZHA 3DPEA 4GF1A 2OW9A 2XS4A 2E3XA 3I7GA 2SRTA 5D1TA 4PKQA 2MLSA 3HDBA 4PKVA 4GUYA 2WO8A 3Q2HA 2E2DA 3DNGA 1C8TA 4GWNA 3ZVSA 2A8HA 4JIJA 2OVZA 3U1RA 1MMRA 3KEKA 3AYKA 3F18A 3HY7A 5BPAA 3LUMA 3HY9A 2DW1A 1IADA 1L6JA 1G49A 3KHIA 1Y0VA 1YOUA 1CXVA 1KUHA 4WZVA 4AIGA 2AIGP 3EHXA 3ELMA 1XFWA 1C3IA 1OM8A 4G9LA 1BKCI 1K7GA 3EWJA 1G4KA 1KAPP 3HYGA 2JNPA 1ZTQA 4JA1A 1O0QA 1YCMA 1FLSA 1Z3JA 2X3AA 1CQRA 4AYKA 1RM8A 1CK7A 2PJTA 5I3MA 4JPAA 3UVCA 1BQQM 4H76A 4XBHA 1CIZA 2OI0A 3HB2P 1BM6A 1I73A 3F1AA 5D1SA 3K7LA 2RJQA 3KWVC 4FXQA 3WV3A 5BOYA 2CLTA 4I03A 2FV9A 1BUVM 3DSLA 1DMTA 3HDAP 3LIRA 1HFCA 1RMZA 1OS2A 1XUCA 2K2GA 2WO9A 1OM7A 4PKTA 2I47A 1XFXA 2O3EA 1PWQA 4PKSA 3AIGA 5L7FA 2TCLA 1CGLA 4AUOA 2WOAA 2JT5A 2Z2DA 1EB6A 5CXAA 1XFZA 1FM1A 1GKCA 1JAQA 3K7NA 3EDHA 3LJZA 1R55A 4DD8A 1HOVA 1XURA 1JANA 1UEAA 3EDIA 3OHLA 3LILA 1ZS0A 1Y8JA 4GR8A 1PWPA 4FXYP 1MMQA 5I4OA 3B2ZA 1XFVA 2CKIA 1I76A 2OW0A 1BIWA 2V4BA 2W0DA 1CGEA 3B8ZA 1QIBA 1FBLA 1ZXVA 2DW0A 2W13A 3LJTA 3F19A 2DW2A 3USNA 5BOTA 1YQYA 1R54A 1OMJA 1PWUA 2W12A 1I1IP 1XUDA 4G0DA 1OO9A 1JAOA 3WV1A 2XS3A 1PWVA 2QPJA 1YP1A 1QJJA 1AKLA 1CAQA 3I7IA 2OXWA 1UTTA 3P24A 2OW2A 3EHYA 1R1JA 2X3CA 4DV8A 3O64A 1AF0A 1JIWP 3KMCA 4GR3A 1MMBA 3LGPA 1GE7A 4IN9A 456CA 5I2ZA 3OHOA 3KMEA 2K9CA 2Y6DA 3Q2GA 3DPFA 4H3XA 2O36A 5D1UA 1BSWA 2OXUA 4ON1A 3CKIA 3N2UA 4DPEA 1EAKA 1O0TA 1PWWA 2J0TA 1KUKA 3RTTA 2YIGA 4XCTA 1HV5A 1JKYA 1UMTA 5B5PA 3N2VA 2DDFA 1IABA 2USNA 3MA2A 4H30A 830CA 2DDYA 5H8XA 1UTZA 3F15A 4GWMA 4H84A 1DTHA 5I0LA 2N8RA 1OM6A 2EROA 1R1HA 2JT6A 5CZMA 1J7NA 1QIAA 2POJA 1QUAA 1EUBA 4L6TA 1SATA 3DWBA 1ZVXA 2OY2A 1G05A 4CTHA 3LE9A 1SU3A 1KUGA 3HBUP 2X3BA 2ERPA 1GE5A 3RTSA 3TSKA 1JH1A 3WV2A 2MZEA 4ZR5A 1IAGA 3F17A 1SRPA 1WNIA 1MNCA 3E8RA 1S4BP 3DL1A 3LQ0A 4Q1LA 4PKRA 1BUDA 1D5JA
chains in the Genus database with same CATH superfamily
1JJ9A 4WKEA 2OW1A 2AYKA 1JK3A 1OS9A 966CA 2D1OA 5D3CA 1IACA 5JMYA 1GXDA 3LMCA 1GKDA 1ZP5A 2W14A 2JIHA 3LIKA 3SHIA 1IAEA 4HX3A 1ATLA 3HBVP 1HTDA 1CGFA 1Q3AA 3L0TA 1AYKA 3NX7A 1SLMA 2YB9A 3B92A 1OZ9A 2W15A 4FU4A 2L0RA 3TVCA 5L79A 3ZXHA 5D7WA 1Y93A 1XAXA 3G5CA 4GQLA 4I35A 2FV5A 4XM8A 1ASTA 2ERQA 1K7IA 1H71P 4L63A 3VI1A 1B3DA 1KUFA 3LUNA 4AXQA 2OY4A 1ND1A 4H82A 4A7BA 4PKWA 1G12A 1QICA 1GO8P 1K7QA 3KEJA 1BZSA 1HY7A 2X7MA 1GE6A 4H2EA 3KRYA 4L19A 1KBCA 4WK7A 3G42A 3DTIA 3L0VA 3DTKA 4A3WA 3BA0A 4PKUA 4H1QA 1GO7P 4QKZA 2RJPA 1R1IA 4JP4A 4R3VA 3TS4A 3TT4A 1D8MA 4XM7A 4ILWD 5B5OA 3LJGA 1G9KA 1BKCA 3F16A 5I12A 3LQBA 4IUWA 1SMPA 5I43A 3GBOA 4GR0A 2MLRA 3EDGA 3AYUA 5D2BA 4DF9A 3LK8A 1XFYA 1D8FA 1A86A 1JIZA 2OVXA 1IAAA 1JAPA 1ZXCA 2KRJA 4FVLA 4H49A 4WKIA 2Y6CA 3KECA 2D1NA 1XFUA 2HU6A 1UMSA 3EDZA 1BKCE 4JQGA 5LABA 1QJIA 1SLNA 3O2XA 3VTGA 1ROSA 1D7XA 3LEAA 2MZIA 1B8YA 4IJOA 2JSDA 4J4MA 2OZRA 3ZUKA 2OXZA 1BQOA 1MMPA 4XM6A 4EFSA 1C7KA 1KUIA 1USNA 1A85A 3LKAA 5CUHA 4HMAA 3V96B 3P1VA 2J83A 1HFSA 4WF6A 2MZHA 3DPEA 4GF1A 2OW9A 2XS4A 2E3XA 3I7GA 2SRTA 5D1TA 4PKQA 2MLSA 3HDBA 4PKVA 4GUYA 2WO8A 3Q2HA 2E2DA 3DNGA 1C8TA 4GWNA 3ZVSA 2A8HA 4JIJA 2OVZA 3U1RA 1MMRA 3KEKA 3AYKA 3F18A 3HY7A 5BPAA 3LUMA 3HY9A 2DW1A 1IADA 1L6JA 1G49A 3KHIA 1Y0VA 1YOUA 1CXVA 1KUHA 4WZVA 4AIGA 2AIGP 3EHXA 3ELMA 1XFWA 1C3IA 1OM8A 4G9LA 1BKCI 1K7GA 3EWJA 1G4KA 1KAPP 3HYGA 2JNPA 1ZTQA 4JA1A 1O0QA 1YCMA 1FLSA 1Z3JA 2X3AA 1CQRA 4AYKA 1RM8A 1CK7A 2PJTA 5I3MA 4JPAA 3UVCA 1BQQM 4H76A 4XBHA 1CIZA 2OI0A 3HB2P 1BM6A 1I73A 3F1AA 5D1SA 3K7LA 2RJQA 3KWVC 4FXQA 3WV3A 5BOYA 1XM5A 2CLTA 4I03A 2FV9A 1BUVM 3DSLA 1DMTA 3HDAP 3LIRA 1HFCA 1RMZA 1OS2A 1XUCA 2K2GA 2WO9A 2YUFA 1OM7A 4PKTA 2I47A 1XFXA 2O3EA 1PWQA 4PKSA 3AIGA 5L7FA 2TCLA 1CGLA 4AUOA 2WOAA 4L7AA 2JT5A 2Z2DA 1EB6A 5CXAA 1XFZA 1FM1A 1GKCA 1JAQA 3K7NA 3EDHA 3LJZA 1R55A 4DD8A 1HOVA 1XURA 1JANA 1UEAA 3EDIA 3OHLA 3LILA 1TVIA 1ZS0A 1Y8JA 4GR8A 1PWPA 4FXYP 1MMQA 5I4OA 3B2ZA 1XFVA 2CKIA 1I76A 2OW0A 1BIWA 2V4BA 2W0DA 1CGEA 3B8ZA 1QIBA 1FBLA 1ZXVA 2DW0A 2W13A 3LJTA 3F19A 2DW2A 3USNA 5BOTA 1YQYA 1R54A 1OMJA 1PWUA 2W12A 1I1IP 1XUDA 4G0DA 1OO9A 1JAOA 3WV1A 2XS3A 1PWVA 2QPJA 1YP1A 1QJJA 1AKLA 1CAQA 3I7IA 2OXWA 1UTTA 3P24A 2OW2A 3EHYA 1R1JA 2X3CA 4DV8A 3O64A 1AF0A 1JIWP 3KMCA 4GR3A 1MMBA 3LGPA 1GE7A 4IN9A 456CA 5I2ZA 3OHOA 3KMEA 2K9CA 2Y6DA 3Q2GA 3DPFA 4H3XA 2O36A 5D1UA 1BSWA 2OXUA 4ON1A 3CKIA 3N2UA 4DPEA 1EAKA 1O0TA 1PWWA 2J0TA 1KUKA 3RTTA 2YIGA 4XCTA 1HV5A 1JKYA 1UMTA 5B5PA 3N2VA 2DDFA 1IABA 2USNA 3MA2A 4H30A 830CA 2DDYA 5H8XA 1UTZA 3F15A 4GWMA 4H84A 1DTHA 5I0LA 2N8RA 1OM6A 2EROA 1R1HA 2JT6A 5CZMA 1J7NA 1QIAA 2POJA 1QUAA 1EUBA 4L6TA 1SATA 3DWBA 1ZVXA 3DTEA 2OY2A 1G05A 4CTHA 3LE9A 1SU3A 1KUGA 3HBUP 2X3BA 2ERPA 1GE5A 3RTSA 3TSKA 1JH1A 3WV2A 2MZEA 4ZR5A 1IAGA 3F17A 1SRPA 1WNIA 1MNCA 3E8RA 1S4BP 3DL1A 3LQ0A 4Q1LA 4PKRA 1BUDA 1D5JA
chains in the Genus database with same CATH topology
1JJ9A 4WKEA 2OW1A 2AYKA 1JK3A 1OS9A 966CA 2D1OA 5D3CA 1IACA 5JMYA 1GXDA 3LMCA 1GKDA 1ZP5A 2W14A 2JIHA 3LIKA 3SHIA 1IAEA 4HX3A 1ATLA 3HBVP 1HTDA 1CGFA 1Q3AA 3L0TA 1AYKA 3NX7A 1SLMA 2YB9A 3B92A 2W15A 4FU4A 2L0RA 3TVCA 5L79A 3ZXHA 5D7WA 1Y93A 3G5CA 4GQLA 4I35A 2FV5A 4XM8A 1ASTA 2ERQA 1K7IA 1H71P 4L63A 3VI1A 1B3DA 1KUFA 3LUNA 4AXQA 2OY4A 1ND1A 4H82A 4A7BA 4PKWA 1G12A 1QICA 1GO8P 1K7QA 3KEJA 1BZSA 1HY7A 2X7MA 1GE6A 4H2EA 3KRYA 4L19A 1KBCA 4WK7A 3G42A 3DTIA 3L0VA 3DTKA 4A3WA 3BA0A 4PKUA 4H1QA 1GO7P 4QKZA 2RJPA 1R1IA 4JP4A 4R3VA 3TS4A 3TT4A 1D8MA 4XM7A 4ILWD 5B5OA 3LJGA 1G9KA 1BKCA 3F16A 5I12A 3LQBA 4IUWA 1SMPA 5I43A 3GBOA 4GR0A 2MLRA 3EDGA 3AYUA 5D2BA 4DF9A 3LK8A 1XFYA 1D8FA 1A86A 1JIZA 2OVXA 1IAAA 1JAPA 1ZXCA 2KRJA 4FVLA 4H49A 4WKIA 2Y6CA 3KECA 2D1NA 1XFUA 2HU6A 1UMSA 3EDZA 1BKCE 4JQGA 5LABA 1QJIA 1SLNA 3O2XA 3VTGA 1ROSA 1D7XA 3LEAA 2MZIA 1B8YA 4IJOA 2JSDA 4J4MA 2OZRA 3ZUKA 2OXZA 1BQOA 1MMPA 4XM6A 4EFSA 1C7KA 1KUIA 1USNA 1A85A 3LKAA 5CUHA 4HMAA 3V96B 3P1VA 2J83A 1HFSA 4WF6A 2MZHA 3DPEA 4GF1A 2OW9A 2XS4A 2E3XA 3I7GA 2SRTA 5D1TA 4PKQA 2MLSA 3HDBA 4PKVA 4GUYA 2WO8A 3Q2HA 2E2DA 3DNGA 1C8TA 4GWNA 3ZVSA 2A8HA 4JIJA 2OVZA 3U1RA 1MMRA 3KEKA 3AYKA 3F18A 3HY7A 5BPAA 3LUMA 3HY9A 2DW1A 1IADA 1L6JA 1G49A 3KHIA 1Y0VA 1YOUA 1CXVA 1KUHA 4WZVA 4AIGA 2AIGP 3EHXA 3ELMA 1XFWA 1C3IA 1OM8A 4G9LA 1BKCI 1K7GA 3EWJA 1G4KA 1KAPP 3HYGA 2JNPA 1ZTQA 4JA1A 1O0QA 1YCMA 1FLSA 1Z3JA 2X3AA 1CQRA 4AYKA 1RM8A 1CK7A 2PJTA 5I3MA 4JPAA 3UVCA 1BQQM 4H76A 4XBHA 1CIZA 2OI0A 3HB2P 1BM6A 1I73A 3F1AA 5D1SA 3K7LA 2RJQA 3KWVC 4FXQA 3WV3A 5BOYA 2CLTA 4I03A 2FV9A 1BUVM 3DSLA 1DMTA 3HDAP 3LIRA 1HFCA 1RMZA 1OS2A 1XUCA 2K2GA 2WO9A 2YUFA 1OM7A 4PKTA 2I47A 1XFXA 2O3EA 1PWQA 4PKSA 3AIGA 5L7FA 2TCLA 1CGLA 4AUOA 2WOAA 4L7AA 2JT5A 2Z2DA 1EB6A 5CXAA 1XFZA 1FM1A 1GKCA 1JAQA 3K7NA 3EDHA 3LJZA 1R55A 4DD8A 1HOVA 1XURA 1JANA 1UEAA 3EDIA 3OHLA 3LILA 1ZS0A 1Y8JA 4GR8A 1PWPA 4FXYP 1MMQA 5I4OA 3B2ZA 1XFVA 2CKIA 1I76A 2OW0A 1BIWA 2V4BA 2W0DA 1CGEA 3B8ZA 1QIBA 1FBLA 1ZXVA 2DW0A 2W13A 3LJTA 3F19A 2DW2A 3USNA 5BOTA 1YQYA 1R54A 1OMJA 1PWUA 2W12A 1I1IP 1XUDA 4G0DA 1OO9A 1JAOA 3WV1A 2XS3A 1PWVA 2QPJA 1YP1A 1QJJA 1AKLA 1CAQA 3I7IA 2OXWA 1UTTA 3P24A 2OW2A 3EHYA 1R1JA 2X3CA 4DV8A 3O64A 1AF0A 1JIWP 3KMCA 4GR3A 1MMBA 3LGPA 1GE7A 4IN9A 456CA 5I2ZA 3OHOA 3KMEA 2K9CA 2Y6DA 3Q2GA 3DPFA 4H3XA 2O36A 5D1UA 1BSWA 2OXUA 4ON1A 3CKIA 3N2UA 4DPEA 1EAKA 1O0TA 1PWWA 2J0TA 1KUKA 3RTTA 2YIGA 4XCTA 1HV5A 1JKYA 1UMTA 5B5PA 3N2VA 2DDFA 1IABA 2USNA 3MA2A 4H30A 830CA 2DDYA 5H8XA 1UTZA 3F15A 4GWMA 4H84A 1DTHA 5I0LA 2N8RA 1OM6A 2EROA 1R1HA 2JT6A 5CZMA 1J7NA 1QIAA 2POJA 1QUAA 1EUBA 4L6TA 1SATA 3DWBA 1ZVXA 3DTEA 2OY2A 1G05A 4CTHA 3LE9A 1SU3A 1KUGA 3HBUP 2X3BA 2ERPA 1GE5A 3RTSA 3TSKA 1JH1A 3WV2A 2MZEA 4ZR5A 1IAGA 3F17A 1SRPA 1WNIA 1MNCA 3E8RA 1S4BP 3DL1A 3LQ0A 4Q1LA 4PKRA 1BUDA 1D5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ9 A;  4WKE A;  2OW1 A;  2AYK A;  1JK3 A;  1OS9 A;  966C A;  2D1O A;  5D3C A;  1IAC A;  5JMY A;  1GXD A;  3LMC A;  1GKD A;  1ZP5 A;  2W14 A;  2JIH A;  3LIK A;  3SHI A;  1IAE A;  4HX3 A;  1ATL A;  3HBV P;  1HTD A;  1CGF A;  1Q3A A;  3L0T A;  1AYK A;  3NX7 A;  1SLM A;  2YB9 A;  3B92 A;  2W15 A;  4FU4 A;  2L0R A;  3TVC A;  5L79 A;  3ZXH A;  5D7W A;  1Y93 A;  3G5C A;  4GQL A;  4I35 A;  2FV5 A;  4XM8 A;  1AST A;  2ERQ A;  1K7I A;  1H71 P;  4L63 A;  3VI1 A;  1B3D A;  1KUF A;  3LUN A;  4AXQ A;  2OY4 A;  1ND1 A;  4H82 A;  4A7B A;  4PKW A;  1G12 A;  1QIC A;  1GO8 P;  1K7Q A;  3KEJ A;  1BZS A;  1HY7 A;  2X7M A;  1GE6 A;  4H2E A;  3KRY A;  4L19 A;  1KBC A;  4WK7 A;  3G42 A;  3L0V A;  4A3W A;  3BA0 A;  4PKU A;  4H1Q A;  1GO7 P;  4QKZ A;  2RJP A;  1R1I A;  4JP4 A;  4R3V A;  3TS4 A;  3TT4 A;  1D8M A;  4XM7 A;  4ILW D;  5B5O A;  3LJG A;  1G9K A;  1BKC A;  3F16 A;  5I12 A;  3LQB A;  4IUW A;  1SMP A;  5I43 A;  3GBO A;  4GR0 A;  2MLR A;  3EDG A;  3AYU A;  5D2B A;  4DF9 A;  3LK8 A;  1XFY A;  1D8F A;  1A86 A;  1JIZ A;  2OVX A;  1IAA A;  1JAP A;  1ZXC A;  2KRJ A;  4FVL A;  4H49 A;  4WKI A;  2Y6C A;  3KEC A;  2D1N A;  1XFU A;  2HU6 A;  1UMS A;  3EDZ A;  1BKC E;  4JQG A;  5LAB A;  1QJI A;  1SLN A;  3O2X A;  3VTG A;  1ROS A;  1D7X A;  3LEA A;  2MZI A;  1B8Y A;  4IJO A;  2JSD A;  4J4M A;  2OZR A;  3ZUK A;  2OXZ A;  1BQO A;  1MMP A;  4XM6 A;  4EFS A;  1C7K A;  1KUI A;  1USN A;  1A85 A;  3LKA A;  5CUH A;  4HMA A;  3V96 B;  3P1V A;  2J83 A;  1HFS A;  4WF6 A;  2MZH A;  3DPE A;  4GF1 A;  2OW9 A;  2XS4 A;  2E3X A;  3I7G A;  2SRT A;  5D1T A;  4PKQ A;  2MLS A;  3HDB A;  4PKV A;  4GUY A;  2WO8 A;  3Q2H A;  2E2D A;  3DNG A;  1C8T A;  4GWN A;  3ZVS A;  2A8H A;  4JIJ A;  2OVZ A;  3U1R A;  1MMR A;  3KEK A;  3AYK A;  3F18 A;  3HY7 A;  5BPA A;  3LUM A;  3HY9 A;  2DW1 A;  1IAD A;  1L6J A;  1G49 A;  3KHI A;  1Y0V A;  1YOU A;  1CXV A;  1KUH A;  4WZV A;  4AIG A;  2AIG P;  3EHX A;  3ELM A;  1XFW A;  1C3I A;  1OM8 A;  4G9L A;  1BKC I;  1K7G A;  3EWJ A;  1G4K A;  1KAP P;  3HYG A;  2JNP A;  1ZTQ A;  4JA1 A;  1O0Q A;  1YCM A;  1FLS A;  1Z3J A;  2X3A A;  1CQR A;  4AYK A;  1RM8 A;  1CK7 A;  2PJT A;  5I3M A;  4JPA A;  3UVC A;  1BQQ M;  4H76 A;  4XBH A;  1CIZ A;  2OI0 A;  3HB2 P;  1BM6 A;  1I73 A;  3F1A A;  5D1S A;  3K7L A;  2RJQ A;  3KWV C;  4FXQ A;  3WV3 A;  5BOY A;  2CLT A;  4I03 A;  2FV9 A;  1BUV M;  3DSL A;  1DMT A;  3HDA P;  3LIR A;  1HFC A;  1RMZ A;  1OS2 A;  1XUC A;  2K2G A;  2WO9 A;  1OM7 A;  4PKT A;  2I47 A;  1XFX A;  2O3E A;  1PWQ A;  4PKS A;  3AIG A;  5L7F A;  2TCL A;  1CGL A;  4AUO A;  2WOA A;  2JT5 A;  2Z2D A;  1EB6 A;  5CXA A;  1XFZ A;  1FM1 A;  1GKC A;  1JAQ A;  3K7N A;  3EDH A;  3LJZ A;  1R55 A;  4DD8 A;  1HOV A;  1XUR A;  1JAN A;  1UEA A;  3EDI A;  3OHL A;  3LIL A;  1ZS0 A;  1Y8J A;  4GR8 A;  1PWP A;  4FXY P;  1MMQ A;  5I4O A;  3B2Z A;  1XFV A;  2CKI A;  1I76 A;  2OW0 A;  1BIW A;  2V4B A;  2W0D A;  1CGE A;  3B8Z A;  1QIB A;  1FBL A;  1ZXV A;  2DW0 A;  2W13 A;  3LJT A;  3F19 A;  2DW2 A;  3USN A;  5BOT A;  1YQY A;  1R54 A;  1OMJ A;  1PWU A;  2W12 A;  1I1I P;  1XUD A;  4G0D A;  1OO9 A;  1JAO A;  3WV1 A;  2XS3 A;  1PWV A;  2QPJ A;  1YP1 A;  1QJJ A;  1AKL A;  1CAQ A;  3I7I A;  2OXW A;  1UTT A;  3P24 A;  2OW2 A;  3EHY A;  1R1J A;  2X3C A;  4DV8 A;  3O64 A;  1AF0 A;  1JIW P;  3KMC A;  4GR3 A;  1MMB A;  3LGP A;  1GE7 A;  4IN9 A;  456C A;  5I2Z A;  3OHO A;  3KME A;  2K9C A;  2Y6D A;  3Q2G A;  3DPF A;  4H3X A;  2O36 A;  5D1U A;  1BSW A;  2OXU A;  4ON1 A;  3CKI A;  3N2U A;  4DPE A;  1EAK A;  1O0T A;  1PWW A;  2J0T A;  1KUK A;  3RTT A;  2YIG A;  4XCT A;  1HV5 A;  1JKY A;  1UMT A;  5B5P A;  3N2V A;  2DDF A;  1IAB A;  2USN A;  3MA2 A;  4H30 A;  830C A;  2DDY A;  5H8X A;  1UTZ A;  3F15 A;  4GWM A;  4H84 A;  1DTH A;  5I0L A;  2N8R A;  1OM6 A;  2ERO A;  1R1H A;  2JT6 A;  5CZM A;  1J7N A;  1QIA A;  2POJ A;  1QUA A;  1EUB A;  4L6T A;  1SAT A;  3DWB A;  1ZVX A;  2OY2 A;  1G05 A;  4CTH A;  3LE9 A;  1SU3 A;  1KUG A;  3HBU P;  2X3B A;  2ERP A;  1GE5 A;  3RTS A;  3TSK A;  1JH1 A;  3WV2 A;  2MZE A;  4ZR5 A;  1IAG A;  3F17 A;  1SRP A;  1WNI A;  1MNC A;  3E8R A;  1S4B P;  3DL1 A;  3LQ0 A;  4Q1L A;  4PKR A;  1BUD A;  1D5J A; 
#chains in the Genus database with same CATH topology
 1JJ9 A;  4WKE A;  2OW1 A;  2AYK A;  1JK3 A;  1OS9 A;  966C A;  2D1O A;  5D3C A;  1IAC A;  5JMY A;  1GXD A;  3LMC A;  1GKD A;  1ZP5 A;  2W14 A;  2JIH A;  3LIK A;  3SHI A;  1IAE A;  4HX3 A;  1ATL A;  3HBV P;  1HTD A;  1CGF A;  1Q3A A;  3L0T A;  1AYK A;  3NX7 A;  1SLM A;  2YB9 A;  3B92 A;  1OZ9 A;  2W15 A;  4FU4 A;  2L0R A;  3TVC A;  5L79 A;  3ZXH A;  5D7W A;  1Y93 A;  1XAX A;  3G5C A;  4GQL A;  4I35 A;  2FV5 A;  4XM8 A;  1AST A;  2ERQ A;  1K7I A;  1H71 P;  4L63 A;  3VI1 A;  1B3D A;  1KUF A;  3LUN A;  4AXQ A;  2OY4 A;  1ND1 A;  4H82 A;  4A7B A;  4PKW A;  1G12 A;  1QIC A;  1GO8 P;  1K7Q A;  3KEJ A;  1BZS A;  1HY7 A;  2X7M A;  1GE6 A;  4H2E A;  3KRY A;  4L19 A;  1KBC A;  4WK7 A;  3G42 A;  3DTI A;  3L0V A;  3DTK A;  4A3W A;  3BA0 A;  4PKU A;  4H1Q A;  1GO7 P;  4QKZ A;  2RJP A;  1R1I A;  4JP4 A;  4R3V A;  3TS4 A;  3TT4 A;  1D8M A;  4XM7 A;  4ILW D;  5B5O A;  3LJG A;  1G9K A;  1BKC A;  3F16 A;  5I12 A;  3LQB A;  4IUW A;  1SMP A;  5I43 A;  3GBO A;  4GR0 A;  2MLR A;  3EDG A;  3AYU A;  5D2B A;  4DF9 A;  3LK8 A;  1XFY A;  1D8F A;  1A86 A;  1JIZ A;  2OVX A;  1IAA A;  1JAP A;  1ZXC A;  2KRJ A;  4FVL A;  4H49 A;  4WKI A;  2Y6C A;  3KEC A;  2D1N A;  1XFU A;  2HU6 A;  1UMS A;  3EDZ A;  1BKC E;  4JQG A;  5LAB A;  1QJI A;  1SLN A;  3O2X A;  3VTG A;  1ROS A;  1D7X A;  3LEA A;  2MZI A;  1B8Y A;  4IJO A;  2JSD A;  4J4M A;  2OZR A;  3ZUK A;  2OXZ A;  1BQO A;  1MMP A;  4XM6 A;  4EFS A;  1C7K A;  1KUI A;  1USN A;  1A85 A;  3LKA A;  5CUH A;  4HMA A;  3V96 B;  3P1V A;  2J83 A;  1HFS A;  4WF6 A;  2MZH A;  3DPE A;  4GF1 A;  2OW9 A;  2XS4 A;  2E3X A;  3I7G A;  2SRT A;  5D1T A;  4PKQ A;  2MLS A;  3HDB A;  4PKV A;  4GUY A;  2WO8 A;  3Q2H A;  2E2D A;  3DNG A;  1C8T A;  4GWN A;  3ZVS A;  2A8H A;  4JIJ A;  2OVZ A;  3U1R A;  1MMR A;  3KEK A;  3AYK A;  3F18 A;  3HY7 A;  5BPA A;  3LUM A;  3HY9 A;  2DW1 A;  1IAD A;  1L6J A;  1G49 A;  3KHI A;  1Y0V A;  1YOU A;  1CXV A;  1KUH A;  4WZV A;  4AIG A;  2AIG P;  3EHX A;  3ELM A;  1XFW A;  1C3I A;  1OM8 A;  4G9L A;  1BKC I;  1K7G A;  3EWJ A;  1G4K A;  1KAP P;  3HYG A;  2JNP A;  1ZTQ A;  4JA1 A;  1O0Q A;  1YCM A;  1FLS A;  1Z3J A;  2X3A A;  1CQR A;  4AYK A;  1RM8 A;  1CK7 A;  2PJT A;  5I3M A;  4JPA A;  3UVC A;  1BQQ M;  4H76 A;  4XBH A;  1CIZ A;  2OI0 A;  3HB2 P;  1BM6 A;  1I73 A;  3F1A A;  5D1S A;  3K7L A;  2RJQ A;  3KWV C;  4FXQ A;  3WV3 A;  5BOY A;  1XM5 A;  2CLT A;  4I03 A;  2FV9 A;  1BUV M;  3DSL A;  1DMT A;  3HDA P;  3LIR A;  1HFC A;  1RMZ A;  1OS2 A;  1XUC A;  2K2G A;  2WO9 A;  2YUF A;  1OM7 A;  4PKT A;  2I47 A;  1XFX A;  2O3E A;  1PWQ A;  4PKS A;  3AIG A;  5L7F A;  2TCL A;  1CGL A;  4AUO A;  2WOA A;  4L7A A;  2JT5 A;  2Z2D A;  1EB6 A;  5CXA A;  1XFZ A;  1FM1 A;  1GKC A;  1JAQ A;  3K7N A;  3EDH A;  3LJZ A;  1R55 A;  4DD8 A;  1HOV A;  1XUR A;  1JAN A;  1UEA A;  3EDI A;  3OHL A;  3LIL A;  1TVI A;  1ZS0 A;  1Y8J A;  4GR8 A;  1PWP A;  4FXY P;  1MMQ A;  5I4O A;  3B2Z A;  1XFV A;  2CKI A;  1I76 A;  2OW0 A;  1BIW A;  2V4B A;  2W0D A;  1CGE A;  3B8Z A;  1QIB A;  1FBL A;  1ZXV A;  2DW0 A;  2W13 A;  3LJT A;  3F19 A;  2DW2 A;  3USN A;  5BOT A;  1YQY A;  1R54 A;  1OMJ A;  1PWU A;  2W12 A;  1I1I P;  1XUD A;  4G0D A;  1OO9 A;  1JAO A;  3WV1 A;  2XS3 A;  1PWV A;  2QPJ A;  1YP1 A;  1QJJ A;  1AKL A;  1CAQ A;  3I7I A;  2OXW A;  1UTT A;  3P24 A;  2OW2 A;  3EHY A;  1R1J A;  2X3C A;  4DV8 A;  3O64 A;  1AF0 A;  1JIW P;  3KMC A;  4GR3 A;  1MMB A;  3LGP A;  1GE7 A;  4IN9 A;  456C A;  5I2Z A;  3OHO A;  3KME A;  2K9C A;  2Y6D A;  3Q2G A;  3DPF A;  4H3X A;  2O36 A;  5D1U A;  1BSW A;  2OXU A;  4ON1 A;  3CKI A;  3N2U A;  4DPE A;  1EAK A;  1O0T A;  1PWW A;  2J0T A;  1KUK A;  3RTT A;  2YIG A;  4XCT A;  1HV5 A;  1JKY A;  1UMT A;  5B5P A;  3N2V A;  2DDF A;  1IAB A;  2USN A;  3MA2 A;  4H30 A;  830C A;  2DDY A;  5H8X A;  1UTZ A;  3F15 A;  4GWM A;  4H84 A;  1DTH A;  5I0L A;  2N8R A;  1OM6 A;  2ERO A;  1R1H A;  2JT6 A;  5CZM A;  1J7N A;  1QIA A;  2POJ A;  1QUA A;  1EUB A;  4L6T A;  1SAT A;  3DWB A;  1ZVX A;  3DTE A;  2OY2 A;  1G05 A;  4CTH A;  3LE9 A;  1SU3 A;  1KUG A;  3HBU P;  2X3B A;  2ERP A;  1GE5 A;  3RTS A;  3TSK A;  1JH1 A;  3WV2 A;  2MZE A;  4ZR5 A;  1IAG A;  3F17 A;  1SRP A;  1WNI A;  1MNC A;  3E8R A;  1S4B P;  3DL1 A;  3LQ0 A;  4Q1L A;  4PKR A;  1BUD A;  1D5J A; 
#chains in the Genus database with same CATH homology
 1JJ9 A;  4WKE A;  2OW1 A;  2AYK A;  1JK3 A;  1OS9 A;  966C A;  2D1O A;  5D3C A;  1IAC A;  5JMY A;  1GXD A;  3LMC A;  1GKD A;  1ZP5 A;  2W14 A;  2JIH A;  3LIK A;  3SHI A;  1IAE A;  4HX3 A;  1ATL A;  3HBV P;  1HTD A;  1CGF A;  1Q3A A;  3L0T A;  1AYK A;  3NX7 A;  1SLM A;  2YB9 A;  3B92 A;  2W15 A;  4FU4 A;  2L0R A;  3TVC A;  5L79 A;  3ZXH A;  5D7W A;  1Y93 A;  3G5C A;  4GQL A;  4I35 A;  2FV5 A;  4XM8 A;  1AST A;  2ERQ A;  1K7I A;  1H71 P;  4L63 A;  3VI1 A;  1B3D A;  1KUF A;  3LUN A;  4AXQ A;  2OY4 A;  1ND1 A;  4H82 A;  4A7B A;  4PKW A;  1G12 A;  1QIC A;  1GO8 P;  1K7Q A;  3KEJ A;  1BZS A;  1HY7 A;  2X7M A;  1GE6 A;  4H2E A;  3KRY A;  4L19 A;  1KBC A;  4WK7 A;  3G42 A;  3DTI A;  3L0V A;  3DTK A;  4A3W A;  3BA0 A;  4PKU A;  4H1Q A;  1GO7 P;  4QKZ A;  2RJP A;  1R1I A;  4JP4 A;  4R3V A;  3TS4 A;  3TT4 A;  1D8M A;  4XM7 A;  4ILW D;  5B5O A;  3LJG A;  1G9K A;  1BKC A;  3F16 A;  5I12 A;  3LQB A;  4IUW A;  1SMP A;  5I43 A;  3GBO A;  4GR0 A;  2MLR A;  3EDG A;  3AYU A;  5D2B A;  4DF9 A;  3LK8 A;  1XFY A;  1D8F A;  1A86 A;  1JIZ A;  2OVX A;  1IAA A;  1JAP A;  1ZXC A;  2KRJ A;  4FVL A;  4H49 A;  4WKI A;  2Y6C A;  3KEC A;  2D1N A;  1XFU A;  2HU6 A;  1UMS A;  3EDZ A;  1BKC E;  4JQG A;  5LAB A;  1QJI A;  1SLN A;  3O2X A;  3VTG A;  1ROS A;  1D7X A;  3LEA A;  2MZI A;  1B8Y A;  4IJO A;  2JSD A;  4J4M A;  2OZR A;  3ZUK A;  2OXZ A;  1BQO A;  1MMP A;  4XM6 A;  4EFS A;  1C7K A;  1KUI A;  1USN A;  1A85 A;  3LKA A;  5CUH A;  4HMA A;  3V96 B;  3P1V A;  2J83 A;  1HFS A;  4WF6 A;  2MZH A;  3DPE A;  4GF1 A;  2OW9 A;  2XS4 A;  2E3X A;  3I7G A;  2SRT A;  5D1T A;  4PKQ A;  2MLS A;  3HDB A;  4PKV A;  4GUY A;  2WO8 A;  3Q2H A;  2E2D A;  3DNG A;  1C8T A;  4GWN A;  3ZVS A;  2A8H A;  4JIJ A;  2OVZ A;  3U1R A;  1MMR A;  3KEK A;  3AYK A;  3F18 A;  3HY7 A;  5BPA A;  3LUM A;  3HY9 A;  2DW1 A;  1IAD A;  1L6J A;  1G49 A;  3KHI A;  1Y0V A;  1YOU A;  1CXV A;  1KUH A;  4WZV A;  4AIG A;  2AIG P;  3EHX A;  3ELM A;  1XFW A;  1C3I A;  1OM8 A;  4G9L A;  1BKC I;  1K7G A;  3EWJ A;  1G4K A;  1KAP P;  3HYG A;  2JNP A;  1ZTQ A;  4JA1 A;  1O0Q A;  1YCM A;  1FLS A;  1Z3J A;  2X3A A;  1CQR A;  4AYK A;  1RM8 A;  1CK7 A;  2PJT A;  5I3M A;  4JPA A;  3UVC A;  1BQQ M;  4H76 A;  4XBH A;  1CIZ A;  2OI0 A;  3HB2 P;  1BM6 A;  1I73 A;  3F1A A;  5D1S A;  3K7L A;  2RJQ A;  3KWV C;  4FXQ A;  3WV3 A;  5BOY A;  2CLT A;  4I03 A;  2FV9 A;  1BUV M;  3DSL A;  1DMT A;  3HDA P;  3LIR A;  1HFC A;  1RMZ A;  1OS2 A;  1XUC A;  2K2G A;  2WO9 A;  2YUF A;  1OM7 A;  4PKT A;  2I47 A;  1XFX A;  2O3E A;  1PWQ A;  4PKS A;  3AIG A;  5L7F A;  2TCL A;  1CGL A;  4AUO A;  2WOA A;  4L7A A;  2JT5 A;  2Z2D A;  1EB6 A;  5CXA A;  1XFZ A;  1FM1 A;  1GKC A;  1JAQ A;  3K7N A;  3EDH A;  3LJZ A;  1R55 A;  4DD8 A;  1HOV A;  1XUR A;  1JAN A;  1UEA A;  3EDI A;  3OHL A;  3LIL A;  1ZS0 A;  1Y8J A;  4GR8 A;  1PWP A;  4FXY P;  1MMQ A;  5I4O A;  3B2Z A;  1XFV A;  2CKI A;  1I76 A;  2OW0 A;  1BIW A;  2V4B A;  2W0D A;  1CGE A;  3B8Z A;  1QIB A;  1FBL A;  1ZXV A;  2DW0 A;  2W13 A;  3LJT A;  3F19 A;  2DW2 A;  3USN A;  5BOT A;  1YQY A;  1R54 A;  1OMJ A;  1PWU A;  2W12 A;  1I1I P;  1XUD A;  4G0D A;  1OO9 A;  1JAO A;  3WV1 A;  2XS3 A;  1PWV A;  2QPJ A;  1YP1 A;  1QJJ A;  1AKL A;  1CAQ A;  3I7I A;  2OXW A;  1UTT A;  3P24 A;  2OW2 A;  3EHY A;  1R1J A;  2X3C A;  4DV8 A;  3O64 A;  1AF0 A;  1JIW P;  3KMC A;  4GR3 A;  1MMB A;  3LGP A;  1GE7 A;  4IN9 A;  456C A;  5I2Z A;  3OHO A;  3KME A;  2K9C A;  2Y6D A;  3Q2G A;  3DPF A;  4H3X A;  2O36 A;  5D1U A;  1BSW A;  2OXU A;  4ON1 A;  3CKI A;  3N2U A;  4DPE A;  1EAK A;  1O0T A;  1PWW A;  2J0T A;  1KUK A;  3RTT A;  2YIG A;  4XCT A;  1HV5 A;  1JKY A;  1UMT A;  5B5P A;  3N2V A;  2DDF A;  1IAB A;  2USN A;  3MA2 A;  4H30 A;  830C A;  2DDY A;  5H8X A;  1UTZ A;  3F15 A;  4GWM A;  4H84 A;  1DTH A;  5I0L A;  2N8R A;  1OM6 A;  2ERO A;  1R1H A;  2JT6 A;  5CZM A;  1J7N A;  1QIA A;  2POJ A;  1QUA A;  1EUB A;  4L6T A;  1SAT A;  3DWB A;  1ZVX A;  3DTE A;  2OY2 A;  1G05 A;  4CTH A;  3LE9 A;  1SU3 A;  1KUG A;  3HBU P;  2X3B A;  2ERP A;  1GE5 A;  3RTS A;  3TSK A;  1JH1 A;  3WV2 A;  2MZE A;  4ZR5 A;  1IAG A;  3F17 A;  1SRP A;  1WNI A;  1MNC A;  3E8R A;  1S4B P;  3DL1 A;  3LQ0 A;  4Q1L A;  4PKR A;  1BUD A;  1D5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...