1HTDA

Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
200
structure length
200
Chain Sequence
LPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNIHVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLGLAPLGTMCDPKLSIGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTKGRSYEFSDDSMHYYERFLKQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATROLYSIN C
publication title Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin C (form d).
pubmed doi rcsb
molecule tags Metalloprotease
total genus 74
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 3.4.24.42: Atrolysin C.
pdb deposition date 1994-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1htdA00
1HTDA 1OM8A 1D7XA 1ROSA 3B8ZA 2XS3A 5B5OA 2K2GA 3HBUP 1GKCA 2OY4A 1L6JA 1FBLA 1SLMA 3KHIA 1MMQA 2DW1A 1G49A 1BKCI 1IACA 4PKSA 3ZVSA 4R3VA 2QPJA 1MNCA 2I47A 3LK8A 4L19A 3EDZA 3LUNA 5LABA 4DF9A 1QJIA 3DWBA 1JJ9A 3N2VA 2RJQA 1K7GA 830CA 1GE5A 1BUDA 5BPAA 1HOVA 1D8FA 3B92A 3DSLA 5I12A 3AYUA 1DTHA 2WO8A 1ZXCA 4H84A 3V96B 2EROA 3VI1A 5CZMA 3O64A 1PWQA 1YOUA 5D2BA 3F19A 5L7FA 4AIGA 3OHOA 3TSKA 4HMAA 1HFSA 3VTGA 3WV3A 3LJZA 2OVZA 2KRJA 1XUDA 2JT6A 2V4BA 3Q2GA 3F16A 2MZEA 1GO7P 3BA0A 4ZR5A 3GBOA 1CK7A 1QIAA 1USNA 3LJTA 4AYKA 4IUWA 3WV1A 5BOTA 4XM7A 1CGFA 1ZP5A 2Y6CA 3K7NA 3ZXHA 3SHIA 1D5JA 2Z2DA 1EAKA 1AKLA 5D1SA 3F1AA 3HBVP 4IJOA 1AF0A 5D1TA 4FVLA 966CA 3B2ZA 1OO9A 1KUFA 2OW1A 3RTSA 1IAGA 5H8XA 1CXVA 4DPEA 2OZRA 1QIBA 3HDAP 1UTZA 1C8TA 1K7QA 3F17A 1HFCA 4WK7A 1CGLA 1JK3A 1I76A 4JQGA 1B8YA 4PKWA 1ATLA 4I03A 4HX3A 3I7GA 4WZVA 1Q3AA 4XM8A 3EDGA 4DV8A 2ERQA 3AIGA 2SRTA 1GKDA 2OXWA 4H2EA 4WKEA 1AYKA 1BUVM 1PWWA 3LQBA 4H76A 1H71P 1CQRA 4H82A 3P24A 2J0TA 1PWPA 1JAPA 2ERPA 1J7NA 4FXQA 1JIZA 3KRYA 1MMRA 1ZVXA 4QKZA 2OW2A 3ELMA 4GF1A 3UVCA 3RTTA 1MMPA 1XFYA 2MLRA 3EDHA 3G42A 3MA2A 1PWUA 1R1IA 1KUGA 4DD8A 2OW9A 3HY9A 4ILWD 3LIKA 2DDYA 1SLNA 1OS2A 1KBCA 2RJPA 3KWVC 2JIHA 1QJJA 4G0DA 1FLSA 2DW2A 2OVXA 4G9LA 4ON1A 4JA1A 4JIJA 4A3WA 2W14A 4XM6A 1B3DA 4PKTA 4H3XA 1G05A 5CXAA 1JAOA 1SATA 3HB2P 1ND1A 1ZTQA 1C7KA 1QICA 4EFSA 3LIRA 2CKIA 1CAQA 3LE9A 4H1QA 4GR3A 3EDIA 1D8MA 3I7IA 1WNIA 3LQ0A 1XURA 3LMCA 1IAAA 1XFUA 1K7IA 1A85A 3LUMA 1OMJA 1BM6A 3DPFA 4GQLA 3HDBA 2TCLA 1Y93A 1OM7A 2OI0A 1OS9A 3CKIA 5BOYA 2J83A 4H30A 4GWMA 1BSWA 2WO9A 1IADA 1XFVA 1JANA 3P1VA 1BKCA 1XUCA 2X7MA 1BIWA 1Z3JA 2MZIA 2D1NA 4JPAA 4GR0A 3LKAA 1CIZA 4L6TA 3KEJA 2O3EA 1G12A 2JNPA 2W12A 3E8RA 3NX7A 2W0DA 4FXYP 5I4OA 2L0RA 4FU4A 2OY2A 2X3AA 3TS4A 4PKVA 1UMSA 1I1IP 1R1HA 4PKQA 4IN9A 2PJTA 3USNA 1IAEA 2AIGP 2OXUA 2YB9A 2E2DA 2MZHA 1JH1A 2AYKA 1XFXA 1YQYA 5D7WA 3L0TA 1RMZA 2XS4A 4J4MA 2X3BA 4GR8A 1YCMA 1R54A 2N8RA 1UTTA 2E3XA 1O0TA 1BQQM 1SRPA 1ZXVA 4WF6A 2Y6DA 3EHYA 1MMBA 1S4BP 3DNGA 3F15A 3F18A 3U1RA 2OXZA 3Q2HA 1G9KA 2CLTA 2W15A 4H49A 1SMPA 3LGPA 3OHLA 5B5PA 1SU3A 1UMTA 1Y0VA 2OW0A 1GE6A 5L79A 4A7BA 5I3MA 2MLSA 3EHXA 1XFWA 3KMEA 4GUYA 4I35A 5D3CA 2DDFA 1A86A 1OM6A 2X3CA 1O0QA 3LJGA 3DPEA 1JAQA 2HU6A 2JSDA 4XCTA 3LILA 5CUHA 2DW0A 1CGEA 3LEAA 3DL1A 2O36A 5D1UA 4AXQA 1KAPP 4XBHA 2W13A 1KUIA 3KMCA 1EUBA 1IABA 1HY7A 4CTHA 1ZS0A 5I0LA 3HYGA 1Y8JA 3N2UA 3G5CA 1RM8A 2D1OA 4JP4A 3HY7A 2A8HA 1FM1A 1R55A 5I2ZA 2POJA 1PWVA 2YIGA 1G4KA 1GXDA 2FV9A 1GO8P 1GE7A 3O2XA 2WOAA 4PKUA 3TT4A 4L63A 1EB6A 3KEKA 3WV2A 1ASTA 1KUKA 1JIWP 3EWJA 5I43A 456CA 1HV5A 2USNA 4Q1LA 3K7LA 1UEAA 1I73A 1QUAA 3KECA 1DMTA 3TVCA 4PKRA 1C3IA 2JT5A 4WKIA 1KUHA 1R1JA 4GWNA 1XFZA 1BZSA 1YP1A 3ZUKA 3L0VA 1BQOA 1JKYA 4AUOA 1BKCE 3AYKA 2FV5A 2K9CA 5JMYA
chains in the Genus database with same CATH superfamily
1HTDA 1OM8A 1D7XA 1ROSA 3B8ZA 2XS3A 5B5OA 2K2GA 3HBUP 1GKCA 2OY4A 1L6JA 1FBLA 1SLMA 3KHIA 1MMQA 2DW1A 1G49A 1BKCI 1IACA 4PKSA 3ZVSA 4R3VA 2QPJA 1MNCA 2I47A 3LK8A 4L19A 3EDZA 3LUNA 5LABA 4DF9A 1QJIA 3DWBA 1JJ9A 3N2VA 2RJQA 1K7GA 830CA 1GE5A 1BUDA 5BPAA 1HOVA 1D8FA 3B92A 3DSLA 5I12A 3AYUA 1DTHA 2WO8A 1ZXCA 4H84A 3V96B 2EROA 3VI1A 5CZMA 3O64A 1PWQA 1YOUA 5D2BA 3F19A 5L7FA 4AIGA 3OHOA 3TSKA 4HMAA 1HFSA 3VTGA 3WV3A 2OVZA 3LJZA 2KRJA 1XUDA 2JT6A 2V4BA 3Q2GA 3F16A 2MZEA 2YUFA 1GO7P 3BA0A 4ZR5A 3GBOA 1CK7A 1QIAA 1USNA 3LJTA 4AYKA 4IUWA 3WV1A 5BOTA 4XM7A 1CGFA 3DTEA 1ZP5A 2Y6CA 3K7NA 3ZXHA 3SHIA 1D5JA 2Z2DA 1EAKA 1AKLA 5D1SA 3F1AA 3HBVP 4IJOA 1AF0A 5D1TA 4FVLA 966CA 3B2ZA 1OO9A 1KUFA 2OW1A 3RTSA 1IAGA 5H8XA 1CXVA 4DPEA 2OZRA 1QIBA 3HDAP 1UTZA 1C8TA 1K7QA 3F17A 1HFCA 4WK7A 1CGLA 1JK3A 1I76A 4JQGA 1B8YA 4PKWA 1ATLA 4I03A 4HX3A 3I7GA 4WZVA 1Q3AA 4XM8A 3EDGA 4DV8A 2ERQA 3AIGA 2SRTA 1GKDA 2OXWA 4H2EA 4WKEA 1AYKA 1BUVM 1PWWA 3LQBA 4H76A 1H71P 1CQRA 4H82A 3P24A 2J0TA 1PWPA 1JAPA 2ERPA 1J7NA 4FXQA 1JIZA 3KRYA 1MMRA 1ZVXA 4QKZA 2OW2A 3ELMA 4GF1A 3UVCA 3RTTA 1MMPA 1XFYA 2MLRA 3EDHA 3G42A 3MA2A 1PWUA 1R1IA 1KUGA 4DD8A 2OW9A 3HY9A 4ILWD 3DTKA 3LIKA 2DDYA 1SLNA 1OS2A 1KBCA 2RJPA 3KWVC 2JIHA 1QJJA 4G0DA 1FLSA 2DW2A 2OVXA 4G9LA 4ON1A 4JA1A 4JIJA 4A3WA 2W14A 4XM6A 1B3DA 4PKTA 4H3XA 1G05A 5CXAA 1JAOA 1SATA 3HB2P 1ND1A 1ZTQA 1C7KA 1QICA 4EFSA 3LIRA 2CKIA 1CAQA 3LE9A 4H1QA 4GR3A 3EDIA 1D8MA 3I7IA 1WNIA 3LQ0A 1XURA 3LMCA 1IAAA 1XFUA 1K7IA 1A85A 3LUMA 1OMJA 1BM6A 3DPFA 4GQLA 3HDBA 4L7AA 2TCLA 1Y93A 1OM7A 2OI0A 1OS9A 3CKIA 5BOYA 2J83A 4H30A 4GWMA 1BSWA 2WO9A 1IADA 1XFVA 1JANA 3P1VA 1BKCA 1XUCA 2X7MA 1BIWA 1Z3JA 2MZIA 2D1NA 4JPAA 4GR0A 3LKAA 1CIZA 4L6TA 3KEJA 2O3EA 1G12A 2JNPA 2W12A 3E8RA 3NX7A 2W0DA 4FXYP 5I4OA 2L0RA 4FU4A 2OY2A 2X3AA 3TS4A 4PKVA 1UMSA 1I1IP 1R1HA 4PKQA 4IN9A 2PJTA 3USNA 1IAEA 2AIGP 2OXUA 2YB9A 2E2DA 2MZHA 1JH1A 2AYKA 1XFXA 1YQYA 5D7WA 3L0TA 1RMZA 2XS4A 4J4MA 2X3BA 4GR8A 1YCMA 1R54A 2N8RA 1UTTA 2E3XA 1O0TA 1BQQM 1SRPA 1ZXVA 4WF6A 2Y6DA 3EHYA 1MMBA 1S4BP 3DNGA 3F15A 3F18A 3U1RA 2OXZA 3Q2HA 1G9KA 2CLTA 2W15A 4H49A 1SMPA 3LGPA 3OHLA 5B5PA 1SU3A 1UMTA 1Y0VA 2OW0A 1GE6A 5L79A 4A7BA 5I3MA 2MLSA 3EHXA 1XFWA 3KMEA 4GUYA 4I35A 5D3CA 2DDFA 1A86A 1OM6A 2X3CA 1O0QA 3LJGA 3DTIA 3DPEA 1JAQA 2HU6A 2JSDA 4XCTA 3LILA 5CUHA 2DW0A 1CGEA 3LEAA 3DL1A 2O36A 5D1UA 4AXQA 1KAPP 4XBHA 2W13A 1KUIA 3KMCA 1EUBA 1IABA 1OZ9A 1HY7A 4CTHA 1ZS0A 5I0LA 3HYGA 1Y8JA 3N2UA 3G5CA 1RM8A 2D1OA 4JP4A 3HY7A 2A8HA 1FM1A 1R55A 5I2ZA 1XAXA 2POJA 1PWVA 1XM5A 2YIGA 1G4KA 1GXDA 2FV9A 1GO8P 1GE7A 3O2XA 2WOAA 4PKUA 3TT4A 4L63A 1EB6A 3KEKA 3WV2A 1ASTA 1KUKA 1JIWP 3EWJA 5I43A 456CA 1HV5A 1TVIA 2USNA 4Q1LA 3K7LA 1UEAA 1I73A 1QUAA 3KECA 1DMTA 3TVCA 4PKRA 1C3IA 2JT5A 4WKIA 1KUHA 1R1JA 4GWNA 1XFZA 1BZSA 1YP1A 3ZUKA 3L0VA 1BQOA 1JKYA 4AUOA 1BKCE 3AYKA 2FV5A 2K9CA 5JMYA
chains in the Genus database with same CATH topology
1HTDA 1OM8A 1D7XA 1ROSA 3B8ZA 2XS3A 5B5OA 2K2GA 3HBUP 1GKCA 2OY4A 1L6JA 1FBLA 1SLMA 3KHIA 1MMQA 2DW1A 1G49A 1BKCI 1IACA 4PKSA 3ZVSA 4R3VA 2QPJA 1MNCA 2I47A 3LK8A 4L19A 3EDZA 3LUNA 5LABA 4DF9A 1QJIA 3DWBA 1JJ9A 3N2VA 2RJQA 1K7GA 830CA 1GE5A 1BUDA 5BPAA 1HOVA 1D8FA 3B92A 3DSLA 5I12A 3AYUA 1DTHA 2WO8A 1ZXCA 4H84A 3V96B 2EROA 3VI1A 5CZMA 3O64A 1PWQA 1YOUA 5D2BA 3F19A 5L7FA 4AIGA 3OHOA 3TSKA 4HMAA 1HFSA 3VTGA 3WV3A 3LJZA 2OVZA 2KRJA 1XUDA 2JT6A 2V4BA 3Q2GA 3F16A 2MZEA 2YUFA 1GO7P 3BA0A 4ZR5A 3GBOA 1CK7A 1QIAA 1USNA 3LJTA 4AYKA 4IUWA 3WV1A 5BOTA 4XM7A 1CGFA 3DTEA 1ZP5A 2Y6CA 3K7NA 3ZXHA 3SHIA 1D5JA 2Z2DA 1EAKA 1AKLA 5D1SA 3F1AA 3HBVP 4IJOA 1AF0A 5D1TA 4FVLA 966CA 3B2ZA 1OO9A 1KUFA 2OW1A 3RTSA 1IAGA 5H8XA 1CXVA 4DPEA 2OZRA 1QIBA 3HDAP 1UTZA 1C8TA 1K7QA 3F17A 1HFCA 4WK7A 1CGLA 1JK3A 1I76A 4JQGA 1B8YA 4PKWA 1ATLA 4I03A 4HX3A 3I7GA 4WZVA 1Q3AA 4XM8A 3EDGA 4DV8A 2ERQA 3AIGA 2SRTA 1GKDA 2OXWA 4H2EA 4WKEA 1AYKA 1BUVM 1PWWA 3LQBA 4H76A 1H71P 1CQRA 4H82A 3P24A 2J0TA 1PWPA 1JAPA 2ERPA 1J7NA 4FXQA 1JIZA 3KRYA 1MMRA 1ZVXA 4QKZA 2OW2A 3ELMA 4GF1A 3UVCA 3RTTA 1MMPA 1XFYA 2MLRA 3EDHA 3G42A 3MA2A 1PWUA 1R1IA 1KUGA 4DD8A 2OW9A 3HY9A 4ILWD 3DTKA 3LIKA 2DDYA 1SLNA 1OS2A 1KBCA 2RJPA 3KWVC 2JIHA 1QJJA 4G0DA 1FLSA 2DW2A 2OVXA 4G9LA 4ON1A 4JA1A 4JIJA 4A3WA 2W14A 4XM6A 1B3DA 4PKTA 4H3XA 1G05A 5CXAA 1JAOA 1SATA 3HB2P 1ND1A 1ZTQA 1C7KA 1QICA 4EFSA 3LIRA 2CKIA 1CAQA 3LE9A 4H1QA 4GR3A 3EDIA 1D8MA 3I7IA 1WNIA 3LQ0A 1XURA 3LMCA 1IAAA 1XFUA 1K7IA 1A85A 3LUMA 1OMJA 1BM6A 3DPFA 4GQLA 3HDBA 4L7AA 2TCLA 1Y93A 1OM7A 2OI0A 1OS9A 3CKIA 5BOYA 2J83A 4H30A 4GWMA 1BSWA 2WO9A 1IADA 1XFVA 1JANA 3P1VA 1BKCA 1XUCA 2X7MA 1BIWA 1Z3JA 2MZIA 2D1NA 4JPAA 4GR0A 3LKAA 1CIZA 4L6TA 3KEJA 2O3EA 1G12A 2JNPA 2W12A 3E8RA 3NX7A 2W0DA 4FXYP 5I4OA 2L0RA 4FU4A 2OY2A 2X3AA 3TS4A 4PKVA 1UMSA 1I1IP 1R1HA 4PKQA 4IN9A 2PJTA 3USNA 1IAEA 2AIGP 2OXUA 2YB9A 2E2DA 2MZHA 1JH1A 2AYKA 1XFXA 1YQYA 5D7WA 3L0TA 1RMZA 2XS4A 4J4MA 2X3BA 4GR8A 1YCMA 1R54A 2N8RA 1UTTA 2E3XA 1O0TA 1BQQM 1SRPA 1ZXVA 4WF6A 2Y6DA 3EHYA 1MMBA 1S4BP 3DNGA 3F15A 3F18A 3U1RA 2OXZA 3Q2HA 1G9KA 2CLTA 2W15A 4H49A 1SMPA 3LGPA 3OHLA 5B5PA 1SU3A 1UMTA 1Y0VA 2OW0A 1GE6A 5L79A 4A7BA 5I3MA 2MLSA 3EHXA 1XFWA 3KMEA 4GUYA 4I35A 5D3CA 2DDFA 1A86A 1OM6A 2X3CA 1O0QA 3LJGA 3DTIA 3DPEA 1JAQA 2HU6A 2JSDA 4XCTA 3LILA 5CUHA 2DW0A 1CGEA 3LEAA 3DL1A 2O36A 5D1UA 4AXQA 1KAPP 4XBHA 2W13A 1KUIA 3KMCA 1EUBA 1IABA 1HY7A 4CTHA 1ZS0A 5I0LA 3HYGA 1Y8JA 3N2UA 3G5CA 1RM8A 2D1OA 4JP4A 3HY7A 2A8HA 1FM1A 1R55A 5I2ZA 2POJA 1PWVA 2YIGA 1G4KA 1GXDA 2FV9A 1GO8P 1GE7A 3O2XA 2WOAA 4PKUA 3TT4A 4L63A 1EB6A 3KEKA 3WV2A 1ASTA 1KUKA 1JIWP 3EWJA 5I43A 456CA 1HV5A 2USNA 4Q1LA 3K7LA 1UEAA 1I73A 1QUAA 3KECA 1DMTA 3TVCA 4PKRA 1C3IA 2JT5A 4WKIA 1KUHA 1R1JA 4GWNA 1XFZA 1BZSA 1YP1A 3ZUKA 3L0VA 1BQOA 1JKYA 4AUOA 1BKCE 3AYKA 2FV5A 2K9CA 5JMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTD A;  1OM8 A;  1D7X A;  1ROS A;  3B8Z A;  2XS3 A;  5B5O A;  2K2G A;  3HBU P;  1GKC A;  2OY4 A;  1L6J A;  1FBL A;  1SLM A;  3KHI A;  1MMQ A;  2DW1 A;  1G49 A;  1BKC I;  1IAC A;  4PKS A;  3ZVS A;  4R3V A;  2QPJ A;  1MNC A;  2I47 A;  3LK8 A;  4L19 A;  3EDZ A;  3LUN A;  5LAB A;  4DF9 A;  1QJI A;  3DWB A;  1JJ9 A;  3N2V A;  2RJQ A;  1K7G A;  830C A;  1GE5 A;  1BUD A;  5BPA A;  1HOV A;  1D8F A;  3B92 A;  3DSL A;  5I12 A;  3AYU A;  1DTH A;  2WO8 A;  1ZXC A;  4H84 A;  3V96 B;  2ERO A;  3VI1 A;  5CZM A;  3O64 A;  1PWQ A;  1YOU A;  5D2B A;  3F19 A;  5L7F A;  4AIG A;  3OHO A;  3TSK A;  4HMA A;  1HFS A;  3VTG A;  3WV3 A;  3LJZ A;  2OVZ A;  2KRJ A;  1XUD A;  2JT6 A;  2V4B A;  3Q2G A;  3F16 A;  2MZE A;  1GO7 P;  3BA0 A;  4ZR5 A;  3GBO A;  1CK7 A;  1QIA A;  1USN A;  3LJT A;  4AYK A;  4IUW A;  3WV1 A;  5BOT A;  4XM7 A;  1CGF A;  1ZP5 A;  2Y6C A;  3K7N A;  3ZXH A;  3SHI A;  1D5J A;  2Z2D A;  1EAK A;  1AKL A;  5D1S A;  3F1A A;  3HBV P;  4IJO A;  1AF0 A;  5D1T A;  4FVL A;  966C A;  3B2Z A;  1OO9 A;  1KUF A;  2OW1 A;  3RTS A;  1IAG A;  5H8X A;  1CXV A;  4DPE A;  2OZR A;  1QIB A;  3HDA P;  1UTZ A;  1C8T A;  1K7Q A;  3F17 A;  1HFC A;  4WK7 A;  1CGL A;  1JK3 A;  1I76 A;  4JQG A;  1B8Y A;  4PKW A;  1ATL A;  4I03 A;  4HX3 A;  3I7G A;  4WZV A;  1Q3A A;  4XM8 A;  3EDG A;  4DV8 A;  2ERQ A;  3AIG A;  2SRT A;  1GKD A;  2OXW A;  4H2E A;  4WKE A;  1AYK A;  1BUV M;  1PWW A;  3LQB A;  4H76 A;  1H71 P;  1CQR A;  4H82 A;  3P24 A;  2J0T A;  1PWP A;  1JAP A;  2ERP A;  1J7N A;  4FXQ A;  1JIZ A;  3KRY A;  1MMR A;  1ZVX A;  4QKZ A;  2OW2 A;  3ELM A;  4GF1 A;  3UVC A;  3RTT A;  1MMP A;  1XFY A;  2MLR A;  3EDH A;  3G42 A;  3MA2 A;  1PWU A;  1R1I A;  1KUG A;  4DD8 A;  2OW9 A;  3HY9 A;  4ILW D;  3LIK A;  2DDY A;  1SLN A;  1OS2 A;  1KBC A;  2RJP A;  3KWV C;  2JIH A;  1QJJ A;  4G0D A;  1FLS A;  2DW2 A;  2OVX A;  4G9L A;  4ON1 A;  4JA1 A;  4JIJ A;  4A3W A;  2W14 A;  4XM6 A;  1B3D A;  4PKT A;  4H3X A;  1G05 A;  5CXA A;  1JAO A;  1SAT A;  3HB2 P;  1ND1 A;  1ZTQ A;  1C7K A;  1QIC A;  4EFS A;  3LIR A;  2CKI A;  1CAQ A;  3LE9 A;  4H1Q A;  4GR3 A;  3EDI A;  1D8M A;  3I7I A;  1WNI A;  3LQ0 A;  1XUR A;  3LMC A;  1IAA A;  1XFU A;  1K7I A;  1A85 A;  3LUM A;  1OMJ A;  1BM6 A;  3DPF A;  4GQL A;  3HDB A;  2TCL A;  1Y93 A;  1OM7 A;  2OI0 A;  1OS9 A;  3CKI A;  5BOY A;  2J83 A;  4H30 A;  4GWM A;  1BSW A;  2WO9 A;  1IAD A;  1XFV A;  1JAN A;  3P1V A;  1BKC A;  1XUC A;  2X7M A;  1BIW A;  1Z3J A;  2MZI A;  2D1N A;  4JPA A;  4GR0 A;  3LKA A;  1CIZ A;  4L6T A;  3KEJ A;  2O3E A;  1G12 A;  2JNP A;  2W12 A;  3E8R A;  3NX7 A;  2W0D A;  4FXY P;  5I4O A;  2L0R A;  4FU4 A;  2OY2 A;  2X3A A;  3TS4 A;  4PKV A;  1UMS A;  1I1I P;  1R1H A;  4PKQ A;  4IN9 A;  2PJT A;  3USN A;  1IAE A;  2AIG P;  2OXU A;  2YB9 A;  2E2D A;  2MZH A;  1JH1 A;  2AYK A;  1XFX A;  1YQY A;  5D7W A;  3L0T A;  1RMZ A;  2XS4 A;  4J4M A;  2X3B A;  4GR8 A;  1YCM A;  1R54 A;  2N8R A;  1UTT A;  2E3X A;  1O0T A;  1BQQ M;  1SRP A;  1ZXV A;  4WF6 A;  2Y6D A;  3EHY A;  1MMB A;  1S4B P;  3DNG A;  3F15 A;  3F18 A;  3U1R A;  2OXZ A;  3Q2H A;  1G9K A;  2CLT A;  2W15 A;  4H49 A;  1SMP A;  3LGP A;  3OHL A;  5B5P A;  1SU3 A;  1UMT A;  1Y0V A;  2OW0 A;  1GE6 A;  5L79 A;  4A7B A;  5I3M A;  2MLS A;  3EHX A;  1XFW A;  3KME A;  4GUY A;  4I35 A;  5D3C A;  2DDF A;  1A86 A;  1OM6 A;  2X3C A;  1O0Q A;  3LJG A;  3DPE A;  1JAQ A;  2HU6 A;  2JSD A;  4XCT A;  3LIL A;  5CUH A;  2DW0 A;  1CGE A;  3LEA A;  3DL1 A;  2O36 A;  5D1U A;  4AXQ A;  1KAP P;  4XBH A;  2W13 A;  1KUI A;  3KMC A;  1EUB A;  1IAB A;  1HY7 A;  4CTH A;  1ZS0 A;  5I0L A;  3HYG A;  1Y8J A;  3N2U A;  3G5C A;  1RM8 A;  2D1O A;  4JP4 A;  3HY7 A;  2A8H A;  1FM1 A;  1R55 A;  5I2Z A;  2POJ A;  1PWV A;  2YIG A;  1G4K A;  1GXD A;  2FV9 A;  1GO8 P;  1GE7 A;  3O2X A;  2WOA A;  4PKU A;  3TT4 A;  4L63 A;  1EB6 A;  3KEK A;  3WV2 A;  1AST A;  1KUK A;  1JIW P;  3EWJ A;  5I43 A;  456C A;  1HV5 A;  2USN A;  4Q1L A;  3K7L A;  1UEA A;  1I73 A;  1QUA A;  3KEC A;  1DMT A;  3TVC A;  4PKR A;  1C3I A;  2JT5 A;  4WKI A;  1KUH A;  1R1J A;  4GWN A;  1XFZ A;  1BZS A;  1YP1 A;  3ZUK A;  3L0V A;  1BQO A;  1JKY A;  4AUO A;  1BKC E;  3AYK A;  2FV5 A;  2K9C A;  5JMY A; 
#chains in the Genus database with same CATH topology
 1HTD A;  1OM8 A;  1D7X A;  1ROS A;  3B8Z A;  2XS3 A;  5B5O A;  2K2G A;  3HBU P;  1GKC A;  2OY4 A;  1L6J A;  1FBL A;  1SLM A;  3KHI A;  1MMQ A;  2DW1 A;  1G49 A;  1BKC I;  1IAC A;  4PKS A;  3ZVS A;  4R3V A;  2QPJ A;  1MNC A;  2I47 A;  3LK8 A;  4L19 A;  3EDZ A;  3LUN A;  5LAB A;  4DF9 A;  1QJI A;  3DWB A;  1JJ9 A;  3N2V A;  2RJQ A;  1K7G A;  830C A;  1GE5 A;  1BUD A;  5BPA A;  1HOV A;  1D8F A;  3B92 A;  3DSL A;  5I12 A;  3AYU A;  1DTH A;  2WO8 A;  1ZXC A;  4H84 A;  3V96 B;  2ERO A;  3VI1 A;  5CZM A;  3O64 A;  1PWQ A;  1YOU A;  5D2B A;  3F19 A;  5L7F A;  4AIG A;  3OHO A;  3TSK A;  4HMA A;  1HFS A;  3VTG A;  3WV3 A;  2OVZ A;  3LJZ A;  2KRJ A;  1XUD A;  2JT6 A;  2V4B A;  3Q2G A;  3F16 A;  2MZE A;  2YUF A;  1GO7 P;  3BA0 A;  4ZR5 A;  3GBO A;  1CK7 A;  1QIA A;  1USN A;  3LJT A;  4AYK A;  4IUW A;  3WV1 A;  5BOT A;  4XM7 A;  1CGF A;  3DTE A;  1ZP5 A;  2Y6C A;  3K7N A;  3ZXH A;  3SHI A;  1D5J A;  2Z2D A;  1EAK A;  1AKL A;  5D1S A;  3F1A A;  3HBV P;  4IJO A;  1AF0 A;  5D1T A;  4FVL A;  966C A;  3B2Z A;  1OO9 A;  1KUF A;  2OW1 A;  3RTS A;  1IAG A;  5H8X A;  1CXV A;  4DPE A;  2OZR A;  1QIB A;  3HDA P;  1UTZ A;  1C8T A;  1K7Q A;  3F17 A;  1HFC A;  4WK7 A;  1CGL A;  1JK3 A;  1I76 A;  4JQG A;  1B8Y A;  4PKW A;  1ATL A;  4I03 A;  4HX3 A;  3I7G A;  4WZV A;  1Q3A A;  4XM8 A;  3EDG A;  4DV8 A;  2ERQ A;  3AIG A;  2SRT A;  1GKD A;  2OXW A;  4H2E A;  4WKE A;  1AYK A;  1BUV M;  1PWW A;  3LQB A;  4H76 A;  1H71 P;  1CQR A;  4H82 A;  3P24 A;  2J0T A;  1PWP A;  1JAP A;  2ERP A;  1J7N A;  4FXQ A;  1JIZ A;  3KRY A;  1MMR A;  1ZVX A;  4QKZ A;  2OW2 A;  3ELM A;  4GF1 A;  3UVC A;  3RTT A;  1MMP A;  1XFY A;  2MLR A;  3EDH A;  3G42 A;  3MA2 A;  1PWU A;  1R1I A;  1KUG A;  4DD8 A;  2OW9 A;  3HY9 A;  4ILW D;  3DTK A;  3LIK A;  2DDY A;  1SLN A;  1OS2 A;  1KBC A;  2RJP A;  3KWV C;  2JIH A;  1QJJ A;  4G0D A;  1FLS A;  2DW2 A;  2OVX A;  4G9L A;  4ON1 A;  4JA1 A;  4JIJ A;  4A3W A;  2W14 A;  4XM6 A;  1B3D A;  4PKT A;  4H3X A;  1G05 A;  5CXA A;  1JAO A;  1SAT A;  3HB2 P;  1ND1 A;  1ZTQ A;  1C7K A;  1QIC A;  4EFS A;  3LIR A;  2CKI A;  1CAQ A;  3LE9 A;  4H1Q A;  4GR3 A;  3EDI A;  1D8M A;  3I7I A;  1WNI A;  3LQ0 A;  1XUR A;  3LMC A;  1IAA A;  1XFU A;  1K7I A;  1A85 A;  3LUM A;  1OMJ A;  1BM6 A;  3DPF A;  4GQL A;  3HDB A;  4L7A A;  2TCL A;  1Y93 A;  1OM7 A;  2OI0 A;  1OS9 A;  3CKI A;  5BOY A;  2J83 A;  4H30 A;  4GWM A;  1BSW A;  2WO9 A;  1IAD A;  1XFV A;  1JAN A;  3P1V A;  1BKC A;  1XUC A;  2X7M A;  1BIW A;  1Z3J A;  2MZI A;  2D1N A;  4JPA A;  4GR0 A;  3LKA A;  1CIZ A;  4L6T A;  3KEJ A;  2O3E A;  1G12 A;  2JNP A;  2W12 A;  3E8R A;  3NX7 A;  2W0D A;  4FXY P;  5I4O A;  2L0R A;  4FU4 A;  2OY2 A;  2X3A A;  3TS4 A;  4PKV A;  1UMS A;  1I1I P;  1R1H A;  4PKQ A;  4IN9 A;  2PJT A;  3USN A;  1IAE A;  2AIG P;  2OXU A;  2YB9 A;  2E2D A;  2MZH A;  1JH1 A;  2AYK A;  1XFX A;  1YQY A;  5D7W A;  3L0T A;  1RMZ A;  2XS4 A;  4J4M A;  2X3B A;  4GR8 A;  1YCM A;  1R54 A;  2N8R A;  1UTT A;  2E3X A;  1O0T A;  1BQQ M;  1SRP A;  1ZXV A;  4WF6 A;  2Y6D A;  3EHY A;  1MMB A;  1S4B P;  3DNG A;  3F15 A;  3F18 A;  3U1R A;  2OXZ A;  3Q2H A;  1G9K A;  2CLT A;  2W15 A;  4H49 A;  1SMP A;  3LGP A;  3OHL A;  5B5P A;  1SU3 A;  1UMT A;  1Y0V A;  2OW0 A;  1GE6 A;  5L79 A;  4A7B A;  5I3M A;  2MLS A;  3EHX A;  1XFW A;  3KME A;  4GUY A;  4I35 A;  5D3C A;  2DDF A;  1A86 A;  1OM6 A;  2X3C A;  1O0Q A;  3LJG A;  3DTI A;  3DPE A;  1JAQ A;  2HU6 A;  2JSD A;  4XCT A;  3LIL A;  5CUH A;  2DW0 A;  1CGE A;  3LEA A;  3DL1 A;  2O36 A;  5D1U A;  4AXQ A;  1KAP P;  4XBH A;  2W13 A;  1KUI A;  3KMC A;  1EUB A;  1IAB A;  1OZ9 A;  1HY7 A;  4CTH A;  1ZS0 A;  5I0L A;  3HYG A;  1Y8J A;  3N2U A;  3G5C A;  1RM8 A;  2D1O A;  4JP4 A;  3HY7 A;  2A8H A;  1FM1 A;  1R55 A;  5I2Z A;  1XAX A;  2POJ A;  1PWV A;  1XM5 A;  2YIG A;  1G4K A;  1GXD A;  2FV9 A;  1GO8 P;  1GE7 A;  3O2X A;  2WOA A;  4PKU A;  3TT4 A;  4L63 A;  1EB6 A;  3KEK A;  3WV2 A;  1AST A;  1KUK A;  1JIW P;  3EWJ A;  5I43 A;  456C A;  1HV5 A;  1TVI A;  2USN A;  4Q1L A;  3K7L A;  1UEA A;  1I73 A;  1QUA A;  3KEC A;  1DMT A;  3TVC A;  4PKR A;  1C3I A;  2JT5 A;  4WKI A;  1KUH A;  1R1J A;  4GWN A;  1XFZ A;  1BZS A;  1YP1 A;  3ZUK A;  3L0V A;  1BQO A;  1JKY A;  4AUO A;  1BKC E;  3AYK A;  2FV5 A;  2K9C A;  5JMY A; 
#chains in the Genus database with same CATH homology
 1HTD A;  1OM8 A;  1D7X A;  1ROS A;  3B8Z A;  2XS3 A;  5B5O A;  2K2G A;  3HBU P;  1GKC A;  2OY4 A;  1L6J A;  1FBL A;  1SLM A;  3KHI A;  1MMQ A;  2DW1 A;  1G49 A;  1BKC I;  1IAC A;  4PKS A;  3ZVS A;  4R3V A;  2QPJ A;  1MNC A;  2I47 A;  3LK8 A;  4L19 A;  3EDZ A;  3LUN A;  5LAB A;  4DF9 A;  1QJI A;  3DWB A;  1JJ9 A;  3N2V A;  2RJQ A;  1K7G A;  830C A;  1GE5 A;  1BUD A;  5BPA A;  1HOV A;  1D8F A;  3B92 A;  3DSL A;  5I12 A;  3AYU A;  1DTH A;  2WO8 A;  1ZXC A;  4H84 A;  3V96 B;  2ERO A;  3VI1 A;  5CZM A;  3O64 A;  1PWQ A;  1YOU A;  5D2B A;  3F19 A;  5L7F A;  4AIG A;  3OHO A;  3TSK A;  4HMA A;  1HFS A;  3VTG A;  3WV3 A;  3LJZ A;  2OVZ A;  2KRJ A;  1XUD A;  2JT6 A;  2V4B A;  3Q2G A;  3F16 A;  2MZE A;  2YUF A;  1GO7 P;  3BA0 A;  4ZR5 A;  3GBO A;  1CK7 A;  1QIA A;  1USN A;  3LJT A;  4AYK A;  4IUW A;  3WV1 A;  5BOT A;  4XM7 A;  1CGF A;  3DTE A;  1ZP5 A;  2Y6C A;  3K7N A;  3ZXH A;  3SHI A;  1D5J A;  2Z2D A;  1EAK A;  1AKL A;  5D1S A;  3F1A A;  3HBV P;  4IJO A;  1AF0 A;  5D1T A;  4FVL A;  966C A;  3B2Z A;  1OO9 A;  1KUF A;  2OW1 A;  3RTS A;  1IAG A;  5H8X A;  1CXV A;  4DPE A;  2OZR A;  1QIB A;  3HDA P;  1UTZ A;  1C8T A;  1K7Q A;  3F17 A;  1HFC A;  4WK7 A;  1CGL A;  1JK3 A;  1I76 A;  4JQG A;  1B8Y A;  4PKW A;  1ATL A;  4I03 A;  4HX3 A;  3I7G A;  4WZV A;  1Q3A A;  4XM8 A;  3EDG A;  4DV8 A;  2ERQ A;  3AIG A;  2SRT A;  1GKD A;  2OXW A;  4H2E A;  4WKE A;  1AYK A;  1BUV M;  1PWW A;  3LQB A;  4H76 A;  1H71 P;  1CQR A;  4H82 A;  3P24 A;  2J0T A;  1PWP A;  1JAP A;  2ERP A;  1J7N A;  4FXQ A;  1JIZ A;  3KRY A;  1MMR A;  1ZVX A;  4QKZ A;  2OW2 A;  3ELM A;  4GF1 A;  3UVC A;  3RTT A;  1MMP A;  1XFY A;  2MLR A;  3EDH A;  3G42 A;  3MA2 A;  1PWU A;  1R1I A;  1KUG A;  4DD8 A;  2OW9 A;  3HY9 A;  4ILW D;  3DTK A;  3LIK A;  2DDY A;  1SLN A;  1OS2 A;  1KBC A;  2RJP A;  3KWV C;  2JIH A;  1QJJ A;  4G0D A;  1FLS A;  2DW2 A;  2OVX A;  4G9L A;  4ON1 A;  4JA1 A;  4JIJ A;  4A3W A;  2W14 A;  4XM6 A;  1B3D A;  4PKT A;  4H3X A;  1G05 A;  5CXA A;  1JAO A;  1SAT A;  3HB2 P;  1ND1 A;  1ZTQ A;  1C7K A;  1QIC A;  4EFS A;  3LIR A;  2CKI A;  1CAQ A;  3LE9 A;  4H1Q A;  4GR3 A;  3EDI A;  1D8M A;  3I7I A;  1WNI A;  3LQ0 A;  1XUR A;  3LMC A;  1IAA A;  1XFU A;  1K7I A;  1A85 A;  3LUM A;  1OMJ A;  1BM6 A;  3DPF A;  4GQL A;  3HDB A;  4L7A A;  2TCL A;  1Y93 A;  1OM7 A;  2OI0 A;  1OS9 A;  3CKI A;  5BOY A;  2J83 A;  4H30 A;  4GWM A;  1BSW A;  2WO9 A;  1IAD A;  1XFV A;  1JAN A;  3P1V A;  1BKC A;  1XUC A;  2X7M A;  1BIW A;  1Z3J A;  2MZI A;  2D1N A;  4JPA A;  4GR0 A;  3LKA A;  1CIZ A;  4L6T A;  3KEJ A;  2O3E A;  1G12 A;  2JNP A;  2W12 A;  3E8R A;  3NX7 A;  2W0D A;  4FXY P;  5I4O A;  2L0R A;  4FU4 A;  2OY2 A;  2X3A A;  3TS4 A;  4PKV A;  1UMS A;  1I1I P;  1R1H A;  4PKQ A;  4IN9 A;  2PJT A;  3USN A;  1IAE A;  2AIG P;  2OXU A;  2YB9 A;  2E2D A;  2MZH A;  1JH1 A;  2AYK A;  1XFX A;  1YQY A;  5D7W A;  3L0T A;  1RMZ A;  2XS4 A;  4J4M A;  2X3B A;  4GR8 A;  1YCM A;  1R54 A;  2N8R A;  1UTT A;  2E3X A;  1O0T A;  1BQQ M;  1SRP A;  1ZXV A;  4WF6 A;  2Y6D A;  3EHY A;  1MMB A;  1S4B P;  3DNG A;  3F15 A;  3F18 A;  3U1R A;  2OXZ A;  3Q2H A;  1G9K A;  2CLT A;  2W15 A;  4H49 A;  1SMP A;  3LGP A;  3OHL A;  5B5P A;  1SU3 A;  1UMT A;  1Y0V A;  2OW0 A;  1GE6 A;  5L79 A;  4A7B A;  5I3M A;  2MLS A;  3EHX A;  1XFW A;  3KME A;  4GUY A;  4I35 A;  5D3C A;  2DDF A;  1A86 A;  1OM6 A;  2X3C A;  1O0Q A;  3LJG A;  3DTI A;  3DPE A;  1JAQ A;  2HU6 A;  2JSD A;  4XCT A;  3LIL A;  5CUH A;  2DW0 A;  1CGE A;  3LEA A;  3DL1 A;  2O36 A;  5D1U A;  4AXQ A;  1KAP P;  4XBH A;  2W13 A;  1KUI A;  3KMC A;  1EUB A;  1IAB A;  1HY7 A;  4CTH A;  1ZS0 A;  5I0L A;  3HYG A;  1Y8J A;  3N2U A;  3G5C A;  1RM8 A;  2D1O A;  4JP4 A;  3HY7 A;  2A8H A;  1FM1 A;  1R55 A;  5I2Z A;  2POJ A;  1PWV A;  2YIG A;  1G4K A;  1GXD A;  2FV9 A;  1GO8 P;  1GE7 A;  3O2X A;  2WOA A;  4PKU A;  3TT4 A;  4L63 A;  1EB6 A;  3KEK A;  3WV2 A;  1AST A;  1KUK A;  1JIW P;  3EWJ A;  5I43 A;  456C A;  1HV5 A;  2USN A;  4Q1L A;  3K7L A;  1UEA A;  1I73 A;  1QUA A;  3KEC A;  1DMT A;  3TVC A;  4PKR A;  1C3I A;  2JT5 A;  4WKI A;  1KUH A;  1R1J A;  4GWN A;  1XFZ A;  1BZS A;  1YP1 A;  3ZUK A;  3L0V A;  1BQO A;  1JKY A;  4AUO A;  1BKC E;  3AYK A;  2FV5 A;  2K9C A;  5JMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...