2ERPA

Crystal structure of vascular apoptosis-inducing protein-1(inhibitor-bound form)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
426
structure length
426
Chain Sequence
SNLTPEQQRYLNAKKYVKLFLVADYIMYLKYGRNLTAVRTRMYDIVNVITPIYHRMNIHVALVGLEIWSNTDKIIVQSSADVTLDLFAKWRATDLLSRKSHDNAQLLTGINFNGPTAGLGYLGGICNTMYSAGIVQDHSKIHHLVAIAMAHEMGHNLGMDHDKDTCTCGTRPCVMAGALSCEASFLFSDCSQKDHREFLIKNMPQCILKKPLKTDVVSPAVCGNYFVEVGEECDCGSPRTCRDPCCDATTCKLRQGAQCAEGLCCDQCRFKGAGTECRAAKDECDMADVCTGRSAECTDRFQRNGQPCKNNNGYCYNGKCPIMADQCIALFGPGATVSQDACFQFNREGNHYGYCRKEQNTKIACEPQDVKCGRLYCFPNSPENKNPCNIYYSPNDEDKGMVLPGTKCADRKACSNGQCVDVTTPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords vascular apoptosis-inducing protein 1
publication title Crystal structures of VAP1 reveal ADAMs' MDC domain architecture and its unique C-shaped scaffold
pubmed doi rcsb
total genus 121
structure length 426
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2erpA01
1C3IA 1BQQM 1Y93A 2KRJA 1CK7A 2MLRA 1OMJA 5LABA 4GR8A 5I3MA 2V4BA 4J4MA 1HFCA 3L0TA 1SMPA 3L0VA 4G0DA 3VTGA 3CKIA 1R1HA 3P24A 1PWPA 4WF6A 1EUBA 4XM7A 1QUAA 3HB2P 3DPEA 4IJOA 1BM6A 4GQLA 3DNGA 1XURA 3HBVP 2OVZA 1O0TA 1GXDA 3N2VA 5L7FA 2WOAA 3E8RA 4PKRA 1BSWA 3ZXHA 1D5JA 1SU3A 3LEAA 3TT4A 1BIWA 1XUDA 4XBHA 2WO9A 3KEJA 2I47A 4PKSA 1UEAA 1HTDA 1XFZA 4WKEA 3Q2HA 2A8HA 1ASTA 3F16A 4JPAA 2OW1A 1UMTA 3DWBA 4GR0A 5D1UA 5I4OA 1ZVXA 3GBOA 4H1QA 3F18A 2XS3A 5I12A 1G12A 1DMTA 4H82A 4AIGA 1KBCA 4IUWA 5D1TA 2W15A 1J7NA 4H76A 1MMRA 4FU4A 1D8MA 1D7XA 3LQBA 2D1OA 2QPJA 2AIGP 1JKYA 1AYKA 1G49A 1ZTQA 1JIZA 5CUHA 4H30A 1IADA 1A85A 1QICA 2E2DA 3LGPA 4H2EA 3HBUP 1HY7A 1MNCA 4L6TA 1HOVA 5B5OA 1RM8A 4AXQA 3EHYA 1HFSA 3OHLA 4AUOA 1CQRA 3DPFA 4L63A 1G05A 4CTHA 3DSLA 4HX3A 1I1IP 3LJTA 3B2ZA 2JT5A 1K7QA 1XFYA 1K7IA 5L79A 1JANA 2DW2A 1OM8A 2CKIA 2W14A 1UTTA 2FV5A 2ERQA 1CGFA 2X3AA 1GE6A 3VI1A 1KUKA 2K9CA 3KRYA 4PKWA 1OM6A 1XFWA 3F1AA 3LUNA 4QKZA 4DF9A 1OS2A 1JH1A 4HMAA 2CLTA 2Z2DA 1MMQA 3ZUKA 2DW0A 5D7WA 1O0QA 5H8XA 1C8TA 2L0RA 1YQYA 5B5PA 4DPEA 3TVCA 2X3BA 3F17A 1CGEA 1S4BP 4AYKA 3I7IA 3G5CA 3TSKA 1SLMA 4JA1A 4A3WA 1I73A 3TS4A 4IN9A 4GR3A 1USNA 1IAGA 4PKUA 4R3VA 3ELMA 2WO8A 3MA2A 3DL1A 3LILA 1JAOA 830CA 2YIGA 1XFXA 2MLSA 3B92A 5D1SA 1XUCA 4PKTA 456CA 1Q3AA 3LJGA 2W0DA 1ZXVA 1H71P 3EHXA 2X3CA 3UVCA 3N2UA 3SHIA 3G42A 1ND1A 1EAKA 1UMSA 4ON1A 2OY4A 1JJ9A 2JT6A 2ERPA 1RMZA 1AF0A 1KUIA 1BUVM 1KUFA 3KMEA 966CA 2OY2A 1WNIA 4JIJA 2MZHA 1ZS0A 1BKCI 1I76A 4PKVA 2W12A 5I43A 3P1VA 2Y6DA 2PJTA 1G4KA 1R1IA 5CXAA 1SLNA 2OXUA 2RJPA 2OXWA 4XCTA 3EDZA 3AYUA 4L19A 4EFSA 2OW9A 1R54A 2J83A 1FM1A 1ZP5A 2TCLA 3RTSA 1K7GA 1R55A 4I35A 1YOUA 1A86A 4ILWD 4XM6A 3HYGA 3LK8A 4WKIA 1IABA 4GUYA 1PWUA 4WZVA 3F15A 2X7MA 3NX7A 4PKQA 3WV2A 5JMYA 2OZRA 3USNA 3HY9A 2J0TA 1JAPA 1YCMA 2O36A 1CXVA 4FXYP 1GO7P 3KMCA 1PWQA 1Y0VA 1JK3A 3RTTA 3O64A 1Z3JA 2USNA 3WV1A 3KEKA 2JSDA 3LMCA 1G9KA 3KHIA 3ZVSA 1GKDA 1BUDA 4FXQA 4Q1LA 4FVLA 1GE7A 1GKCA 2JIHA 3Q2GA 3WV3A 1DTHA 2D1NA 4ZR5A 3EDGA 1CIZA 4H3XA 1PWVA 2Y6CA 1GO8P 2YB9A 4XM8A 4JQGA 3LIKA 3AYKA 2W13A 1HV5A 1XFVA 1B3DA 1PWWA 1QJIA 1GE5A 1IACA 3B8ZA 3I7GA 3LJZA 2SRTA 1OM7A 3K7LA 1AKLA 4GF1A 2OI0A 5BOTA 1EB6A 1KUHA 2EROA 3K7NA 3F19A 3EWJA 1L6JA 2MZIA 4GWMA 3KWVC 3EDHA 1UTZA 4WK7A 1D8FA 3LIRA 3HDAP 3EDIA 3LQ0A 4JP4A 5BOYA 5BPAA 1IAEA 2E3XA 2OXZA 1XFUA 2OVXA 2OW2A 1B8YA 4DD8A 3U1RA 2MZEA 1QIBA 2POJA 1MMPA 1Y8JA 2HU6A 5D3CA 5I2ZA 1KAPP 2DDYA 1YP1A 1SRPA 2K2GA 5I0LA 1FLSA 1ROSA 1JIWP 1IAAA 3O2XA 1BKCE 1SATA 1QJJA 2JNPA 1OO9A 3HY7A 4G9LA 4GWNA 3HDBA 1ZXCA 2AYKA 1MMBA 1FBLA 1JAQA 1CAQA 5CZMA 3LUMA 2RJQA 3BA0A 2OW0A 3KECA 1BKCA 2N8RA 4I03A 2FV9A 4H84A 2O3EA 2DW1A 1CGLA 4DV8A 1R1JA 1BQOA 1C7KA 3OHOA 3LKAA 5D2BA 1QIAA 1ATLA 3V96B 2XS4A 3AIGA 4A7BA 1BZSA 3LE9A 1KUGA 4H49A 1OS9A 2DDFA
chains in the Genus database with same CATH superfamily
1C3IA 1BQQM 1Y93A 2KRJA 1CK7A 2MLRA 1OMJA 5LABA 4GR8A 5I3MA 2V4BA 4J4MA 1HFCA 3L0TA 1SMPA 3L0VA 4G0DA 3VTGA 3CKIA 1R1HA 3P24A 1PWPA 4WF6A 1EUBA 4XM7A 1QUAA 3HB2P 3DPEA 4IJOA 1BM6A 4GQLA 3DNGA 1XURA 3HBVP 2OVZA 1O0TA 1GXDA 3N2VA 5L7FA 2WOAA 3E8RA 4PKRA 1BSWA 3ZXHA 1D5JA 1SU3A 3LEAA 3TT4A 1BIWA 1XUDA 4XBHA 2WO9A 3KEJA 2I47A 4PKSA 1UEAA 1HTDA 1XFZA 4WKEA 3Q2HA 2A8HA 1ASTA 3F16A 4JPAA 2OW1A 1UMTA 3DWBA 4GR0A 5D1UA 5I4OA 1ZVXA 3GBOA 4H1QA 3F18A 2XS3A 5I12A 1G12A 1DMTA 4H82A 4AIGA 1KBCA 4IUWA 5D1TA 2W15A 1J7NA 4H76A 1MMRA 1XM5A 4FU4A 1D8MA 1D7XA 3LQBA 2D1OA 2QPJA 2AIGP 1JKYA 1AYKA 1G49A 1ZTQA 1JIZA 5CUHA 4H30A 1IADA 1A85A 1QICA 2E2DA 3LGPA 4H2EA 3HBUP 1HY7A 1MNCA 4L6TA 1HOVA 5B5OA 1RM8A 4AXQA 3EHYA 1HFSA 3OHLA 4L7AA 4AUOA 1CQRA 3DPFA 4L63A 1G05A 4CTHA 3DSLA 1XAXA 4HX3A 1I1IP 3LJTA 3B2ZA 2JT5A 1K7QA 1XFYA 1K7IA 5L79A 1JANA 3DTIA 2DW2A 1OM8A 3DTKA 2CKIA 2W14A 1UTTA 2FV5A 2ERQA 1CGFA 2X3AA 1GE6A 3VI1A 1KUKA 2K9CA 3KRYA 1OZ9A 4PKWA 1OM6A 1XFWA 3F1AA 3LUNA 4QKZA 4DF9A 1OS2A 1JH1A 4HMAA 2CLTA 2Z2DA 1MMQA 3ZUKA 2DW0A 5D7WA 1O0QA 5H8XA 1C8TA 2L0RA 1YQYA 5B5PA 4DPEA 3TVCA 2X3BA 3F17A 1CGEA 1S4BP 4AYKA 3I7IA 3G5CA 3TSKA 2YUFA 1SLMA 4JA1A 4A3WA 1I73A 3TS4A 4IN9A 4GR3A 1USNA 1IAGA 4PKUA 4R3VA 3ELMA 2WO8A 3MA2A 3DL1A 3LILA 1JAOA 830CA 2YIGA 1XFXA 2MLSA 3B92A 5D1SA 1XUCA 4PKTA 456CA 1Q3AA 3LJGA 2W0DA 1ZXVA 1H71P 3EHXA 2X3CA 3UVCA 3N2UA 3SHIA 3G42A 1ND1A 1EAKA 1UMSA 4ON1A 2OY4A 1JJ9A 2JT6A 2ERPA 1RMZA 1AF0A 1KUIA 1BUVM 1KUFA 3KMEA 966CA 2OY2A 1WNIA 4JIJA 2MZHA 1ZS0A 1BKCI 1I76A 4PKVA 2W12A 5I43A 3P1VA 3DTEA 2Y6DA 2PJTA 1G4KA 1R1IA 5CXAA 1SLNA 2OXUA 2RJPA 2OXWA 4XCTA 3EDZA 3AYUA 4L19A 4EFSA 2OW9A 1R54A 2J83A 1FM1A 1ZP5A 2TCLA 3RTSA 1K7GA 1R55A 4I35A 1TVIA 1YOUA 1A86A 4ILWD 4XM6A 3HYGA 3LK8A 4WKIA 1IABA 4GUYA 1PWUA 4WZVA 3F15A 2X7MA 3NX7A 4PKQA 3WV2A 5JMYA 2OZRA 3USNA 3HY9A 2J0TA 1JAPA 1YCMA 2O36A 1CXVA 4FXYP 1GO7P 3KMCA 1PWQA 1Y0VA 1JK3A 3RTTA 3O64A 1Z3JA 2USNA 3WV1A 3KEKA 2JSDA 3LMCA 1G9KA 3KHIA 3ZVSA 1GKDA 1BUDA 4FXQA 4Q1LA 4FVLA 1GE7A 1GKCA 2JIHA 3Q2GA 3WV3A 1DTHA 2D1NA 4ZR5A 3EDGA 1CIZA 4H3XA 1PWVA 2Y6CA 1GO8P 2YB9A 4XM8A 4JQGA 3LIKA 3AYKA 2W13A 1HV5A 1XFVA 1B3DA 1PWWA 1QJIA 1GE5A 1IACA 3B8ZA 3I7GA 3LJZA 2SRTA 1OM7A 3K7LA 1AKLA 4GF1A 2OI0A 5BOTA 1EB6A 1KUHA 2EROA 3K7NA 3F19A 3EWJA 1L6JA 2MZIA 4GWMA 3KWVC 3EDHA 1UTZA 4WK7A 1D8FA 3LIRA 3HDAP 3EDIA 3LQ0A 4JP4A 5BOYA 5BPAA 1IAEA 2E3XA 2OXZA 1XFUA 2OVXA 2OW2A 1B8YA 4DD8A 3U1RA 2MZEA 1QIBA 2POJA 1MMPA 1Y8JA 2HU6A 5D3CA 5I2ZA 1KAPP 2DDYA 1YP1A 1SRPA 2K2GA 5I0LA 1FLSA 1ROSA 1JIWP 1IAAA 3O2XA 1BKCE 1SATA 1QJJA 2JNPA 1OO9A 3HY7A 4G9LA 4GWNA 3HDBA 1ZXCA 2AYKA 1MMBA 1FBLA 1JAQA 1CAQA 5CZMA 3LUMA 2RJQA 3BA0A 2OW0A 3KECA 1BKCA 2N8RA 4I03A 2FV9A 4H84A 2O3EA 2DW1A 1CGLA 4DV8A 1R1JA 1BQOA 1C7KA 3OHOA 3LKAA 5D2BA 1QIAA 1ATLA 3V96B 2XS4A 3AIGA 4A7BA 1BZSA 3LE9A 1KUGA 4H49A 1OS9A 2DDFA
chains in the Genus database with same CATH topology
1C3IA 1BQQM 1Y93A 2KRJA 1CK7A 2MLRA 1OMJA 5LABA 4GR8A 5I3MA 2V4BA 4J4MA 1HFCA 3L0TA 1SMPA 3L0VA 4G0DA 3VTGA 3CKIA 1R1HA 3P24A 1PWPA 4WF6A 1EUBA 4XM7A 1QUAA 3HB2P 3DPEA 4IJOA 1BM6A 4GQLA 3DNGA 1XURA 3HBVP 2OVZA 1O0TA 1GXDA 3N2VA 5L7FA 2WOAA 3E8RA 4PKRA 1BSWA 3ZXHA 1D5JA 1SU3A 3LEAA 3TT4A 1BIWA 1XUDA 4XBHA 2WO9A 3KEJA 2I47A 4PKSA 1UEAA 1HTDA 1XFZA 4WKEA 3Q2HA 2A8HA 1ASTA 3F16A 4JPAA 2OW1A 1UMTA 3DWBA 4GR0A 5D1UA 5I4OA 1ZVXA 3GBOA 4H1QA 3F18A 2XS3A 5I12A 1G12A 1DMTA 4H82A 4AIGA 1KBCA 4IUWA 5D1TA 2W15A 1J7NA 4H76A 1MMRA 4FU4A 1D8MA 1D7XA 3LQBA 2D1OA 2QPJA 2AIGP 1JKYA 1AYKA 1G49A 1ZTQA 1JIZA 5CUHA 4H30A 1IADA 1A85A 1QICA 2E2DA 3LGPA 4H2EA 3HBUP 1HY7A 1MNCA 4L6TA 1HOVA 5B5OA 1RM8A 4AXQA 3EHYA 1HFSA 3OHLA 4L7AA 4AUOA 1CQRA 3DPFA 4L63A 1G05A 4CTHA 3DSLA 4HX3A 1I1IP 3LJTA 3B2ZA 2JT5A 1K7QA 1XFYA 1K7IA 5L79A 1JANA 3DTIA 2DW2A 1OM8A 3DTKA 2CKIA 2W14A 1UTTA 2FV5A 2ERQA 1CGFA 2X3AA 1GE6A 3VI1A 1KUKA 2K9CA 3KRYA 4PKWA 1OM6A 1XFWA 3F1AA 3LUNA 4QKZA 4DF9A 1OS2A 1JH1A 4HMAA 2CLTA 2Z2DA 1MMQA 3ZUKA 2DW0A 5D7WA 1O0QA 5H8XA 1C8TA 2L0RA 1YQYA 5B5PA 4DPEA 3TVCA 2X3BA 3F17A 1CGEA 1S4BP 4AYKA 3I7IA 3G5CA 3TSKA 2YUFA 1SLMA 4JA1A 4A3WA 1I73A 3TS4A 4IN9A 4GR3A 1USNA 1IAGA 4PKUA 4R3VA 3ELMA 2WO8A 3MA2A 3DL1A 3LILA 1JAOA 830CA 2YIGA 1XFXA 2MLSA 3B92A 5D1SA 1XUCA 4PKTA 456CA 1Q3AA 3LJGA 2W0DA 1ZXVA 1H71P 3EHXA 2X3CA 3UVCA 3N2UA 3SHIA 3G42A 1ND1A 1EAKA 1UMSA 4ON1A 2OY4A 1JJ9A 2JT6A 2ERPA 1RMZA 1AF0A 1KUIA 1BUVM 1KUFA 3KMEA 966CA 2OY2A 1WNIA 4JIJA 2MZHA 1ZS0A 1BKCI 1I76A 4PKVA 2W12A 5I43A 3P1VA 3DTEA 2Y6DA 2PJTA 1G4KA 1R1IA 5CXAA 1SLNA 2OXUA 2RJPA 2OXWA 4XCTA 3EDZA 3AYUA 4L19A 4EFSA 2OW9A 1R54A 2J83A 1FM1A 1ZP5A 2TCLA 3RTSA 1K7GA 1R55A 4I35A 1YOUA 1A86A 4ILWD 4XM6A 3HYGA 3LK8A 4WKIA 1IABA 4GUYA 1PWUA 4WZVA 3F15A 2X7MA 3NX7A 4PKQA 3WV2A 5JMYA 2OZRA 3USNA 3HY9A 2J0TA 1JAPA 1YCMA 2O36A 1CXVA 4FXYP 1GO7P 3KMCA 1PWQA 1Y0VA 1JK3A 3RTTA 3O64A 1Z3JA 2USNA 3WV1A 3KEKA 2JSDA 3LMCA 1G9KA 3KHIA 3ZVSA 1GKDA 1BUDA 4FXQA 4Q1LA 4FVLA 1GE7A 1GKCA 2JIHA 3Q2GA 3WV3A 1DTHA 2D1NA 4ZR5A 3EDGA 1CIZA 4H3XA 1PWVA 2Y6CA 1GO8P 2YB9A 4XM8A 4JQGA 3LIKA 3AYKA 2W13A 1HV5A 1XFVA 1B3DA 1PWWA 1QJIA 1GE5A 1IACA 3B8ZA 3I7GA 3LJZA 2SRTA 1OM7A 3K7LA 1AKLA 4GF1A 2OI0A 5BOTA 1EB6A 1KUHA 2EROA 3K7NA 3F19A 3EWJA 1L6JA 2MZIA 4GWMA 3KWVC 3EDHA 1UTZA 4WK7A 1D8FA 3LIRA 3HDAP 3EDIA 3LQ0A 4JP4A 5BOYA 5BPAA 1IAEA 2E3XA 2OXZA 1XFUA 2OVXA 2OW2A 1B8YA 4DD8A 3U1RA 2MZEA 1QIBA 2POJA 1MMPA 1Y8JA 2HU6A 5D3CA 5I2ZA 1KAPP 2DDYA 1YP1A 1SRPA 2K2GA 5I0LA 1FLSA 1ROSA 1JIWP 1IAAA 3O2XA 1BKCE 1SATA 1QJJA 2JNPA 1OO9A 3HY7A 4G9LA 4GWNA 3HDBA 1ZXCA 2AYKA 1MMBA 1FBLA 1JAQA 1CAQA 5CZMA 3LUMA 2RJQA 3BA0A 2OW0A 3KECA 1BKCA 2N8RA 4I03A 2FV9A 4H84A 2O3EA 2DW1A 1CGLA 4DV8A 1R1JA 1BQOA 1C7KA 3OHOA 3LKAA 5D2BA 1QIAA 1ATLA 3V96B 2XS4A 3AIGA 4A7BA 1BZSA 3LE9A 1KUGA 4H49A 1OS9A 2DDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3I A;  1BQQ M;  1Y93 A;  2KRJ A;  1CK7 A;  2MLR A;  1OMJ A;  5LAB A;  4GR8 A;  5I3M A;  2V4B A;  4J4M A;  1HFC A;  3L0T A;  1SMP A;  3L0V A;  4G0D A;  3VTG A;  3CKI A;  1R1H A;  3P24 A;  1PWP A;  4WF6 A;  1EUB A;  4XM7 A;  1QUA A;  3HB2 P;  3DPE A;  4IJO A;  1BM6 A;  4GQL A;  3DNG A;  1XUR A;  3HBV P;  2OVZ A;  1O0T A;  1GXD A;  3N2V A;  5L7F A;  2WOA A;  3E8R A;  4PKR A;  1BSW A;  3ZXH A;  1D5J A;  1SU3 A;  3LEA A;  3TT4 A;  1BIW A;  1XUD A;  4XBH A;  2WO9 A;  3KEJ A;  2I47 A;  4PKS A;  1UEA A;  1HTD A;  1XFZ A;  4WKE A;  3Q2H A;  2A8H A;  1AST A;  3F16 A;  4JPA A;  2OW1 A;  1UMT A;  3DWB A;  4GR0 A;  5D1U A;  5I4O A;  1ZVX A;  3GBO A;  4H1Q A;  3F18 A;  2XS3 A;  5I12 A;  1G12 A;  1DMT A;  4H82 A;  4AIG A;  1KBC A;  4IUW A;  5D1T A;  2W15 A;  1J7N A;  4H76 A;  1MMR A;  4FU4 A;  1D8M A;  1D7X A;  3LQB A;  2D1O A;  2QPJ A;  2AIG P;  1JKY A;  1AYK A;  1G49 A;  1ZTQ A;  1JIZ A;  5CUH A;  4H30 A;  1IAD A;  1A85 A;  1QIC A;  2E2D A;  3LGP A;  4H2E A;  3HBU P;  1HY7 A;  1MNC A;  4L6T A;  1HOV A;  5B5O A;  1RM8 A;  4AXQ A;  3EHY A;  1HFS A;  3OHL A;  4AUO A;  1CQR A;  3DPF A;  4L63 A;  1G05 A;  4CTH A;  3DSL A;  4HX3 A;  1I1I P;  3LJT A;  3B2Z A;  2JT5 A;  1K7Q A;  1XFY A;  1K7I A;  5L79 A;  1JAN A;  2DW2 A;  1OM8 A;  2CKI A;  2W14 A;  1UTT A;  2FV5 A;  2ERQ A;  1CGF A;  2X3A A;  1GE6 A;  3VI1 A;  1KUK A;  2K9C A;  3KRY A;  4PKW A;  1OM6 A;  1XFW A;  3F1A A;  3LUN A;  4QKZ A;  4DF9 A;  1OS2 A;  1JH1 A;  4HMA A;  2CLT A;  2Z2D A;  1MMQ A;  3ZUK A;  2DW0 A;  5D7W A;  1O0Q A;  5H8X A;  1C8T A;  2L0R A;  1YQY A;  5B5P A;  4DPE A;  3TVC A;  2X3B A;  3F17 A;  1CGE A;  1S4B P;  4AYK A;  3I7I A;  3G5C A;  3TSK A;  1SLM A;  4JA1 A;  4A3W A;  1I73 A;  3TS4 A;  4IN9 A;  4GR3 A;  1USN A;  1IAG A;  4PKU A;  4R3V A;  3ELM A;  2WO8 A;  3MA2 A;  3DL1 A;  3LIL A;  1JAO A;  830C A;  2YIG A;  1XFX A;  2MLS A;  3B92 A;  5D1S A;  1XUC A;  4PKT A;  456C A;  1Q3A A;  3LJG A;  2W0D A;  1ZXV A;  1H71 P;  3EHX A;  2X3C A;  3UVC A;  3N2U A;  3SHI A;  3G42 A;  1ND1 A;  1EAK A;  1UMS A;  4ON1 A;  2OY4 A;  1JJ9 A;  2JT6 A;  2ERP A;  1RMZ A;  1AF0 A;  1KUI A;  1BUV M;  1KUF A;  3KME A;  966C A;  2OY2 A;  1WNI A;  4JIJ A;  2MZH A;  1ZS0 A;  1BKC I;  1I76 A;  4PKV A;  2W12 A;  5I43 A;  3P1V A;  2Y6D A;  2PJT A;  1G4K A;  1R1I A;  5CXA A;  1SLN A;  2OXU A;  2RJP A;  2OXW A;  4XCT A;  3EDZ A;  3AYU A;  4L19 A;  4EFS A;  2OW9 A;  1R54 A;  2J83 A;  1FM1 A;  1ZP5 A;  2TCL A;  3RTS A;  1K7G A;  1R55 A;  4I35 A;  1YOU A;  1A86 A;  4ILW D;  4XM6 A;  3HYG A;  3LK8 A;  4WKI A;  1IAB A;  4GUY A;  1PWU A;  4WZV A;  3F15 A;  2X7M A;  3NX7 A;  4PKQ A;  3WV2 A;  5JMY A;  2OZR A;  3USN A;  3HY9 A;  2J0T A;  1JAP A;  1YCM A;  2O36 A;  1CXV A;  4FXY P;  1GO7 P;  3KMC A;  1PWQ A;  1Y0V A;  1JK3 A;  3RTT A;  3O64 A;  1Z3J A;  2USN A;  3WV1 A;  3KEK A;  2JSD A;  3LMC A;  1G9K A;  3KHI A;  3ZVS A;  1GKD A;  1BUD A;  4FXQ A;  4Q1L A;  4FVL A;  1GE7 A;  1GKC A;  2JIH A;  3Q2G A;  3WV3 A;  1DTH A;  2D1N A;  4ZR5 A;  3EDG A;  1CIZ A;  4H3X A;  1PWV A;  2Y6C A;  1GO8 P;  2YB9 A;  4XM8 A;  4JQG A;  3LIK A;  3AYK A;  2W13 A;  1HV5 A;  1XFV A;  1B3D A;  1PWW A;  1QJI A;  1GE5 A;  1IAC A;  3B8Z A;  3I7G A;  3LJZ A;  2SRT A;  1OM7 A;  3K7L A;  1AKL A;  4GF1 A;  2OI0 A;  5BOT A;  1EB6 A;  1KUH A;  2ERO A;  3K7N A;  3F19 A;  3EWJ A;  1L6J A;  2MZI A;  4GWM A;  3KWV C;  3EDH A;  1UTZ A;  4WK7 A;  1D8F A;  3LIR A;  3HDA P;  3EDI A;  3LQ0 A;  4JP4 A;  5BOY A;  5BPA A;  1IAE A;  2E3X A;  2OXZ A;  1XFU A;  2OVX A;  2OW2 A;  1B8Y A;  4DD8 A;  3U1R A;  2MZE A;  1QIB A;  2POJ A;  1MMP A;  1Y8J A;  2HU6 A;  5D3C A;  5I2Z A;  1KAP P;  2DDY A;  1YP1 A;  1SRP A;  2K2G A;  5I0L A;  1FLS A;  1ROS A;  1JIW P;  1IAA A;  3O2X A;  1BKC E;  1SAT A;  1QJJ A;  2JNP A;  1OO9 A;  3HY7 A;  4G9L A;  4GWN A;  3HDB A;  1ZXC A;  2AYK A;  1MMB A;  1FBL A;  1JAQ A;  1CAQ A;  5CZM A;  3LUM A;  2RJQ A;  3BA0 A;  2OW0 A;  3KEC A;  1BKC A;  2N8R A;  4I03 A;  2FV9 A;  4H84 A;  2O3E A;  2DW1 A;  1CGL A;  4DV8 A;  1R1J A;  1BQO A;  1C7K A;  3OHO A;  3LKA A;  5D2B A;  1QIA A;  1ATL A;  3V96 B;  2XS4 A;  3AIG A;  4A7B A;  1BZS A;  3LE9 A;  1KUG A;  4H49 A;  1OS9 A;  2DDF A; 
#chains in the Genus database with same CATH topology
 1C3I A;  1BQQ M;  1Y93 A;  2KRJ A;  1CK7 A;  2MLR A;  1OMJ A;  5LAB A;  4GR8 A;  5I3M A;  2V4B A;  4J4M A;  1HFC A;  3L0T A;  1SMP A;  3L0V A;  4G0D A;  3VTG A;  3CKI A;  1R1H A;  3P24 A;  1PWP A;  4WF6 A;  1EUB A;  4XM7 A;  1QUA A;  3HB2 P;  3DPE A;  4IJO A;  1BM6 A;  4GQL A;  3DNG A;  1XUR A;  3HBV P;  2OVZ A;  1O0T A;  1GXD A;  3N2V A;  5L7F A;  2WOA A;  3E8R A;  4PKR A;  1BSW A;  3ZXH A;  1D5J A;  1SU3 A;  3LEA A;  3TT4 A;  1BIW A;  1XUD A;  4XBH A;  2WO9 A;  3KEJ A;  2I47 A;  4PKS A;  1UEA A;  1HTD A;  1XFZ A;  4WKE A;  3Q2H A;  2A8H A;  1AST A;  3F16 A;  4JPA A;  2OW1 A;  1UMT A;  3DWB A;  4GR0 A;  5D1U A;  5I4O A;  1ZVX A;  3GBO A;  4H1Q A;  3F18 A;  2XS3 A;  5I12 A;  1G12 A;  1DMT A;  4H82 A;  4AIG A;  1KBC A;  4IUW A;  5D1T A;  2W15 A;  1J7N A;  4H76 A;  1MMR A;  1XM5 A;  4FU4 A;  1D8M A;  1D7X A;  3LQB A;  2D1O A;  2QPJ A;  2AIG P;  1JKY A;  1AYK A;  1G49 A;  1ZTQ A;  1JIZ A;  5CUH A;  4H30 A;  1IAD A;  1A85 A;  1QIC A;  2E2D A;  3LGP A;  4H2E A;  3HBU P;  1HY7 A;  1MNC A;  4L6T A;  1HOV A;  5B5O A;  1RM8 A;  4AXQ A;  3EHY A;  1HFS A;  3OHL A;  4L7A A;  4AUO A;  1CQR A;  3DPF A;  4L63 A;  1G05 A;  4CTH A;  3DSL A;  1XAX A;  4HX3 A;  1I1I P;  3LJT A;  3B2Z A;  2JT5 A;  1K7Q A;  1XFY A;  1K7I A;  5L79 A;  1JAN A;  3DTI A;  2DW2 A;  1OM8 A;  3DTK A;  2CKI A;  2W14 A;  1UTT A;  2FV5 A;  2ERQ A;  1CGF A;  2X3A A;  1GE6 A;  3VI1 A;  1KUK A;  2K9C A;  3KRY A;  1OZ9 A;  4PKW A;  1OM6 A;  1XFW A;  3F1A A;  3LUN A;  4QKZ A;  4DF9 A;  1OS2 A;  1JH1 A;  4HMA A;  2CLT A;  2Z2D A;  1MMQ A;  3ZUK A;  2DW0 A;  5D7W A;  1O0Q A;  5H8X A;  1C8T A;  2L0R A;  1YQY A;  5B5P A;  4DPE A;  3TVC A;  2X3B A;  3F17 A;  1CGE A;  1S4B P;  4AYK A;  3I7I A;  3G5C A;  3TSK A;  2YUF A;  1SLM A;  4JA1 A;  4A3W A;  1I73 A;  3TS4 A;  4IN9 A;  4GR3 A;  1USN A;  1IAG A;  4PKU A;  4R3V A;  3ELM A;  2WO8 A;  3MA2 A;  3DL1 A;  3LIL A;  1JAO A;  830C A;  2YIG A;  1XFX A;  2MLS A;  3B92 A;  5D1S A;  1XUC A;  4PKT A;  456C A;  1Q3A A;  3LJG A;  2W0D A;  1ZXV A;  1H71 P;  3EHX A;  2X3C A;  3UVC A;  3N2U A;  3SHI A;  3G42 A;  1ND1 A;  1EAK A;  1UMS A;  4ON1 A;  2OY4 A;  1JJ9 A;  2JT6 A;  2ERP A;  1RMZ A;  1AF0 A;  1KUI A;  1BUV M;  1KUF A;  3KME A;  966C A;  2OY2 A;  1WNI A;  4JIJ A;  2MZH A;  1ZS0 A;  1BKC I;  1I76 A;  4PKV A;  2W12 A;  5I43 A;  3P1V A;  3DTE A;  2Y6D A;  2PJT A;  1G4K A;  1R1I A;  5CXA A;  1SLN A;  2OXU A;  2RJP A;  2OXW A;  4XCT A;  3EDZ A;  3AYU A;  4L19 A;  4EFS A;  2OW9 A;  1R54 A;  2J83 A;  1FM1 A;  1ZP5 A;  2TCL A;  3RTS A;  1K7G A;  1R55 A;  4I35 A;  1TVI A;  1YOU A;  1A86 A;  4ILW D;  4XM6 A;  3HYG A;  3LK8 A;  4WKI A;  1IAB A;  4GUY A;  1PWU A;  4WZV A;  3F15 A;  2X7M A;  3NX7 A;  4PKQ A;  3WV2 A;  5JMY A;  2OZR A;  3USN A;  3HY9 A;  2J0T A;  1JAP A;  1YCM A;  2O36 A;  1CXV A;  4FXY P;  1GO7 P;  3KMC A;  1PWQ A;  1Y0V A;  1JK3 A;  3RTT A;  3O64 A;  1Z3J A;  2USN A;  3WV1 A;  3KEK A;  2JSD A;  3LMC A;  1G9K A;  3KHI A;  3ZVS A;  1GKD A;  1BUD A;  4FXQ A;  4Q1L A;  4FVL A;  1GE7 A;  1GKC A;  2JIH A;  3Q2G A;  3WV3 A;  1DTH A;  2D1N A;  4ZR5 A;  3EDG A;  1CIZ A;  4H3X A;  1PWV A;  2Y6C A;  1GO8 P;  2YB9 A;  4XM8 A;  4JQG A;  3LIK A;  3AYK A;  2W13 A;  1HV5 A;  1XFV A;  1B3D A;  1PWW A;  1QJI A;  1GE5 A;  1IAC A;  3B8Z A;  3I7G A;  3LJZ A;  2SRT A;  1OM7 A;  3K7L A;  1AKL A;  4GF1 A;  2OI0 A;  5BOT A;  1EB6 A;  1KUH A;  2ERO A;  3K7N A;  3F19 A;  3EWJ A;  1L6J A;  2MZI A;  4GWM A;  3KWV C;  3EDH A;  1UTZ A;  4WK7 A;  1D8F A;  3LIR A;  3HDA P;  3EDI A;  3LQ0 A;  4JP4 A;  5BOY A;  5BPA A;  1IAE A;  2E3X A;  2OXZ A;  1XFU A;  2OVX A;  2OW2 A;  1B8Y A;  4DD8 A;  3U1R A;  2MZE A;  1QIB A;  2POJ A;  1MMP A;  1Y8J A;  2HU6 A;  5D3C A;  5I2Z A;  1KAP P;  2DDY A;  1YP1 A;  1SRP A;  2K2G A;  5I0L A;  1FLS A;  1ROS A;  1JIW P;  1IAA A;  3O2X A;  1BKC E;  1SAT A;  1QJJ A;  2JNP A;  1OO9 A;  3HY7 A;  4G9L A;  4GWN A;  3HDB A;  1ZXC A;  2AYK A;  1MMB A;  1FBL A;  1JAQ A;  1CAQ A;  5CZM A;  3LUM A;  2RJQ A;  3BA0 A;  2OW0 A;  3KEC A;  1BKC A;  2N8R A;  4I03 A;  2FV9 A;  4H84 A;  2O3E A;  2DW1 A;  1CGL A;  4DV8 A;  1R1J A;  1BQO A;  1C7K A;  3OHO A;  3LKA A;  5D2B A;  1QIA A;  1ATL A;  3V96 B;  2XS4 A;  3AIG A;  4A7B A;  1BZS A;  3LE9 A;  1KUG A;  4H49 A;  1OS9 A;  2DDF A; 
#chains in the Genus database with same CATH homology
 1C3I A;  1BQQ M;  1Y93 A;  2KRJ A;  1CK7 A;  2MLR A;  1OMJ A;  5LAB A;  4GR8 A;  5I3M A;  2V4B A;  4J4M A;  1HFC A;  3L0T A;  1SMP A;  3L0V A;  4G0D A;  3VTG A;  3CKI A;  1R1H A;  3P24 A;  1PWP A;  4WF6 A;  1EUB A;  4XM7 A;  1QUA A;  3HB2 P;  3DPE A;  4IJO A;  1BM6 A;  4GQL A;  3DNG A;  1XUR A;  3HBV P;  2OVZ A;  1O0T A;  1GXD A;  3N2V A;  5L7F A;  2WOA A;  3E8R A;  4PKR A;  1BSW A;  3ZXH A;  1D5J A;  1SU3 A;  3LEA A;  3TT4 A;  1BIW A;  1XUD A;  4XBH A;  2WO9 A;  3KEJ A;  2I47 A;  4PKS A;  1UEA A;  1HTD A;  1XFZ A;  4WKE A;  3Q2H A;  2A8H A;  1AST A;  3F16 A;  4JPA A;  2OW1 A;  1UMT A;  3DWB A;  4GR0 A;  5D1U A;  5I4O A;  1ZVX A;  3GBO A;  4H1Q A;  3F18 A;  2XS3 A;  5I12 A;  1G12 A;  1DMT A;  4H82 A;  4AIG A;  1KBC A;  4IUW A;  5D1T A;  2W15 A;  1J7N A;  4H76 A;  1MMR A;  4FU4 A;  1D8M A;  1D7X A;  3LQB A;  2D1O A;  2QPJ A;  2AIG P;  1JKY A;  1AYK A;  1G49 A;  1ZTQ A;  1JIZ A;  5CUH A;  4H30 A;  1IAD A;  1A85 A;  1QIC A;  2E2D A;  3LGP A;  4H2E A;  3HBU P;  1HY7 A;  1MNC A;  4L6T A;  1HOV A;  5B5O A;  1RM8 A;  4AXQ A;  3EHY A;  1HFS A;  3OHL A;  4L7A A;  4AUO A;  1CQR A;  3DPF A;  4L63 A;  1G05 A;  4CTH A;  3DSL A;  4HX3 A;  1I1I P;  3LJT A;  3B2Z A;  2JT5 A;  1K7Q A;  1XFY A;  1K7I A;  5L79 A;  1JAN A;  3DTI A;  2DW2 A;  1OM8 A;  3DTK A;  2CKI A;  2W14 A;  1UTT A;  2FV5 A;  2ERQ A;  1CGF A;  2X3A A;  1GE6 A;  3VI1 A;  1KUK A;  2K9C A;  3KRY A;  4PKW A;  1OM6 A;  1XFW A;  3F1A A;  3LUN A;  4QKZ A;  4DF9 A;  1OS2 A;  1JH1 A;  4HMA A;  2CLT A;  2Z2D A;  1MMQ A;  3ZUK A;  2DW0 A;  5D7W A;  1O0Q A;  5H8X A;  1C8T A;  2L0R A;  1YQY A;  5B5P A;  4DPE A;  3TVC A;  2X3B A;  3F17 A;  1CGE A;  1S4B P;  4AYK A;  3I7I A;  3G5C A;  3TSK A;  2YUF A;  1SLM A;  4JA1 A;  4A3W A;  1I73 A;  3TS4 A;  4IN9 A;  4GR3 A;  1USN A;  1IAG A;  4PKU A;  4R3V A;  3ELM A;  2WO8 A;  3MA2 A;  3DL1 A;  3LIL A;  1JAO A;  830C A;  2YIG A;  1XFX A;  2MLS A;  3B92 A;  5D1S A;  1XUC A;  4PKT A;  456C A;  1Q3A A;  3LJG A;  2W0D A;  1ZXV A;  1H71 P;  3EHX A;  2X3C A;  3UVC A;  3N2U A;  3SHI A;  3G42 A;  1ND1 A;  1EAK A;  1UMS A;  4ON1 A;  2OY4 A;  1JJ9 A;  2JT6 A;  2ERP A;  1RMZ A;  1AF0 A;  1KUI A;  1BUV M;  1KUF A;  3KME A;  966C A;  2OY2 A;  1WNI A;  4JIJ A;  2MZH A;  1ZS0 A;  1BKC I;  1I76 A;  4PKV A;  2W12 A;  5I43 A;  3P1V A;  3DTE A;  2Y6D A;  2PJT A;  1G4K A;  1R1I A;  5CXA A;  1SLN A;  2OXU A;  2RJP A;  2OXW A;  4XCT A;  3EDZ A;  3AYU A;  4L19 A;  4EFS A;  2OW9 A;  1R54 A;  2J83 A;  1FM1 A;  1ZP5 A;  2TCL A;  3RTS A;  1K7G A;  1R55 A;  4I35 A;  1YOU A;  1A86 A;  4ILW D;  4XM6 A;  3HYG A;  3LK8 A;  4WKI A;  1IAB A;  4GUY A;  1PWU A;  4WZV A;  3F15 A;  2X7M A;  3NX7 A;  4PKQ A;  3WV2 A;  5JMY A;  2OZR A;  3USN A;  3HY9 A;  2J0T A;  1JAP A;  1YCM A;  2O36 A;  1CXV A;  4FXY P;  1GO7 P;  3KMC A;  1PWQ A;  1Y0V A;  1JK3 A;  3RTT A;  3O64 A;  1Z3J A;  2USN A;  3WV1 A;  3KEK A;  2JSD A;  3LMC A;  1G9K A;  3KHI A;  3ZVS A;  1GKD A;  1BUD A;  4FXQ A;  4Q1L A;  4FVL A;  1GE7 A;  1GKC A;  2JIH A;  3Q2G A;  3WV3 A;  1DTH A;  2D1N A;  4ZR5 A;  3EDG A;  1CIZ A;  4H3X A;  1PWV A;  2Y6C A;  1GO8 P;  2YB9 A;  4XM8 A;  4JQG A;  3LIK A;  3AYK A;  2W13 A;  1HV5 A;  1XFV A;  1B3D A;  1PWW A;  1QJI A;  1GE5 A;  1IAC A;  3B8Z A;  3I7G A;  3LJZ A;  2SRT A;  1OM7 A;  3K7L A;  1AKL A;  4GF1 A;  2OI0 A;  5BOT A;  1EB6 A;  1KUH A;  2ERO A;  3K7N A;  3F19 A;  3EWJ A;  1L6J A;  2MZI A;  4GWM A;  3KWV C;  3EDH A;  1UTZ A;  4WK7 A;  1D8F A;  3LIR A;  3HDA P;  3EDI A;  3LQ0 A;  4JP4 A;  5BOY A;  5BPA A;  1IAE A;  2E3X A;  2OXZ A;  1XFU A;  2OVX A;  2OW2 A;  1B8Y A;  4DD8 A;  3U1R A;  2MZE A;  1QIB A;  2POJ A;  1MMP A;  1Y8J A;  2HU6 A;  5D3C A;  5I2Z A;  1KAP P;  2DDY A;  1YP1 A;  1SRP A;  2K2G A;  5I0L A;  1FLS A;  1ROS A;  1JIW P;  1IAA A;  3O2X A;  1BKC E;  1SAT A;  1QJJ A;  2JNP A;  1OO9 A;  3HY7 A;  4G9L A;  4GWN A;  3HDB A;  1ZXC A;  2AYK A;  1MMB A;  1FBL A;  1JAQ A;  1CAQ A;  5CZM A;  3LUM A;  2RJQ A;  3BA0 A;  2OW0 A;  3KEC A;  1BKC A;  2N8R A;  4I03 A;  2FV9 A;  4H84 A;  2O3E A;  2DW1 A;  1CGL A;  4DV8 A;  1R1J A;  1BQO A;  1C7K A;  3OHO A;  3LKA A;  5D2B A;  1QIA A;  1ATL A;  3V96 B;  2XS4 A;  3AIG A;  4A7B A;  1BZS A;  3LE9 A;  1KUG A;  4H49 A;  1OS9 A;  2DDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...