1QJJA

Structure of astacin with a hydroxamic acid inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
AAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ASTACIN
publication title Structure of Astacin with a Transition-State Analogue Inhibitor
pubmed doi rcsb
total genus 61
structure length 200
sequence length 200
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qjjA00
2JIHA 3P24A 1R54A 3WV1A 1I73A 3DPEA 4FU4A 3DL1A 1HFSA 2AIGP 3EDHA 3K7LA 4H82A 1FM1A 1R1JA 2YIGA 1XURA 4XBHA 3DPFA 2DW1A 2E3XA 4A3WA 1JAOA 1B3DA 2USNA 3I7GA 3F1AA 1XUCA 1HY7A 1GO7P 1YQYA 1OS2A 1QIAA 1B8YA 1R1IA 1BKCA 4ZR5A 1UEAA 2ERQA 1QICA 1SU3A 4PKWA 2E2DA 5CZMA 1S4BP 5CXAA 2L0RA 1GE5A 4H3XA 2Y6CA 5BOYA 1O0QA 1QUAA 3TT4A 3HY9A 1DMTA 2JSDA 2QPJA 4DF9A 1C8TA 4L6TA 3LIKA 2HU6A 1AKLA 4PKQA 2CLTA 3RTSA 4AXQA 3VTGA 2I47A 1XFUA 2OW9A 3HB2P 5D3CA 1FLSA 2OXUA 4A7BA 4FVLA 1YP1A 2W14A 1EUBA 4AIGA 4XM7A 3LJZA 5JMYA 5I12A 2XS4A 1D5JA 1BUVM 4WZVA 3HYGA 4JP4A 2W15A 4GQLA 3DSLA 1UMSA 4I03A 5B5PA 1PWVA 2N8RA 3F19A 1CQRA 3V96B 5D2BA 1SATA 1D8MA 3EDGA 1IAEA 3BA0A 5I2ZA 4DPEA 4GF1A 4AYKA 3LQBA 1BQOA 2WOAA 1DTHA 1Q3AA 1ZXVA 4Q1LA 3EHXA 1GKCA 1SLMA 1HOVA 1GXDA 2X3CA 456CA 4HMAA 1JIWP 2O36A 1MNCA 1BKCI 3Q2HA 3ZVSA 1JJ9A 1AYKA 966CA 3ZXHA 1HV5A 2XS3A 3VI1A 4WK7A 4GR0A 1QJIA 1XFYA 1L6JA 3LIRA 1IAAA 1KUFA 1ZS0A 2X7MA 1BZSA 5L7FA 1GO8P 3K7NA 2OI0A 2OY2A 1JAPA 4CTHA 4XM8A 4JA1A 2O3EA 1KUIA 2JNPA 5BPAA 3LUMA 4WF6A 1AF0A 3TSKA 2OXWA 2WO9A 1OM6A 2OVZA 5H8XA 4PKTA 3EWJA 2MLRA 2SRTA 1K7QA 3B8ZA 3EHYA 3USNA 1CIZA 2K2GA 2MZEA 3KMEA 2X3AA 1SLNA 1UMTA 3OHOA 4J4MA 5I4OA 3AIGA 2W13A 3B92A 1CXVA 4PKRA 5I43A 2W0DA 4GWNA 1UTTA 4XM6A 3UVCA 830CA 3KHIA 1IACA 3KMCA 4IJOA 4HX3A 2J83A 3LKAA 1RMZA 2PJTA 1GE6A 1MMBA 2DDYA 1YCMA 3KEKA 4JPAA 2AYKA 3HBVP 4WKEA 1ZP5A 4H2EA 2FV5A 2JT6A 1JIZA 4ON1A 3L0TA 3O64A 3L0VA 1WNIA 1I1IP 4H30A 1YOUA 5I0LA 3LUNA 1R1HA 4JQGA 3DWBA 3N2VA 1ND1A 3HBUP 3F15A 3G5CA 1XUDA 5BOTA 2RJQA 1C3IA 1RM8A 2DW0A 1PWWA 4PKSA 4QKZA 1FBLA 1QJJA 1SRPA 1Y8JA 3LJTA 2FV9A 2X3BA 3LE9A 2POJA 2OW0A 1K7GA 1PWQA 3KRYA 1Y0VA 1O0TA 5LABA 1D7XA 4GUYA 4PKUA 5D7WA 3F18A 1ZXCA 4G9LA 3LGPA 5B5OA 1JANA 1MMQA 2WO8A 3AYKA 4XCTA 3Q2GA 4FXQA 1XFWA 4GWMA 1CGFA 1ZVXA 5D1TA 1MMRA 1BQQM 1JKYA 3N2UA 4H76A 2YB9A 1KUGA 2OY4A 3HDAP 3CKIA 1BKCE 1Z3JA 1G4KA 2D1NA 4WKIA 1UTZA 1SMPA 2JT5A 3GBOA 4G0DA 3LEAA 3I7IA 3RTTA 2A8HA 3F16A 4DV8A 1XFXA 2KRJA 3LQ0A 2EROA 4GR3A 1HTDA 4IUWA 4L19A 3TVCA 1ASTA 3AYUA 4H1QA 1QIBA 1XFVA 2MZHA 1EAKA 4EFSA 2OXZA 3HY7A 2DDFA 3TS4A 2CKIA 2Z2DA 3SHIA 4AUOA 2K9CA 3LMCA 2OZRA 1PWPA 2RJPA 4R3VA 4DD8A 4L63A 3EDZA 1MMPA 1JAQA 1Y93A 2OW2A 1G12A 1BM6A 1OMJA 1XFZA 1BUDA 3ELMA 3WV3A 5D1UA 1H71P 1JH1A 3O2XA 1C7KA 3LILA 3WV2A 3LK8A 1D8FA 1EB6A 3U1RA 1ZTQA 3KWVC 3KEJA 2DW2A 1KUHA 2W12A 1HFCA 4IN9A 1KBCA 2OVXA 1BSWA 1OO9A 2J0TA 3P1VA 3NX7A 2ERPA 3G42A 1G05A 1IAGA 1GKDA 1KUKA 4JIJA 1GE7A 1OM7A 3OHLA 1CGEA 3B2ZA 1G49A 4GR8A 2D1OA 4PKVA 2Y6DA 4I35A 1OS9A 1IADA 2OW1A 4H84A 1J7NA 3ZUKA 4FXYP 1G9KA 2TCLA 1CGLA 3LJGA 4H49A 3HDBA 5L79A 1USNA 2MLSA 3E8RA 1ROSA 1OM8A 1A85A 3MA2A 1IABA 1A86A 5D1SA 3DNGA 1KAPP 1JK3A 2V4BA 4ILWD 1CK7A 1R55A 1CAQA 3KECA 3F17A 5CUHA 5I3MA 1ATLA 2MZIA 3EDIA 1I76A 1BIWA 1K7IA 1PWUA
chains in the Genus database with same CATH superfamily
2JIHA 3P24A 1R54A 3WV1A 1I73A 3DPEA 4FU4A 3DL1A 1HFSA 2AIGP 3EDHA 3K7LA 4H82A 1FM1A 1R1JA 2YIGA 1XURA 4XBHA 3DPFA 2DW1A 2E3XA 4A3WA 1JAOA 1B3DA 2USNA 3I7GA 3F1AA 1XUCA 1HY7A 1GO7P 1YQYA 1OS2A 1QIAA 1B8YA 1R1IA 1BKCA 4ZR5A 1UEAA 2ERQA 1QICA 1SU3A 4PKWA 2E2DA 5CZMA 1S4BP 5CXAA 2L0RA 1GE5A 4H3XA 2Y6CA 5BOYA 1O0QA 1QUAA 3TT4A 3HY9A 1DMTA 2JSDA 2QPJA 1XAXA 1C8TA 4DF9A 4L6TA 3LIKA 2HU6A 1AKLA 4PKQA 2CLTA 3RTSA 4AXQA 3VTGA 2I47A 1XFUA 2OW9A 3HB2P 5D3CA 1FLSA 2OXUA 4A7BA 4FVLA 1YP1A 2W14A 1EUBA 4AIGA 4XM7A 3LJZA 5JMYA 5I12A 2XS4A 1D5JA 1BUVM 4WZVA 3HYGA 4JP4A 2W15A 4GQLA 3DSLA 1UMSA 4I03A 5B5PA 1PWVA 2N8RA 3F19A 1CQRA 3V96B 5D2BA 1SATA 1D8MA 3EDGA 1IAEA 3BA0A 5I2ZA 4DPEA 4GF1A 4AYKA 3LQBA 1BQOA 2WOAA 1DTHA 1Q3AA 1ZXVA 4Q1LA 3EHXA 1GKCA 1SLMA 1HOVA 2YUFA 1GXDA 1TVIA 2X3CA 456CA 4HMAA 1JIWP 2O36A 1MNCA 1BKCI 3Q2HA 3ZVSA 1JJ9A 1AYKA 966CA 3ZXHA 1HV5A 2XS3A 3VI1A 4WK7A 4GR0A 1QJIA 1XFYA 1L6JA 3LIRA 1IAAA 1KUFA 1ZS0A 2X7MA 1BZSA 5L7FA 1GO8P 3K7NA 2OI0A 2OY2A 1JAPA 4CTHA 4XM8A 4JA1A 2O3EA 1KUIA 2JNPA 5BPAA 3LUMA 4WF6A 1AF0A 3TSKA 2OXWA 2WO9A 1OM6A 2OVZA 5H8XA 4PKTA 3EWJA 2MLRA 2SRTA 1K7QA 3B8ZA 3EHYA 3USNA 1CIZA 2K2GA 2MZEA 3KMEA 2X3AA 1SLNA 1UMTA 3OHOA 4J4MA 5I4OA 3AIGA 2W13A 3B92A 1CXVA 4PKRA 5I43A 2W0DA 4GWNA 1UTTA 4XM6A 3UVCA 830CA 3KHIA 1IACA 3KMCA 4IJOA 4HX3A 2J83A 3LKAA 1RMZA 2PJTA 1GE6A 1MMBA 2DDYA 1YCMA 3KEKA 4JPAA 2AYKA 3HBVP 4WKEA 1ZP5A 4H2EA 2FV5A 2JT6A 1JIZA 4ON1A 3L0TA 3O64A 3L0VA 1WNIA 1I1IP 4H30A 1YOUA 5I0LA 3LUNA 1R1HA 4JQGA 3DWBA 3N2VA 1ND1A 3HBUP 3F15A 3G5CA 1XUDA 5BOTA 2RJQA 1C3IA 1RM8A 2DW0A 1PWWA 4PKSA 4QKZA 1FBLA 1QJJA 1SRPA 1Y8JA 3DTEA 3LJTA 2FV9A 2X3BA 3LE9A 2POJA 2OW0A 1K7GA 1PWQA 3KRYA 1Y0VA 1O0TA 5LABA 1D7XA 4GUYA 4PKUA 5D7WA 3F18A 1ZXCA 4G9LA 3LGPA 5B5OA 1JANA 1MMQA 2WO8A 3AYKA 4XCTA 3Q2GA 4FXQA 1XFWA 4GWMA 1CGFA 1ZVXA 5D1TA 1MMRA 1BQQM 1JKYA 3N2UA 4H76A 2YB9A 1KUGA 2OY4A 3HDAP 3CKIA 1BKCE 1Z3JA 1G4KA 2D1NA 4WKIA 1UTZA 1SMPA 2JT5A 3GBOA 4G0DA 3LEAA 3I7IA 3RTTA 2A8HA 3F16A 4DV8A 1XFXA 2KRJA 3LQ0A 2EROA 4GR3A 1HTDA 4IUWA 4L19A 3TVCA 1ASTA 3AYUA 4H1QA 1QIBA 1XFVA 2MZHA 1EAKA 4EFSA 2OXZA 3HY7A 2DDFA 3TS4A 2CKIA 2Z2DA 3SHIA 4AUOA 2K9CA 3LMCA 2OZRA 1PWPA 2RJPA 4R3VA 4DD8A 4L63A 3EDZA 1MMPA 1JAQA 1Y93A 2OW2A 1G12A 4L7AA 1BM6A 1OZ9A 1OMJA 1XFZA 1BUDA 3ELMA 3WV3A 3DTKA 5D1UA 1H71P 1JH1A 3O2XA 1C7KA 3LILA 3WV2A 3LK8A 1D8FA 1EB6A 3U1RA 1ZTQA 3KWVC 3KEJA 2DW2A 1KUHA 2W12A 1HFCA 4IN9A 1KBCA 3DTIA 2OVXA 1BSWA 1OO9A 2J0TA 3P1VA 3NX7A 2ERPA 3G42A 1G05A 1IAGA 1GKDA 1KUKA 4JIJA 1GE7A 1OM7A 3OHLA 1CGEA 3B2ZA 1G49A 4GR8A 2D1OA 4PKVA 2Y6DA 4I35A 1OS9A 1IADA 2OW1A 4H84A 1J7NA 3ZUKA 4FXYP 1G9KA 2TCLA 1CGLA 3LJGA 4H49A 3HDBA 5L79A 1USNA 2MLSA 3E8RA 1ROSA 1XM5A 1OM8A 1A85A 3MA2A 1IABA 1A86A 5D1SA 3DNGA 1KAPP 1JK3A 2V4BA 4ILWD 1CK7A 1R55A 1CAQA 3KECA 3F17A 5CUHA 5I3MA 1ATLA 2MZIA 3EDIA 1I76A 1BIWA 1K7IA 1PWUA
chains in the Genus database with same CATH topology
2JIHA 3P24A 1R54A 3WV1A 1I73A 3DPEA 4FU4A 3DL1A 1HFSA 2AIGP 3EDHA 3K7LA 4H82A 1FM1A 1R1JA 2YIGA 1XURA 4XBHA 3DPFA 2DW1A 2E3XA 4A3WA 1JAOA 1B3DA 2USNA 3I7GA 3F1AA 1XUCA 1HY7A 1GO7P 1YQYA 1OS2A 1QIAA 1B8YA 1R1IA 1BKCA 4ZR5A 1UEAA 2ERQA 1QICA 1SU3A 4PKWA 2E2DA 5CZMA 1S4BP 5CXAA 2L0RA 1GE5A 4H3XA 2Y6CA 5BOYA 1O0QA 1QUAA 3TT4A 3HY9A 1DMTA 2JSDA 2QPJA 4DF9A 1C8TA 4L6TA 3LIKA 2HU6A 1AKLA 4PKQA 2CLTA 3RTSA 4AXQA 3VTGA 2I47A 1XFUA 2OW9A 3HB2P 5D3CA 1FLSA 2OXUA 4A7BA 4FVLA 1YP1A 2W14A 1EUBA 4AIGA 4XM7A 3LJZA 5JMYA 5I12A 2XS4A 1D5JA 1BUVM 4WZVA 3HYGA 4JP4A 2W15A 4GQLA 3DSLA 1UMSA 4I03A 5B5PA 1PWVA 2N8RA 3F19A 1CQRA 3V96B 5D2BA 1SATA 1D8MA 3EDGA 1IAEA 3BA0A 5I2ZA 4DPEA 4GF1A 4AYKA 3LQBA 1BQOA 2WOAA 1DTHA 1Q3AA 1ZXVA 4Q1LA 3EHXA 1GKCA 1SLMA 1HOVA 2YUFA 1GXDA 2X3CA 456CA 4HMAA 1JIWP 2O36A 1MNCA 1BKCI 3Q2HA 3ZVSA 1JJ9A 1AYKA 966CA 3ZXHA 1HV5A 2XS3A 3VI1A 4WK7A 4GR0A 1QJIA 1XFYA 1L6JA 3LIRA 1IAAA 1KUFA 1ZS0A 2X7MA 1BZSA 5L7FA 1GO8P 3K7NA 2OI0A 2OY2A 1JAPA 4CTHA 4XM8A 4JA1A 2O3EA 1KUIA 2JNPA 5BPAA 3LUMA 4WF6A 1AF0A 3TSKA 2OXWA 2WO9A 1OM6A 2OVZA 5H8XA 4PKTA 3EWJA 2MLRA 2SRTA 1K7QA 3B8ZA 3EHYA 3USNA 1CIZA 2K2GA 2MZEA 3KMEA 2X3AA 1SLNA 1UMTA 3OHOA 4J4MA 5I4OA 3AIGA 2W13A 3B92A 1CXVA 4PKRA 5I43A 2W0DA 4GWNA 1UTTA 4XM6A 3UVCA 830CA 3KHIA 1IACA 3KMCA 4IJOA 4HX3A 2J83A 3LKAA 1RMZA 2PJTA 1GE6A 1MMBA 2DDYA 1YCMA 3KEKA 4JPAA 2AYKA 3HBVP 4WKEA 1ZP5A 4H2EA 2FV5A 2JT6A 1JIZA 4ON1A 3L0TA 3O64A 3L0VA 1WNIA 1I1IP 4H30A 1YOUA 5I0LA 3LUNA 1R1HA 4JQGA 3DWBA 3N2VA 1ND1A 3HBUP 3F15A 3G5CA 1XUDA 5BOTA 2RJQA 1C3IA 1RM8A 2DW0A 1PWWA 4PKSA 4QKZA 1FBLA 1QJJA 1SRPA 1Y8JA 3DTEA 3LJTA 2FV9A 2X3BA 3LE9A 2POJA 2OW0A 1K7GA 1PWQA 3KRYA 1Y0VA 1O0TA 5LABA 1D7XA 4GUYA 4PKUA 5D7WA 3F18A 1ZXCA 4G9LA 3LGPA 5B5OA 1JANA 1MMQA 2WO8A 3AYKA 4XCTA 3Q2GA 4FXQA 1XFWA 4GWMA 1CGFA 1ZVXA 5D1TA 1MMRA 1BQQM 1JKYA 3N2UA 4H76A 2YB9A 1KUGA 2OY4A 3HDAP 3CKIA 1BKCE 1Z3JA 1G4KA 2D1NA 4WKIA 1UTZA 1SMPA 2JT5A 3GBOA 4G0DA 3LEAA 3I7IA 3RTTA 2A8HA 3F16A 4DV8A 1XFXA 2KRJA 3LQ0A 2EROA 4GR3A 1HTDA 4IUWA 4L19A 3TVCA 1ASTA 3AYUA 4H1QA 1QIBA 1XFVA 2MZHA 1EAKA 4EFSA 2OXZA 3HY7A 2DDFA 3TS4A 2CKIA 2Z2DA 3SHIA 4AUOA 2K9CA 3LMCA 2OZRA 1PWPA 2RJPA 4R3VA 4DD8A 4L63A 3EDZA 1MMPA 1JAQA 1Y93A 2OW2A 1G12A 4L7AA 1BM6A 1OMJA 1XFZA 1BUDA 3ELMA 3WV3A 3DTKA 5D1UA 1H71P 1JH1A 3O2XA 1C7KA 3LILA 3WV2A 3LK8A 1D8FA 1EB6A 3U1RA 1ZTQA 3KWVC 3KEJA 2DW2A 1KUHA 2W12A 1HFCA 4IN9A 1KBCA 3DTIA 2OVXA 1BSWA 1OO9A 2J0TA 3P1VA 3NX7A 2ERPA 3G42A 1G05A 1IAGA 1GKDA 1KUKA 4JIJA 1GE7A 1OM7A 3OHLA 1CGEA 3B2ZA 1G49A 4GR8A 2D1OA 4PKVA 2Y6DA 4I35A 1OS9A 1IADA 2OW1A 4H84A 1J7NA 3ZUKA 4FXYP 1G9KA 2TCLA 1CGLA 3LJGA 4H49A 3HDBA 5L79A 1USNA 2MLSA 3E8RA 1ROSA 1OM8A 1A85A 3MA2A 1IABA 1A86A 5D1SA 3DNGA 1KAPP 1JK3A 2V4BA 4ILWD 1CK7A 1R55A 1CAQA 3KECA 3F17A 5CUHA 5I3MA 1ATLA 2MZIA 3EDIA 1I76A 1BIWA 1K7IA 1PWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIH A;  3P24 A;  1R54 A;  3WV1 A;  1I73 A;  3DPE A;  4FU4 A;  3DL1 A;  1HFS A;  2AIG P;  3EDH A;  3K7L A;  4H82 A;  1FM1 A;  1R1J A;  2YIG A;  1XUR A;  4XBH A;  3DPF A;  2DW1 A;  2E3X A;  4A3W A;  1JAO A;  1B3D A;  2USN A;  3I7G A;  3F1A A;  1XUC A;  1HY7 A;  1GO7 P;  1YQY A;  1OS2 A;  1QIA A;  1B8Y A;  1R1I A;  1BKC A;  4ZR5 A;  1UEA A;  2ERQ A;  1QIC A;  1SU3 A;  4PKW A;  2E2D A;  5CZM A;  1S4B P;  5CXA A;  2L0R A;  1GE5 A;  4H3X A;  2Y6C A;  5BOY A;  1O0Q A;  1QUA A;  3TT4 A;  3HY9 A;  1DMT A;  2JSD A;  2QPJ A;  4DF9 A;  1C8T A;  4L6T A;  3LIK A;  2HU6 A;  1AKL A;  4PKQ A;  2CLT A;  3RTS A;  4AXQ A;  3VTG A;  2I47 A;  1XFU A;  2OW9 A;  3HB2 P;  5D3C A;  1FLS A;  2OXU A;  4A7B A;  4FVL A;  1YP1 A;  2W14 A;  1EUB A;  4AIG A;  4XM7 A;  3LJZ A;  5JMY A;  5I12 A;  2XS4 A;  1D5J A;  1BUV M;  4WZV A;  3HYG A;  4JP4 A;  2W15 A;  4GQL A;  3DSL A;  1UMS A;  4I03 A;  5B5P A;  1PWV A;  2N8R A;  3F19 A;  1CQR A;  3V96 B;  5D2B A;  1SAT A;  1D8M A;  3EDG A;  1IAE A;  3BA0 A;  5I2Z A;  4DPE A;  4GF1 A;  4AYK A;  3LQB A;  1BQO A;  2WOA A;  1DTH A;  1Q3A A;  1ZXV A;  4Q1L A;  3EHX A;  1GKC A;  1SLM A;  1HOV A;  1GXD A;  2X3C A;  456C A;  4HMA A;  1JIW P;  2O36 A;  1MNC A;  1BKC I;  3Q2H A;  3ZVS A;  1JJ9 A;  1AYK A;  966C A;  3ZXH A;  1HV5 A;  2XS3 A;  3VI1 A;  4WK7 A;  4GR0 A;  1QJI A;  1XFY A;  1L6J A;  3LIR A;  1IAA A;  1KUF A;  1ZS0 A;  2X7M A;  1BZS A;  5L7F A;  1GO8 P;  3K7N A;  2OI0 A;  2OY2 A;  1JAP A;  4CTH A;  4XM8 A;  4JA1 A;  2O3E A;  1KUI A;  2JNP A;  5BPA A;  3LUM A;  4WF6 A;  1AF0 A;  3TSK A;  2OXW A;  2WO9 A;  1OM6 A;  2OVZ A;  5H8X A;  4PKT A;  3EWJ A;  2MLR A;  2SRT A;  1K7Q A;  3B8Z A;  3EHY A;  3USN A;  1CIZ A;  2K2G A;  2MZE A;  3KME A;  2X3A A;  1SLN A;  1UMT A;  3OHO A;  4J4M A;  5I4O A;  3AIG A;  2W13 A;  3B92 A;  1CXV A;  4PKR A;  5I43 A;  2W0D A;  4GWN A;  1UTT A;  4XM6 A;  3UVC A;  830C A;  3KHI A;  1IAC A;  3KMC A;  4IJO A;  4HX3 A;  2J83 A;  3LKA A;  1RMZ A;  2PJT A;  1GE6 A;  1MMB A;  2DDY A;  1YCM A;  3KEK A;  4JPA A;  2AYK A;  3HBV P;  4WKE A;  1ZP5 A;  4H2E A;  2FV5 A;  2JT6 A;  1JIZ A;  4ON1 A;  3L0T A;  3O64 A;  3L0V A;  1WNI A;  1I1I P;  4H30 A;  1YOU A;  5I0L A;  3LUN A;  1R1H A;  4JQG A;  3DWB A;  3N2V A;  1ND1 A;  3HBU P;  3F15 A;  3G5C A;  1XUD A;  5BOT A;  2RJQ A;  1C3I A;  1RM8 A;  2DW0 A;  1PWW A;  4PKS A;  4QKZ A;  1FBL A;  1QJJ A;  1SRP A;  1Y8J A;  3LJT A;  2FV9 A;  2X3B A;  3LE9 A;  2POJ A;  2OW0 A;  1K7G A;  1PWQ A;  3KRY A;  1Y0V A;  1O0T A;  5LAB A;  1D7X A;  4GUY A;  4PKU A;  5D7W A;  3F18 A;  1ZXC A;  4G9L A;  3LGP A;  5B5O A;  1JAN A;  1MMQ A;  2WO8 A;  3AYK A;  4XCT A;  3Q2G A;  4FXQ A;  1XFW A;  4GWM A;  1CGF A;  1ZVX A;  5D1T A;  1MMR A;  1BQQ M;  1JKY A;  3N2U A;  4H76 A;  2YB9 A;  1KUG A;  2OY4 A;  3HDA P;  3CKI A;  1BKC E;  1Z3J A;  1G4K A;  2D1N A;  4WKI A;  1UTZ A;  1SMP A;  2JT5 A;  3GBO A;  4G0D A;  3LEA A;  3I7I A;  3RTT A;  2A8H A;  3F16 A;  4DV8 A;  1XFX A;  2KRJ A;  3LQ0 A;  2ERO A;  4GR3 A;  1HTD A;  4IUW A;  4L19 A;  3TVC A;  1AST A;  3AYU A;  4H1Q A;  1QIB A;  1XFV A;  2MZH A;  1EAK A;  4EFS A;  2OXZ A;  3HY7 A;  2DDF A;  3TS4 A;  2CKI A;  2Z2D A;  3SHI A;  4AUO A;  2K9C A;  3LMC A;  2OZR A;  1PWP A;  2RJP A;  4R3V A;  4DD8 A;  4L63 A;  3EDZ A;  1MMP A;  1JAQ A;  1Y93 A;  2OW2 A;  1G12 A;  1BM6 A;  1OMJ A;  1XFZ A;  1BUD A;  3ELM A;  3WV3 A;  5D1U A;  1H71 P;  1JH1 A;  3O2X A;  1C7K A;  3LIL A;  3WV2 A;  3LK8 A;  1D8F A;  1EB6 A;  3U1R A;  1ZTQ A;  3KWV C;  3KEJ A;  2DW2 A;  1KUH A;  2W12 A;  1HFC A;  4IN9 A;  1KBC A;  2OVX A;  1BSW A;  1OO9 A;  2J0T A;  3P1V A;  3NX7 A;  2ERP A;  3G42 A;  1G05 A;  1IAG A;  1GKD A;  1KUK A;  4JIJ A;  1GE7 A;  1OM7 A;  3OHL A;  1CGE A;  3B2Z A;  1G49 A;  4GR8 A;  2D1O A;  4PKV A;  2Y6D A;  4I35 A;  1OS9 A;  1IAD A;  2OW1 A;  4H84 A;  1J7N A;  3ZUK A;  4FXY P;  1G9K A;  2TCL A;  1CGL A;  3LJG A;  4H49 A;  3HDB A;  5L79 A;  1USN A;  2MLS A;  3E8R A;  1ROS A;  1OM8 A;  1A85 A;  3MA2 A;  1IAB A;  1A86 A;  5D1S A;  3DNG A;  1KAP P;  1JK3 A;  2V4B A;  4ILW D;  1CK7 A;  1R55 A;  1CAQ A;  3KEC A;  3F17 A;  5CUH A;  5I3M A;  1ATL A;  2MZI A;  3EDI A;  1I76 A;  1BIW A;  1K7I A;  1PWU A; 
#chains in the Genus database with same CATH topology
 2JIH A;  3P24 A;  1R54 A;  3WV1 A;  1I73 A;  3DPE A;  4FU4 A;  3DL1 A;  1HFS A;  2AIG P;  3EDH A;  3K7L A;  4H82 A;  1FM1 A;  1R1J A;  2YIG A;  1XUR A;  4XBH A;  3DPF A;  2DW1 A;  2E3X A;  4A3W A;  1JAO A;  1B3D A;  2USN A;  3I7G A;  3F1A A;  1XUC A;  1HY7 A;  1GO7 P;  1YQY A;  1OS2 A;  1QIA A;  1B8Y A;  1R1I A;  1BKC A;  4ZR5 A;  1UEA A;  2ERQ A;  1QIC A;  1SU3 A;  4PKW A;  2E2D A;  5CZM A;  1S4B P;  5CXA A;  2L0R A;  1GE5 A;  4H3X A;  2Y6C A;  5BOY A;  1O0Q A;  1QUA A;  3TT4 A;  3HY9 A;  1DMT A;  2JSD A;  2QPJ A;  1XAX A;  1C8T A;  4DF9 A;  4L6T A;  3LIK A;  2HU6 A;  1AKL A;  4PKQ A;  2CLT A;  3RTS A;  4AXQ A;  3VTG A;  2I47 A;  1XFU A;  2OW9 A;  3HB2 P;  5D3C A;  1FLS A;  2OXU A;  4A7B A;  4FVL A;  1YP1 A;  2W14 A;  1EUB A;  4AIG A;  4XM7 A;  3LJZ A;  5JMY A;  5I12 A;  2XS4 A;  1D5J A;  1BUV M;  4WZV A;  3HYG A;  4JP4 A;  2W15 A;  4GQL A;  3DSL A;  1UMS A;  4I03 A;  5B5P A;  1PWV A;  2N8R A;  3F19 A;  1CQR A;  3V96 B;  5D2B A;  1SAT A;  1D8M A;  3EDG A;  1IAE A;  3BA0 A;  5I2Z A;  4DPE A;  4GF1 A;  4AYK A;  3LQB A;  1BQO A;  2WOA A;  1DTH A;  1Q3A A;  1ZXV A;  4Q1L A;  3EHX A;  1GKC A;  1SLM A;  1HOV A;  2YUF A;  1GXD A;  1TVI A;  2X3C A;  456C A;  4HMA A;  1JIW P;  2O36 A;  1MNC A;  1BKC I;  3Q2H A;  3ZVS A;  1JJ9 A;  1AYK A;  966C A;  3ZXH A;  1HV5 A;  2XS3 A;  3VI1 A;  4WK7 A;  4GR0 A;  1QJI A;  1XFY A;  1L6J A;  3LIR A;  1IAA A;  1KUF A;  1ZS0 A;  2X7M A;  1BZS A;  5L7F A;  1GO8 P;  3K7N A;  2OI0 A;  2OY2 A;  1JAP A;  4CTH A;  4XM8 A;  4JA1 A;  2O3E A;  1KUI A;  2JNP A;  5BPA A;  3LUM A;  4WF6 A;  1AF0 A;  3TSK A;  2OXW A;  2WO9 A;  1OM6 A;  2OVZ A;  5H8X A;  4PKT A;  3EWJ A;  2MLR A;  2SRT A;  1K7Q A;  3B8Z A;  3EHY A;  3USN A;  1CIZ A;  2K2G A;  2MZE A;  3KME A;  2X3A A;  1SLN A;  1UMT A;  3OHO A;  4J4M A;  5I4O A;  3AIG A;  2W13 A;  3B92 A;  1CXV A;  4PKR A;  5I43 A;  2W0D A;  4GWN A;  1UTT A;  4XM6 A;  3UVC A;  830C A;  3KHI A;  1IAC A;  3KMC A;  4IJO A;  4HX3 A;  2J83 A;  3LKA A;  1RMZ A;  2PJT A;  1GE6 A;  1MMB A;  2DDY A;  1YCM A;  3KEK A;  4JPA A;  2AYK A;  3HBV P;  4WKE A;  1ZP5 A;  4H2E A;  2FV5 A;  2JT6 A;  1JIZ A;  4ON1 A;  3L0T A;  3O64 A;  3L0V A;  1WNI A;  1I1I P;  4H30 A;  1YOU A;  5I0L A;  3LUN A;  1R1H A;  4JQG A;  3DWB A;  3N2V A;  1ND1 A;  3HBU P;  3F15 A;  3G5C A;  1XUD A;  5BOT A;  2RJQ A;  1C3I A;  1RM8 A;  2DW0 A;  1PWW A;  4PKS A;  4QKZ A;  1FBL A;  1QJJ A;  1SRP A;  1Y8J A;  3DTE A;  3LJT A;  2FV9 A;  2X3B A;  3LE9 A;  2POJ A;  2OW0 A;  1K7G A;  1PWQ A;  3KRY A;  1Y0V A;  1O0T A;  5LAB A;  1D7X A;  4GUY A;  4PKU A;  5D7W A;  3F18 A;  1ZXC A;  4G9L A;  3LGP A;  5B5O A;  1JAN A;  1MMQ A;  2WO8 A;  3AYK A;  4XCT A;  3Q2G A;  4FXQ A;  1XFW A;  4GWM A;  1CGF A;  1ZVX A;  5D1T A;  1MMR A;  1BQQ M;  1JKY A;  3N2U A;  4H76 A;  2YB9 A;  1KUG A;  2OY4 A;  3HDA P;  3CKI A;  1BKC E;  1Z3J A;  1G4K A;  2D1N A;  4WKI A;  1UTZ A;  1SMP A;  2JT5 A;  3GBO A;  4G0D A;  3LEA A;  3I7I A;  3RTT A;  2A8H A;  3F16 A;  4DV8 A;  1XFX A;  2KRJ A;  3LQ0 A;  2ERO A;  4GR3 A;  1HTD A;  4IUW A;  4L19 A;  3TVC A;  1AST A;  3AYU A;  4H1Q A;  1QIB A;  1XFV A;  2MZH A;  1EAK A;  4EFS A;  2OXZ A;  3HY7 A;  2DDF A;  3TS4 A;  2CKI A;  2Z2D A;  3SHI A;  4AUO A;  2K9C A;  3LMC A;  2OZR A;  1PWP A;  2RJP A;  4R3V A;  4DD8 A;  4L63 A;  3EDZ A;  1MMP A;  1JAQ A;  1Y93 A;  2OW2 A;  1G12 A;  4L7A A;  1BM6 A;  1OZ9 A;  1OMJ A;  1XFZ A;  1BUD A;  3ELM A;  3WV3 A;  3DTK A;  5D1U A;  1H71 P;  1JH1 A;  3O2X A;  1C7K A;  3LIL A;  3WV2 A;  3LK8 A;  1D8F A;  1EB6 A;  3U1R A;  1ZTQ A;  3KWV C;  3KEJ A;  2DW2 A;  1KUH A;  2W12 A;  1HFC A;  4IN9 A;  1KBC A;  3DTI A;  2OVX A;  1BSW A;  1OO9 A;  2J0T A;  3P1V A;  3NX7 A;  2ERP A;  3G42 A;  1G05 A;  1IAG A;  1GKD A;  1KUK A;  4JIJ A;  1GE7 A;  1OM7 A;  3OHL A;  1CGE A;  3B2Z A;  1G49 A;  4GR8 A;  2D1O A;  4PKV A;  2Y6D A;  4I35 A;  1OS9 A;  1IAD A;  2OW1 A;  4H84 A;  1J7N A;  3ZUK A;  4FXY P;  1G9K A;  2TCL A;  1CGL A;  3LJG A;  4H49 A;  3HDB A;  5L79 A;  1USN A;  2MLS A;  3E8R A;  1ROS A;  1XM5 A;  1OM8 A;  1A85 A;  3MA2 A;  1IAB A;  1A86 A;  5D1S A;  3DNG A;  1KAP P;  1JK3 A;  2V4B A;  4ILW D;  1CK7 A;  1R55 A;  1CAQ A;  3KEC A;  3F17 A;  5CUH A;  5I3M A;  1ATL A;  2MZI A;  3EDI A;  1I76 A;  1BIW A;  1K7I A;  1PWU A; 
#chains in the Genus database with same CATH homology
 2JIH A;  3P24 A;  1R54 A;  3WV1 A;  1I73 A;  3DPE A;  4FU4 A;  3DL1 A;  1HFS A;  2AIG P;  3EDH A;  3K7L A;  4H82 A;  1FM1 A;  1R1J A;  2YIG A;  1XUR A;  4XBH A;  3DPF A;  2DW1 A;  2E3X A;  4A3W A;  1JAO A;  1B3D A;  2USN A;  3I7G A;  3F1A A;  1XUC A;  1HY7 A;  1GO7 P;  1YQY A;  1OS2 A;  1QIA A;  1B8Y A;  1R1I A;  1BKC A;  4ZR5 A;  1UEA A;  2ERQ A;  1QIC A;  1SU3 A;  4PKW A;  2E2D A;  5CZM A;  1S4B P;  5CXA A;  2L0R A;  1GE5 A;  4H3X A;  2Y6C A;  5BOY A;  1O0Q A;  1QUA A;  3TT4 A;  3HY9 A;  1DMT A;  2JSD A;  2QPJ A;  4DF9 A;  1C8T A;  4L6T A;  3LIK A;  2HU6 A;  1AKL A;  4PKQ A;  2CLT A;  3RTS A;  4AXQ A;  3VTG A;  2I47 A;  1XFU A;  2OW9 A;  3HB2 P;  5D3C A;  1FLS A;  2OXU A;  4A7B A;  4FVL A;  1YP1 A;  2W14 A;  1EUB A;  4AIG A;  4XM7 A;  3LJZ A;  5JMY A;  5I12 A;  2XS4 A;  1D5J A;  1BUV M;  4WZV A;  3HYG A;  4JP4 A;  2W15 A;  4GQL A;  3DSL A;  1UMS A;  4I03 A;  5B5P A;  1PWV A;  2N8R A;  3F19 A;  1CQR A;  3V96 B;  5D2B A;  1SAT A;  1D8M A;  3EDG A;  1IAE A;  3BA0 A;  5I2Z A;  4DPE A;  4GF1 A;  4AYK A;  3LQB A;  1BQO A;  2WOA A;  1DTH A;  1Q3A A;  1ZXV A;  4Q1L A;  3EHX A;  1GKC A;  1SLM A;  1HOV A;  2YUF A;  1GXD A;  2X3C A;  456C A;  4HMA A;  1JIW P;  2O36 A;  1MNC A;  1BKC I;  3Q2H A;  3ZVS A;  1JJ9 A;  1AYK A;  966C A;  3ZXH A;  1HV5 A;  2XS3 A;  3VI1 A;  4WK7 A;  4GR0 A;  1QJI A;  1XFY A;  1L6J A;  3LIR A;  1IAA A;  1KUF A;  1ZS0 A;  2X7M A;  1BZS A;  5L7F A;  1GO8 P;  3K7N A;  2OI0 A;  2OY2 A;  1JAP A;  4CTH A;  4XM8 A;  4JA1 A;  2O3E A;  1KUI A;  2JNP A;  5BPA A;  3LUM A;  4WF6 A;  1AF0 A;  3TSK A;  2OXW A;  2WO9 A;  1OM6 A;  2OVZ A;  5H8X A;  4PKT A;  3EWJ A;  2MLR A;  2SRT A;  1K7Q A;  3B8Z A;  3EHY A;  3USN A;  1CIZ A;  2K2G A;  2MZE A;  3KME A;  2X3A A;  1SLN A;  1UMT A;  3OHO A;  4J4M A;  5I4O A;  3AIG A;  2W13 A;  3B92 A;  1CXV A;  4PKR A;  5I43 A;  2W0D A;  4GWN A;  1UTT A;  4XM6 A;  3UVC A;  830C A;  3KHI A;  1IAC A;  3KMC A;  4IJO A;  4HX3 A;  2J83 A;  3LKA A;  1RMZ A;  2PJT A;  1GE6 A;  1MMB A;  2DDY A;  1YCM A;  3KEK A;  4JPA A;  2AYK A;  3HBV P;  4WKE A;  1ZP5 A;  4H2E A;  2FV5 A;  2JT6 A;  1JIZ A;  4ON1 A;  3L0T A;  3O64 A;  3L0V A;  1WNI A;  1I1I P;  4H30 A;  1YOU A;  5I0L A;  3LUN A;  1R1H A;  4JQG A;  3DWB A;  3N2V A;  1ND1 A;  3HBU P;  3F15 A;  3G5C A;  1XUD A;  5BOT A;  2RJQ A;  1C3I A;  1RM8 A;  2DW0 A;  1PWW A;  4PKS A;  4QKZ A;  1FBL A;  1QJJ A;  1SRP A;  1Y8J A;  3DTE A;  3LJT A;  2FV9 A;  2X3B A;  3LE9 A;  2POJ A;  2OW0 A;  1K7G A;  1PWQ A;  3KRY A;  1Y0V A;  1O0T A;  5LAB A;  1D7X A;  4GUY A;  4PKU A;  5D7W A;  3F18 A;  1ZXC A;  4G9L A;  3LGP A;  5B5O A;  1JAN A;  1MMQ A;  2WO8 A;  3AYK A;  4XCT A;  3Q2G A;  4FXQ A;  1XFW A;  4GWM A;  1CGF A;  1ZVX A;  5D1T A;  1MMR A;  1BQQ M;  1JKY A;  3N2U A;  4H76 A;  2YB9 A;  1KUG A;  2OY4 A;  3HDA P;  3CKI A;  1BKC E;  1Z3J A;  1G4K A;  2D1N A;  4WKI A;  1UTZ A;  1SMP A;  2JT5 A;  3GBO A;  4G0D A;  3LEA A;  3I7I A;  3RTT A;  2A8H A;  3F16 A;  4DV8 A;  1XFX A;  2KRJ A;  3LQ0 A;  2ERO A;  4GR3 A;  1HTD A;  4IUW A;  4L19 A;  3TVC A;  1AST A;  3AYU A;  4H1Q A;  1QIB A;  1XFV A;  2MZH A;  1EAK A;  4EFS A;  2OXZ A;  3HY7 A;  2DDF A;  3TS4 A;  2CKI A;  2Z2D A;  3SHI A;  4AUO A;  2K9C A;  3LMC A;  2OZR A;  1PWP A;  2RJP A;  4R3V A;  4DD8 A;  4L63 A;  3EDZ A;  1MMP A;  1JAQ A;  1Y93 A;  2OW2 A;  1G12 A;  4L7A A;  1BM6 A;  1OMJ A;  1XFZ A;  1BUD A;  3ELM A;  3WV3 A;  3DTK A;  5D1U A;  1H71 P;  1JH1 A;  3O2X A;  1C7K A;  3LIL A;  3WV2 A;  3LK8 A;  1D8F A;  1EB6 A;  3U1R A;  1ZTQ A;  3KWV C;  3KEJ A;  2DW2 A;  1KUH A;  2W12 A;  1HFC A;  4IN9 A;  1KBC A;  3DTI A;  2OVX A;  1BSW A;  1OO9 A;  2J0T A;  3P1V A;  3NX7 A;  2ERP A;  3G42 A;  1G05 A;  1IAG A;  1GKD A;  1KUK A;  4JIJ A;  1GE7 A;  1OM7 A;  3OHL A;  1CGE A;  3B2Z A;  1G49 A;  4GR8 A;  2D1O A;  4PKV A;  2Y6D A;  4I35 A;  1OS9 A;  1IAD A;  2OW1 A;  4H84 A;  1J7N A;  3ZUK A;  4FXY P;  1G9K A;  2TCL A;  1CGL A;  3LJG A;  4H49 A;  3HDB A;  5L79 A;  1USN A;  2MLS A;  3E8R A;  1ROS A;  1OM8 A;  1A85 A;  3MA2 A;  1IAB A;  1A86 A;  5D1S A;  3DNG A;  1KAP P;  1JK3 A;  2V4B A;  4ILW D;  1CK7 A;  1R55 A;  1CAQ A;  3KEC A;  3F17 A;  5CUH A;  5I3M A;  1ATL A;  2MZI A;  3EDI A;  1I76 A;  1BIW A;  1K7I A;  1PWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...