3OHOA

Catalytic domain of stromelysin-1 in complex with n-hydroxy-2-(4-methylphenylsulfonamido)acetamide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
167
structure length
159
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANALMYPLYHRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Non-Resonance Raman Difference Spectroscopy as a Tool to Probe Enthalpy-Entropy Compensation and the Interfacial Mobility Model
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 159
sequence length 167
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ohoA00
1KBCA 1JKYA 1IABA 1UTZA 3KRYA 3LILA 3E8RA 1FLSA 1SRPA 1YQYA 4DD8A 1GO8P 3G5CA 4L63A 1FM1A 2JSDA 2D1NA 2MZHA 1BQQM 3EDZA 1BQOA 1JAQA 2W13A 1I76A 3HY9A 1S4BP 2QPJA 4XBHA 3KECA 1MNCA 1ZP5A 1D8MA 3DWBA 2WO8A 4H2EA 5CXAA 3LEAA 1OS2A 1JK3A 1GXDA 1AKLA 5D2BA 1HV5A 5I0LA 1KUFA 3LJGA 3LMCA 2DW1A 2O36A 1OM6A 3EDGA 1XFZA 3BA0A 1IACA 5I43A 1EUBA 3RTTA 1QJIA 1HFSA 3I7GA 4PKUA 3WV3A 1XFWA 1J7NA 3AYUA 4PKQA 1SMPA 5JMYA 1L6JA 2TCLA 2V4BA 1WNIA 3O64A 2W0DA 4ON1A 3N2UA 2W15A 4L19A 3LUNA 4WKEA 3KHIA 1MMBA 4PKTA 2CLTA 1MMPA 4CTHA 4IJOA 3GBOA 4JP4A 2K9CA 1QIBA 4H49A 1CQRA 3DNGA 4H3XA 4GR0A 1SU3A 1USNA 3F19A 1PWQA 2L0RA 3B2ZA 1Y0VA 1XUDA 1G05A 1JAPA 3G42A 2CKIA 1A86A 1R1JA 2YB9A 3F17A 1GE7A 1R1IA 1ROSA 1JIWP 1CXVA 2Y6CA 1XFYA 1O0QA 3L0TA 3LK8A 1BSWA 5B5PA 4L6TA 3KMCA 1CK7A 5B5OA 1EB6A 1IAGA 1UMTA 2XS4A 3EDIA 1SATA 1JJ9A 1IAEA 1ATLA 2OW1A 1G49A 2DDFA 1MMQA 4EFSA 1GKCA 1CGLA 1R1HA 1K7IA 3O2XA 3P1VA 3HDAP 2USNA 2OW2A 1KAPP 4G0DA 5CUHA 5L7FA 2D1OA 4H1QA 3K7NA 1QUAA 3DSLA 3HB2P 4AUOA 2N8RA 2OI0A 2RJPA 2WO9A 2X3BA 2OXWA 2X3AA 2DW2A 1C3IA 4H76A 3TT4A 4FXYP 4H82A 3NX7A 3LGPA 5D3CA 2XS3A 4GR8A 3MA2A 3I7IA 2FV9A 3ZVSA 2PJTA 1ZTQA 1FBLA 1UTTA 4XM6A 3LQ0A 4FXQA 3L0VA 2Y6DA 2KRJA 2E3XA 2HU6A 1ZXCA 1A85A 3Q2HA 4IUWA 3TS4A 1RM8A 830CA 5I3MA 1XFXA 2DDYA 1YOUA 1D5JA 1XUCA 3F18A 2E2DA 2JT6A 2MLSA 4GR3A 3ELMA 3LJTA 1PWPA 1BUDA 4A7BA 4XM7A 4I03A 1BKCE 1QJJA 3EHXA 1G4KA 3KMEA 4HMAA 3VI1A 5D1UA 1R54A 1BUVM 1BM6A 1SLMA 1IADA 3B8ZA 5L79A 1QIAA 3LQBA 4AYKA 1HFCA 1XURA 2X7MA 4GUYA 1G12A 2ERPA 1YCMA 1D8FA 1PWVA 1YP1A 4IN9A 1XFUA 1B3DA 5D1SA 3VTGA 2OW0A 4JPAA 3U1RA 456CA 5I12A 1I1IP 2OVZA 1QICA 2OXUA 5BOTA 1ZS0A 2MZIA 4J4MA 1KUGA 1JANA 1HTDA 3F15A 3SHIA 5D7WA 1ND1A 2O3EA 1O0TA 2OY4A 1R55A 4AXQA 1GE6A 2I47A 3HDBA 4JA1A 5H8XA 1DMTA 2W12A 2X3CA 3LIKA 2A8HA 4GWNA 1KUKA 3CKIA 1I73A 4WK7A 4WZVA 4I35A 4JQGA 3AIGA 3P24A 1BIWA 3WV1A 1ASTA 1BKCI 1KUHA 4PKRA 2DW0A 4PKVA 1B8YA 4FU4A 4H30A 4DPEA 3LE9A 1JIZA 3OHLA 4H84A 2OZRA 1CGFA 3ZXHA 3F1AA 4JIJA 4XM8A 3EWJA 2JIHA 1PWUA 1OM8A 3DPEA 4DF9A 3HY7A 3TVCA 1G9KA 1Z3JA 1BZSA 3F16A 2MZEA 2K2GA 3HBVP 2JT5A 4QKZA 2AIGP 3HYGA 3Q2GA 5LABA 1C8TA 1CGEA 1OO9A 3B92A 3LKAA 1CIZA 2SRTA 1EAKA 2J83A 1DTHA 3AYKA 3DL1A 1Q3AA 1C7KA 1K7GA 2OVXA 1BKCA 1HY7A 1JH1A 5BOYA 2OXZA 2OW9A 1ZXVA 2Z2DA 3N2VA 1XFVA 1IAAA 2J0TA 4HX3A 3HBUP 4AIGA 1AF0A 1GE5A 4R3VA 1GO7P 1UEAA 3WV2A 3TSKA 4G9LA 5I2ZA 4GWMA 2OY2A 4WF6A 3LIRA 3USNA 5D1TA 3RTSA 1OMJA 3ZUKA 4PKSA 1K7QA 3DPFA 4ILWD 4A3WA 1ZVXA 2YIGA 3UVCA 2JNPA 3EDHA 3LJZA 1MMRA 1H71P 2RJQA 966CA 1UMSA 2POJA 3LUMA 2ERQA 4GQLA 4PKWA 5BPAA 2W14A 1Y8JA 3KEJA 3EHYA 4XCTA 4ZR5A 4FVLA 1Y93A 1SLNA 4GF1A 3KWVC 1AYKA 4Q1LA 1PWWA 1OS9A 4DV8A 1KUIA 3V96B 1OM7A 2EROA 1CAQA 3OHOA 5I4OA 4WKIA 3K7LA 2WOAA 1RMZA 1JAOA 5CZMA 1GKDA 2FV5A 2MLRA 1HOVA 1D7XA 3KEKA 2AYKA
chains in the Genus database with same CATH superfamily
1KBCA 1JKYA 1IABA 1UTZA 3KRYA 3LILA 3E8RA 1FLSA 1SRPA 1YQYA 4DD8A 1GO8P 3G5CA 4L63A 1FM1A 2JSDA 2D1NA 2MZHA 1BQQM 3EDZA 1BQOA 1JAQA 2W13A 1I76A 3HY9A 1S4BP 2QPJA 4XBHA 3KECA 1MNCA 1ZP5A 1D8MA 3DWBA 2WO8A 4H2EA 5CXAA 3LEAA 1OS2A 1JK3A 1GXDA 1AKLA 5D2BA 1HV5A 5I0LA 1KUFA 3LJGA 3LMCA 2DW1A 2O36A 1OM6A 3EDGA 1XFZA 3BA0A 1IACA 5I43A 1EUBA 3RTTA 1QJIA 1HFSA 3I7GA 4PKUA 3WV3A 1XFWA 1J7NA 3AYUA 4PKQA 1SMPA 5JMYA 1L6JA 2TCLA 2V4BA 1WNIA 3O64A 2W0DA 4ON1A 3N2UA 2W15A 4L19A 3LUNA 4WKEA 3KHIA 1MMBA 4PKTA 2CLTA 1MMPA 4CTHA 4IJOA 3GBOA 4JP4A 2K9CA 1QIBA 4H49A 1CQRA 3DNGA 4H3XA 4GR0A 1SU3A 1USNA 3F19A 1PWQA 2L0RA 3B2ZA 1Y0VA 1XUDA 1G05A 1JAPA 3G42A 2CKIA 1A86A 1R1JA 2YB9A 3F17A 1GE7A 1R1IA 1ROSA 1JIWP 1CXVA 2Y6CA 1XFYA 1O0QA 3L0TA 3LK8A 1BSWA 5B5PA 4L6TA 3KMCA 3DTKA 1CK7A 5B5OA 1EB6A 1IAGA 1UMTA 2XS4A 3EDIA 1SATA 1JJ9A 1IAEA 1ATLA 2OW1A 1G49A 2DDFA 1MMQA 4EFSA 1GKCA 1CGLA 1R1HA 1K7IA 3O2XA 3P1VA 3HDAP 2USNA 2OW2A 1KAPP 4G0DA 5CUHA 5L7FA 3DTEA 2D1OA 4H1QA 3K7NA 1QUAA 3DSLA 3HB2P 4AUOA 2N8RA 2OI0A 2RJPA 2WO9A 2X3BA 2OXWA 2X3AA 2DW2A 1C3IA 4H76A 3TT4A 4FXYP 4H82A 3NX7A 3LGPA 5D3CA 2XS3A 4GR8A 3MA2A 3I7IA 2FV9A 3ZVSA 2PJTA 1ZTQA 1FBLA 1UTTA 4XM6A 3LQ0A 4FXQA 3L0VA 2Y6DA 2KRJA 2E3XA 2HU6A 1ZXCA 1A85A 3Q2HA 4IUWA 3TS4A 1RM8A 830CA 5I3MA 1XFXA 2DDYA 1XM5A 1YOUA 1D5JA 1XUCA 3F18A 2E2DA 2JT6A 2MLSA 4GR3A 3ELMA 3LJTA 1PWPA 1BUDA 4A7BA 4XM7A 4I03A 1BKCE 1QJJA 3EHXA 1G4KA 3KMEA 4HMAA 3VI1A 5D1UA 1R54A 1BUVM 1BM6A 1SLMA 1IADA 3B8ZA 5L79A 1QIAA 3LQBA 4AYKA 1HFCA 1XURA 2X7MA 4GUYA 1G12A 2ERPA 1YCMA 1D8FA 1PWVA 1YP1A 4IN9A 1XFUA 1B3DA 5D1SA 3VTGA 2OW0A 4JPAA 3U1RA 456CA 5I12A 1I1IP 2OVZA 1QICA 2OXUA 5BOTA 1ZS0A 2MZIA 4J4MA 1KUGA 1JANA 1TVIA 1HTDA 3F15A 3SHIA 5D7WA 1ND1A 2O3EA 1O0TA 2OY4A 1R55A 4AXQA 1GE6A 2I47A 3HDBA 4JA1A 5H8XA 1DMTA 2W12A 2X3CA 3LIKA 2A8HA 4GWNA 1KUKA 3CKIA 1I73A 4WK7A 4WZVA 4I35A 4JQGA 3AIGA 3P24A 1BIWA 3WV1A 1ASTA 1BKCI 1KUHA 4PKRA 2DW0A 4PKVA 1B8YA 4FU4A 4H30A 4DPEA 3LE9A 1JIZA 3OHLA 4H84A 2OZRA 1CGFA 3ZXHA 3F1AA 4JIJA 4XM8A 3EWJA 2JIHA 1PWUA 1OM8A 3DPEA 4DF9A 3HY7A 3TVCA 1G9KA 1Z3JA 1BZSA 3F16A 2MZEA 2K2GA 3HBVP 2JT5A 4QKZA 2AIGP 3HYGA 3Q2GA 5LABA 1C8TA 1CGEA 1OO9A 3B92A 3LKAA 1CIZA 2SRTA 1EAKA 2J83A 1DTHA 3AYKA 3DL1A 1Q3AA 1C7KA 1K7GA 2OVXA 1BKCA 1HY7A 1JH1A 5BOYA 2OXZA 2OW9A 1ZXVA 2Z2DA 3N2VA 1XFVA 1IAAA 2J0TA 4HX3A 4L7AA 3HBUP 1XAXA 4AIGA 1AF0A 1GE5A 4R3VA 1GO7P 1UEAA 3WV2A 3TSKA 4G9LA 5I2ZA 4GWMA 2OY2A 4WF6A 3LIRA 3USNA 5D1TA 3RTSA 1OMJA 3ZUKA 4PKSA 1OZ9A 1K7QA 3DPFA 4ILWD 4A3WA 1ZVXA 3DTIA 2YIGA 3UVCA 2JNPA 3EDHA 3LJZA 1MMRA 1H71P 2RJQA 966CA 1UMSA 2YUFA 2POJA 3LUMA 2ERQA 4GQLA 4PKWA 5BPAA 2W14A 1Y8JA 3KEJA 3EHYA 4XCTA 4ZR5A 4FVLA 1Y93A 1SLNA 4GF1A 3KWVC 1AYKA 4Q1LA 1PWWA 1OS9A 4DV8A 1KUIA 3V96B 1OM7A 2EROA 1CAQA 3OHOA 5I4OA 4WKIA 3K7LA 2WOAA 1RMZA 1JAOA 5CZMA 1GKDA 2FV5A 2MLRA 1HOVA 1D7XA 3KEKA 2AYKA
chains in the Genus database with same CATH topology
1KBCA 1JKYA 1IABA 1UTZA 3KRYA 3LILA 3E8RA 1FLSA 1SRPA 1YQYA 4DD8A 1GO8P 3G5CA 4L63A 1FM1A 2JSDA 2D1NA 2MZHA 1BQQM 3EDZA 1BQOA 1JAQA 2W13A 1I76A 3HY9A 1S4BP 2QPJA 4XBHA 3KECA 1MNCA 1ZP5A 1D8MA 3DWBA 2WO8A 4H2EA 5CXAA 3LEAA 1OS2A 1JK3A 1GXDA 1AKLA 5D2BA 1HV5A 5I0LA 1KUFA 3LJGA 3LMCA 2DW1A 2O36A 1OM6A 3EDGA 1XFZA 3BA0A 1IACA 5I43A 1EUBA 3RTTA 1QJIA 1HFSA 3I7GA 4PKUA 3WV3A 1XFWA 1J7NA 3AYUA 4PKQA 1SMPA 5JMYA 1L6JA 2TCLA 2V4BA 1WNIA 3O64A 2W0DA 4ON1A 3N2UA 2W15A 4L19A 3LUNA 4WKEA 3KHIA 1MMBA 4PKTA 2CLTA 1MMPA 4CTHA 4IJOA 3GBOA 4JP4A 2K9CA 1QIBA 4H49A 1CQRA 3DNGA 4H3XA 4GR0A 1SU3A 1USNA 3F19A 1PWQA 2L0RA 3B2ZA 1Y0VA 1XUDA 1G05A 1JAPA 3G42A 2CKIA 1A86A 1R1JA 2YB9A 3F17A 1GE7A 1R1IA 1ROSA 1JIWP 1CXVA 2Y6CA 1XFYA 1O0QA 3L0TA 3LK8A 1BSWA 5B5PA 4L6TA 3KMCA 3DTKA 1CK7A 5B5OA 1EB6A 1IAGA 1UMTA 2XS4A 3EDIA 1SATA 1JJ9A 1IAEA 1ATLA 2OW1A 1G49A 2DDFA 1MMQA 4EFSA 1GKCA 1CGLA 1R1HA 1K7IA 3O2XA 3P1VA 3HDAP 2USNA 2OW2A 1KAPP 4G0DA 5CUHA 5L7FA 3DTEA 2D1OA 4H1QA 3K7NA 1QUAA 3DSLA 3HB2P 4AUOA 2N8RA 2OI0A 2RJPA 2WO9A 2X3BA 2OXWA 2X3AA 2DW2A 1C3IA 4H76A 3TT4A 4FXYP 4H82A 3NX7A 3LGPA 5D3CA 2XS3A 4GR8A 3MA2A 3I7IA 2FV9A 3ZVSA 2PJTA 1ZTQA 1FBLA 1UTTA 4XM6A 3LQ0A 4FXQA 3L0VA 2Y6DA 2KRJA 2E3XA 2HU6A 1ZXCA 1A85A 3Q2HA 4IUWA 3TS4A 1RM8A 830CA 5I3MA 1XFXA 2DDYA 1YOUA 1D5JA 1XUCA 3F18A 2E2DA 2JT6A 2MLSA 4GR3A 3ELMA 3LJTA 1PWPA 1BUDA 4A7BA 4XM7A 4I03A 1BKCE 1QJJA 3EHXA 1G4KA 3KMEA 4HMAA 3VI1A 5D1UA 1R54A 1BUVM 1BM6A 1SLMA 1IADA 3B8ZA 5L79A 1QIAA 3LQBA 4AYKA 1HFCA 1XURA 2X7MA 4GUYA 1G12A 2ERPA 1YCMA 1D8FA 1PWVA 1YP1A 4IN9A 1XFUA 1B3DA 5D1SA 3VTGA 2OW0A 4JPAA 3U1RA 456CA 5I12A 1I1IP 2OVZA 1QICA 2OXUA 5BOTA 1ZS0A 2MZIA 4J4MA 1KUGA 1JANA 1HTDA 3F15A 3SHIA 5D7WA 1ND1A 2O3EA 1O0TA 2OY4A 1R55A 4AXQA 1GE6A 2I47A 3HDBA 4JA1A 5H8XA 1DMTA 2W12A 2X3CA 3LIKA 2A8HA 4GWNA 1KUKA 3CKIA 1I73A 4WK7A 4WZVA 4I35A 4JQGA 3AIGA 3P24A 1BIWA 3WV1A 1ASTA 1BKCI 1KUHA 4PKRA 2DW0A 4PKVA 1B8YA 4FU4A 4H30A 4DPEA 3LE9A 1JIZA 3OHLA 4H84A 2OZRA 1CGFA 3ZXHA 3F1AA 4JIJA 4XM8A 3EWJA 2JIHA 1PWUA 1OM8A 3DPEA 4DF9A 3HY7A 3TVCA 1G9KA 1Z3JA 1BZSA 3F16A 2MZEA 2K2GA 3HBVP 2JT5A 4QKZA 2AIGP 3HYGA 3Q2GA 5LABA 1C8TA 1CGEA 1OO9A 3B92A 3LKAA 1CIZA 2SRTA 1EAKA 2J83A 1DTHA 3AYKA 3DL1A 1Q3AA 1C7KA 1K7GA 2OVXA 1BKCA 1HY7A 1JH1A 5BOYA 2OXZA 2OW9A 1ZXVA 2Z2DA 3N2VA 1XFVA 1IAAA 2J0TA 4HX3A 4L7AA 3HBUP 4AIGA 1AF0A 1GE5A 4R3VA 1GO7P 1UEAA 3WV2A 3TSKA 4G9LA 5I2ZA 4GWMA 2OY2A 4WF6A 3LIRA 3USNA 5D1TA 3RTSA 1OMJA 3ZUKA 4PKSA 1K7QA 3DPFA 4ILWD 4A3WA 1ZVXA 3DTIA 2YIGA 3UVCA 2JNPA 3EDHA 3LJZA 1MMRA 1H71P 2RJQA 966CA 1UMSA 2YUFA 2POJA 3LUMA 2ERQA 4GQLA 4PKWA 5BPAA 2W14A 1Y8JA 3KEJA 3EHYA 4XCTA 4ZR5A 4FVLA 1Y93A 1SLNA 4GF1A 3KWVC 1AYKA 4Q1LA 1PWWA 1OS9A 4DV8A 1KUIA 3V96B 1OM7A 2EROA 1CAQA 3OHOA 5I4OA 4WKIA 3K7LA 2WOAA 1RMZA 1JAOA 5CZMA 1GKDA 2FV5A 2MLRA 1HOVA 1D7XA 3KEKA 2AYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBC A;  1JKY A;  1IAB A;  1UTZ A;  3KRY A;  3LIL A;  3E8R A;  1FLS A;  1SRP A;  1YQY A;  4DD8 A;  1GO8 P;  3G5C A;  4L63 A;  1FM1 A;  2JSD A;  2D1N A;  2MZH A;  1BQQ M;  3EDZ A;  1BQO A;  1JAQ A;  2W13 A;  1I76 A;  3HY9 A;  1S4B P;  2QPJ A;  4XBH A;  3KEC A;  1MNC A;  1ZP5 A;  1D8M A;  3DWB A;  2WO8 A;  4H2E A;  5CXA A;  3LEA A;  1OS2 A;  1JK3 A;  1GXD A;  1AKL A;  5D2B A;  1HV5 A;  5I0L A;  1KUF A;  3LJG A;  3LMC A;  2DW1 A;  2O36 A;  1OM6 A;  3EDG A;  1XFZ A;  3BA0 A;  1IAC A;  5I43 A;  1EUB A;  3RTT A;  1QJI A;  1HFS A;  3I7G A;  4PKU A;  3WV3 A;  1XFW A;  1J7N A;  3AYU A;  4PKQ A;  1SMP A;  5JMY A;  1L6J A;  2TCL A;  2V4B A;  1WNI A;  3O64 A;  2W0D A;  4ON1 A;  3N2U A;  2W15 A;  4L19 A;  3LUN A;  4WKE A;  3KHI A;  1MMB A;  4PKT A;  2CLT A;  1MMP A;  4CTH A;  4IJO A;  3GBO A;  4JP4 A;  2K9C A;  1QIB A;  4H49 A;  1CQR A;  3DNG A;  4H3X A;  4GR0 A;  1SU3 A;  1USN A;  3F19 A;  1PWQ A;  2L0R A;  3B2Z A;  1Y0V A;  1XUD A;  1G05 A;  1JAP A;  3G42 A;  2CKI A;  1A86 A;  1R1J A;  2YB9 A;  3F17 A;  1GE7 A;  1R1I A;  1ROS A;  1JIW P;  1CXV A;  2Y6C A;  1XFY A;  1O0Q A;  3L0T A;  3LK8 A;  1BSW A;  5B5P A;  4L6T A;  3KMC A;  1CK7 A;  5B5O A;  1EB6 A;  1IAG A;  1UMT A;  2XS4 A;  3EDI A;  1SAT A;  1JJ9 A;  1IAE A;  1ATL A;  2OW1 A;  1G49 A;  2DDF A;  1MMQ A;  4EFS A;  1GKC A;  1CGL A;  1R1H A;  1K7I A;  3O2X A;  3P1V A;  3HDA P;  2USN A;  2OW2 A;  1KAP P;  4G0D A;  5CUH A;  5L7F A;  2D1O A;  4H1Q A;  3K7N A;  1QUA A;  3DSL A;  3HB2 P;  4AUO A;  2N8R A;  2OI0 A;  2RJP A;  2WO9 A;  2X3B A;  2OXW A;  2X3A A;  2DW2 A;  1C3I A;  4H76 A;  3TT4 A;  4FXY P;  4H82 A;  3NX7 A;  3LGP A;  5D3C A;  2XS3 A;  4GR8 A;  3MA2 A;  3I7I A;  2FV9 A;  3ZVS A;  2PJT A;  1ZTQ A;  1FBL A;  1UTT A;  4XM6 A;  3LQ0 A;  4FXQ A;  3L0V A;  2Y6D A;  2KRJ A;  2E3X A;  2HU6 A;  1ZXC A;  1A85 A;  3Q2H A;  4IUW A;  3TS4 A;  1RM8 A;  830C A;  5I3M A;  1XFX A;  2DDY A;  1YOU A;  1D5J A;  1XUC A;  3F18 A;  2E2D A;  2JT6 A;  2MLS A;  4GR3 A;  3ELM A;  3LJT A;  1PWP A;  1BUD A;  4A7B A;  4XM7 A;  4I03 A;  1BKC E;  1QJJ A;  3EHX A;  1G4K A;  3KME A;  4HMA A;  3VI1 A;  5D1U A;  1R54 A;  1BUV M;  1BM6 A;  1SLM A;  1IAD A;  3B8Z A;  5L79 A;  1QIA A;  3LQB A;  4AYK A;  1HFC A;  1XUR A;  2X7M A;  4GUY A;  1G12 A;  2ERP A;  1YCM A;  1D8F A;  1PWV A;  1YP1 A;  4IN9 A;  1XFU A;  1B3D A;  5D1S A;  3VTG A;  2OW0 A;  4JPA A;  3U1R A;  456C A;  5I12 A;  1I1I P;  2OVZ A;  1QIC A;  2OXU A;  5BOT A;  1ZS0 A;  2MZI A;  4J4M A;  1KUG A;  1JAN A;  1HTD A;  3F15 A;  3SHI A;  5D7W A;  1ND1 A;  2O3E A;  1O0T A;  2OY4 A;  1R55 A;  4AXQ A;  1GE6 A;  2I47 A;  3HDB A;  4JA1 A;  5H8X A;  1DMT A;  2W12 A;  2X3C A;  3LIK A;  2A8H A;  4GWN A;  1KUK A;  3CKI A;  1I73 A;  4WK7 A;  4WZV A;  4I35 A;  4JQG A;  3AIG A;  3P24 A;  1BIW A;  3WV1 A;  1AST A;  1BKC I;  1KUH A;  4PKR A;  2DW0 A;  4PKV A;  1B8Y A;  4FU4 A;  4H30 A;  4DPE A;  3LE9 A;  1JIZ A;  3OHL A;  4H84 A;  2OZR A;  1CGF A;  3ZXH A;  3F1A A;  4JIJ A;  4XM8 A;  3EWJ A;  2JIH A;  1PWU A;  1OM8 A;  3DPE A;  4DF9 A;  3HY7 A;  3TVC A;  1G9K A;  1Z3J A;  1BZS A;  3F16 A;  2MZE A;  2K2G A;  3HBV P;  2JT5 A;  4QKZ A;  2AIG P;  3HYG A;  3Q2G A;  5LAB A;  1C8T A;  1CGE A;  1OO9 A;  3B92 A;  3LKA A;  1CIZ A;  2SRT A;  1EAK A;  2J83 A;  1DTH A;  3AYK A;  3DL1 A;  1Q3A A;  1C7K A;  1K7G A;  2OVX A;  1BKC A;  1HY7 A;  1JH1 A;  5BOY A;  2OXZ A;  2OW9 A;  1ZXV A;  2Z2D A;  3N2V A;  1XFV A;  1IAA A;  2J0T A;  4HX3 A;  3HBU P;  4AIG A;  1AF0 A;  1GE5 A;  4R3V A;  1GO7 P;  1UEA A;  3WV2 A;  3TSK A;  4G9L A;  5I2Z A;  4GWM A;  2OY2 A;  4WF6 A;  3LIR A;  3USN A;  5D1T A;  3RTS A;  1OMJ A;  3ZUK A;  4PKS A;  1K7Q A;  3DPF A;  4ILW D;  4A3W A;  1ZVX A;  2YIG A;  3UVC A;  2JNP A;  3EDH A;  3LJZ A;  1MMR A;  1H71 P;  2RJQ A;  966C A;  1UMS A;  2POJ A;  3LUM A;  2ERQ A;  4GQL A;  4PKW A;  5BPA A;  2W14 A;  1Y8J A;  3KEJ A;  3EHY A;  4XCT A;  4ZR5 A;  4FVL A;  1Y93 A;  1SLN A;  4GF1 A;  3KWV C;  1AYK A;  4Q1L A;  1PWW A;  1OS9 A;  4DV8 A;  1KUI A;  3V96 B;  1OM7 A;  2ERO A;  1CAQ A;  3OHO A;  5I4O A;  4WKI A;  3K7L A;  2WOA A;  1RMZ A;  1JAO A;  5CZM A;  1GKD A;  2FV5 A;  2MLR A;  1HOV A;  1D7X A;  3KEK A;  2AYK A; 
#chains in the Genus database with same CATH topology
 1KBC A;  1JKY A;  1IAB A;  1UTZ A;  3KRY A;  3LIL A;  3E8R A;  1FLS A;  1SRP A;  1YQY A;  4DD8 A;  1GO8 P;  3G5C A;  4L63 A;  1FM1 A;  2JSD A;  2D1N A;  2MZH A;  1BQQ M;  3EDZ A;  1BQO A;  1JAQ A;  2W13 A;  1I76 A;  3HY9 A;  1S4B P;  2QPJ A;  4XBH A;  3KEC A;  1MNC A;  1ZP5 A;  1D8M A;  3DWB A;  2WO8 A;  4H2E A;  5CXA A;  3LEA A;  1OS2 A;  1JK3 A;  1GXD A;  1AKL A;  5D2B A;  1HV5 A;  5I0L A;  1KUF A;  3LJG A;  3LMC A;  2DW1 A;  2O36 A;  1OM6 A;  3EDG A;  1XFZ A;  3BA0 A;  1IAC A;  5I43 A;  1EUB A;  3RTT A;  1QJI A;  1HFS A;  3I7G A;  4PKU A;  3WV3 A;  1XFW A;  1J7N A;  3AYU A;  4PKQ A;  1SMP A;  5JMY A;  1L6J A;  2TCL A;  2V4B A;  1WNI A;  3O64 A;  2W0D A;  4ON1 A;  3N2U A;  2W15 A;  4L19 A;  3LUN A;  4WKE A;  3KHI A;  1MMB A;  4PKT A;  2CLT A;  1MMP A;  4CTH A;  4IJO A;  3GBO A;  4JP4 A;  2K9C A;  1QIB A;  4H49 A;  1CQR A;  3DNG A;  4H3X A;  4GR0 A;  1SU3 A;  1USN A;  3F19 A;  1PWQ A;  2L0R A;  3B2Z A;  1Y0V A;  1XUD A;  1G05 A;  1JAP A;  3G42 A;  2CKI A;  1A86 A;  1R1J A;  2YB9 A;  3F17 A;  1GE7 A;  1R1I A;  1ROS A;  1JIW P;  1CXV A;  2Y6C A;  1XFY A;  1O0Q A;  3L0T A;  3LK8 A;  1BSW A;  5B5P A;  4L6T A;  3KMC A;  3DTK A;  1CK7 A;  5B5O A;  1EB6 A;  1IAG A;  1UMT A;  2XS4 A;  3EDI A;  1SAT A;  1JJ9 A;  1IAE A;  1ATL A;  2OW1 A;  1G49 A;  2DDF A;  1MMQ A;  4EFS A;  1GKC A;  1CGL A;  1R1H A;  1K7I A;  3O2X A;  3P1V A;  3HDA P;  2USN A;  2OW2 A;  1KAP P;  4G0D A;  5CUH A;  5L7F A;  3DTE A;  2D1O A;  4H1Q A;  3K7N A;  1QUA A;  3DSL A;  3HB2 P;  4AUO A;  2N8R A;  2OI0 A;  2RJP A;  2WO9 A;  2X3B A;  2OXW A;  2X3A A;  2DW2 A;  1C3I A;  4H76 A;  3TT4 A;  4FXY P;  4H82 A;  3NX7 A;  3LGP A;  5D3C A;  2XS3 A;  4GR8 A;  3MA2 A;  3I7I A;  2FV9 A;  3ZVS A;  2PJT A;  1ZTQ A;  1FBL A;  1UTT A;  4XM6 A;  3LQ0 A;  4FXQ A;  3L0V A;  2Y6D A;  2KRJ A;  2E3X A;  2HU6 A;  1ZXC A;  1A85 A;  3Q2H A;  4IUW A;  3TS4 A;  1RM8 A;  830C A;  5I3M A;  1XFX A;  2DDY A;  1XM5 A;  1YOU A;  1D5J A;  1XUC A;  3F18 A;  2E2D A;  2JT6 A;  2MLS A;  4GR3 A;  3ELM A;  3LJT A;  1PWP A;  1BUD A;  4A7B A;  4XM7 A;  4I03 A;  1BKC E;  1QJJ A;  3EHX A;  1G4K A;  3KME A;  4HMA A;  3VI1 A;  5D1U A;  1R54 A;  1BUV M;  1BM6 A;  1SLM A;  1IAD A;  3B8Z A;  5L79 A;  1QIA A;  3LQB A;  4AYK A;  1HFC A;  1XUR A;  2X7M A;  4GUY A;  1G12 A;  2ERP A;  1YCM A;  1D8F A;  1PWV A;  1YP1 A;  4IN9 A;  1XFU A;  1B3D A;  5D1S A;  3VTG A;  2OW0 A;  4JPA A;  3U1R A;  456C A;  5I12 A;  1I1I P;  2OVZ A;  1QIC A;  2OXU A;  5BOT A;  1ZS0 A;  2MZI A;  4J4M A;  1KUG A;  1JAN A;  1TVI A;  1HTD A;  3F15 A;  3SHI A;  5D7W A;  1ND1 A;  2O3E A;  1O0T A;  2OY4 A;  1R55 A;  4AXQ A;  1GE6 A;  2I47 A;  3HDB A;  4JA1 A;  5H8X A;  1DMT A;  2W12 A;  2X3C A;  3LIK A;  2A8H A;  4GWN A;  1KUK A;  3CKI A;  1I73 A;  4WK7 A;  4WZV A;  4I35 A;  4JQG A;  3AIG A;  3P24 A;  1BIW A;  3WV1 A;  1AST A;  1BKC I;  1KUH A;  4PKR A;  2DW0 A;  4PKV A;  1B8Y A;  4FU4 A;  4H30 A;  4DPE A;  3LE9 A;  1JIZ A;  3OHL A;  4H84 A;  2OZR A;  1CGF A;  3ZXH A;  3F1A A;  4JIJ A;  4XM8 A;  3EWJ A;  2JIH A;  1PWU A;  1OM8 A;  3DPE A;  4DF9 A;  3HY7 A;  3TVC A;  1G9K A;  1Z3J A;  1BZS A;  3F16 A;  2MZE A;  2K2G A;  3HBV P;  2JT5 A;  4QKZ A;  2AIG P;  3HYG A;  3Q2G A;  5LAB A;  1C8T A;  1CGE A;  1OO9 A;  3B92 A;  3LKA A;  1CIZ A;  2SRT A;  1EAK A;  2J83 A;  1DTH A;  3AYK A;  3DL1 A;  1Q3A A;  1C7K A;  1K7G A;  2OVX A;  1BKC A;  1HY7 A;  1JH1 A;  5BOY A;  2OXZ A;  2OW9 A;  1ZXV A;  2Z2D A;  3N2V A;  1XFV A;  1IAA A;  2J0T A;  4HX3 A;  4L7A A;  3HBU P;  1XAX A;  4AIG A;  1AF0 A;  1GE5 A;  4R3V A;  1GO7 P;  1UEA A;  3WV2 A;  3TSK A;  4G9L A;  5I2Z A;  4GWM A;  2OY2 A;  4WF6 A;  3LIR A;  3USN A;  5D1T A;  3RTS A;  1OMJ A;  3ZUK A;  4PKS A;  1OZ9 A;  1K7Q A;  3DPF A;  4ILW D;  4A3W A;  1ZVX A;  3DTI A;  2YIG A;  3UVC A;  2JNP A;  3EDH A;  3LJZ A;  1MMR A;  1H71 P;  2RJQ A;  966C A;  1UMS A;  2YUF A;  2POJ A;  3LUM A;  2ERQ A;  4GQL A;  4PKW A;  5BPA A;  2W14 A;  1Y8J A;  3KEJ A;  3EHY A;  4XCT A;  4ZR5 A;  4FVL A;  1Y93 A;  1SLN A;  4GF1 A;  3KWV C;  1AYK A;  4Q1L A;  1PWW A;  1OS9 A;  4DV8 A;  1KUI A;  3V96 B;  1OM7 A;  2ERO A;  1CAQ A;  3OHO A;  5I4O A;  4WKI A;  3K7L A;  2WOA A;  1RMZ A;  1JAO A;  5CZM A;  1GKD A;  2FV5 A;  2MLR A;  1HOV A;  1D7X A;  3KEK A;  2AYK A; 
#chains in the Genus database with same CATH homology
 1KBC A;  1JKY A;  1IAB A;  1UTZ A;  3KRY A;  3LIL A;  3E8R A;  1FLS A;  1SRP A;  1YQY A;  4DD8 A;  1GO8 P;  3G5C A;  4L63 A;  1FM1 A;  2JSD A;  2D1N A;  2MZH A;  1BQQ M;  3EDZ A;  1BQO A;  1JAQ A;  2W13 A;  1I76 A;  3HY9 A;  1S4B P;  2QPJ A;  4XBH A;  3KEC A;  1MNC A;  1ZP5 A;  1D8M A;  3DWB A;  2WO8 A;  4H2E A;  5CXA A;  3LEA A;  1OS2 A;  1JK3 A;  1GXD A;  1AKL A;  5D2B A;  1HV5 A;  5I0L A;  1KUF A;  3LJG A;  3LMC A;  2DW1 A;  2O36 A;  1OM6 A;  3EDG A;  1XFZ A;  3BA0 A;  1IAC A;  5I43 A;  1EUB A;  3RTT A;  1QJI A;  1HFS A;  3I7G A;  4PKU A;  3WV3 A;  1XFW A;  1J7N A;  3AYU A;  4PKQ A;  1SMP A;  5JMY A;  1L6J A;  2TCL A;  2V4B A;  1WNI A;  3O64 A;  2W0D A;  4ON1 A;  3N2U A;  2W15 A;  4L19 A;  3LUN A;  4WKE A;  3KHI A;  1MMB A;  4PKT A;  2CLT A;  1MMP A;  4CTH A;  4IJO A;  3GBO A;  4JP4 A;  2K9C A;  1QIB A;  4H49 A;  1CQR A;  3DNG A;  4H3X A;  4GR0 A;  1SU3 A;  1USN A;  3F19 A;  1PWQ A;  2L0R A;  3B2Z A;  1Y0V A;  1XUD A;  1G05 A;  1JAP A;  3G42 A;  2CKI A;  1A86 A;  1R1J A;  2YB9 A;  3F17 A;  1GE7 A;  1R1I A;  1ROS A;  1JIW P;  1CXV A;  2Y6C A;  1XFY A;  1O0Q A;  3L0T A;  3LK8 A;  1BSW A;  5B5P A;  4L6T A;  3KMC A;  3DTK A;  1CK7 A;  5B5O A;  1EB6 A;  1IAG A;  1UMT A;  2XS4 A;  3EDI A;  1SAT A;  1JJ9 A;  1IAE A;  1ATL A;  2OW1 A;  1G49 A;  2DDF A;  1MMQ A;  4EFS A;  1GKC A;  1CGL A;  1R1H A;  1K7I A;  3O2X A;  3P1V A;  3HDA P;  2USN A;  2OW2 A;  1KAP P;  4G0D A;  5CUH A;  5L7F A;  3DTE A;  2D1O A;  4H1Q A;  3K7N A;  1QUA A;  3DSL A;  3HB2 P;  4AUO A;  2N8R A;  2OI0 A;  2RJP A;  2WO9 A;  2X3B A;  2OXW A;  2X3A A;  2DW2 A;  1C3I A;  4H76 A;  3TT4 A;  4FXY P;  4H82 A;  3NX7 A;  3LGP A;  5D3C A;  2XS3 A;  4GR8 A;  3MA2 A;  3I7I A;  2FV9 A;  3ZVS A;  2PJT A;  1ZTQ A;  1FBL A;  1UTT A;  4XM6 A;  3LQ0 A;  4FXQ A;  3L0V A;  2Y6D A;  2KRJ A;  2E3X A;  2HU6 A;  1ZXC A;  1A85 A;  3Q2H A;  4IUW A;  3TS4 A;  1RM8 A;  830C A;  5I3M A;  1XFX A;  2DDY A;  1YOU A;  1D5J A;  1XUC A;  3F18 A;  2E2D A;  2JT6 A;  2MLS A;  4GR3 A;  3ELM A;  3LJT A;  1PWP A;  1BUD A;  4A7B A;  4XM7 A;  4I03 A;  1BKC E;  1QJJ A;  3EHX A;  1G4K A;  3KME A;  4HMA A;  3VI1 A;  5D1U A;  1R54 A;  1BUV M;  1BM6 A;  1SLM A;  1IAD A;  3B8Z A;  5L79 A;  1QIA A;  3LQB A;  4AYK A;  1HFC A;  1XUR A;  2X7M A;  4GUY A;  1G12 A;  2ERP A;  1YCM A;  1D8F A;  1PWV A;  1YP1 A;  4IN9 A;  1XFU A;  1B3D A;  5D1S A;  3VTG A;  2OW0 A;  4JPA A;  3U1R A;  456C A;  5I12 A;  1I1I P;  2OVZ A;  1QIC A;  2OXU A;  5BOT A;  1ZS0 A;  2MZI A;  4J4M A;  1KUG A;  1JAN A;  1HTD A;  3F15 A;  3SHI A;  5D7W A;  1ND1 A;  2O3E A;  1O0T A;  2OY4 A;  1R55 A;  4AXQ A;  1GE6 A;  2I47 A;  3HDB A;  4JA1 A;  5H8X A;  1DMT A;  2W12 A;  2X3C A;  3LIK A;  2A8H A;  4GWN A;  1KUK A;  3CKI A;  1I73 A;  4WK7 A;  4WZV A;  4I35 A;  4JQG A;  3AIG A;  3P24 A;  1BIW A;  3WV1 A;  1AST A;  1BKC I;  1KUH A;  4PKR A;  2DW0 A;  4PKV A;  1B8Y A;  4FU4 A;  4H30 A;  4DPE A;  3LE9 A;  1JIZ A;  3OHL A;  4H84 A;  2OZR A;  1CGF A;  3ZXH A;  3F1A A;  4JIJ A;  4XM8 A;  3EWJ A;  2JIH A;  1PWU A;  1OM8 A;  3DPE A;  4DF9 A;  3HY7 A;  3TVC A;  1G9K A;  1Z3J A;  1BZS A;  3F16 A;  2MZE A;  2K2G A;  3HBV P;  2JT5 A;  4QKZ A;  2AIG P;  3HYG A;  3Q2G A;  5LAB A;  1C8T A;  1CGE A;  1OO9 A;  3B92 A;  3LKA A;  1CIZ A;  2SRT A;  1EAK A;  2J83 A;  1DTH A;  3AYK A;  3DL1 A;  1Q3A A;  1C7K A;  1K7G A;  2OVX A;  1BKC A;  1HY7 A;  1JH1 A;  5BOY A;  2OXZ A;  2OW9 A;  1ZXV A;  2Z2D A;  3N2V A;  1XFV A;  1IAA A;  2J0T A;  4HX3 A;  4L7A A;  3HBU P;  4AIG A;  1AF0 A;  1GE5 A;  4R3V A;  1GO7 P;  1UEA A;  3WV2 A;  3TSK A;  4G9L A;  5I2Z A;  4GWM A;  2OY2 A;  4WF6 A;  3LIR A;  3USN A;  5D1T A;  3RTS A;  1OMJ A;  3ZUK A;  4PKS A;  1K7Q A;  3DPF A;  4ILW D;  4A3W A;  1ZVX A;  3DTI A;  2YIG A;  3UVC A;  2JNP A;  3EDH A;  3LJZ A;  1MMR A;  1H71 P;  2RJQ A;  966C A;  1UMS A;  2YUF A;  2POJ A;  3LUM A;  2ERQ A;  4GQL A;  4PKW A;  5BPA A;  2W14 A;  1Y8J A;  3KEJ A;  3EHY A;  4XCT A;  4ZR5 A;  4FVL A;  1Y93 A;  1SLN A;  4GF1 A;  3KWV C;  1AYK A;  4Q1L A;  1PWW A;  1OS9 A;  4DV8 A;  1KUI A;  3V96 B;  1OM7 A;  2ERO A;  1CAQ A;  3OHO A;  5I4O A;  4WKI A;  3K7L A;  2WOA A;  1RMZ A;  1JAO A;  5CZM A;  1GKD A;  2FV5 A;  2MLR A;  1HOV A;  1D7X A;  3KEK A;  2AYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...