1USNA

Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with thiadiazole inhibitor pnu-142372
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
164
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTALMYPLYHSLTDLTRFRLSQDDINGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STROMELYSIN-1
publication title Structural characterizations of nonpeptidic thiadiazole inhibitors of matrix metalloproteinases reveal the basis for stromelysin selectivity.
pubmed rcsb
source organism Homo sapiens
total genus 45
structure length 164
sequence length 165
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1usnA00
4DD8A 1DMTA 1QJJA 1JANA 1BQQM 2DDFA 1R1HA 4L19A 2OY2A 3KMEA 1JJ9A 1ZTQA 2OXZA 2POJA 4XBHA 1Y8JA 2W13A 3DNGA 2OZRA 4ZR5A 1HV5A 2OW1A 3TVCA 3LGPA 2V4BA 3F19A 3DPEA 1YCMA 2DW1A 1MMQA 3KHIA 3CKIA 4XM7A 3B92A 1QJIA 2JSDA 2QPJA 2ERPA 4JPAA 4GF1A 4FU4A 1OM6A 4G9LA 3LMCA 2Z2DA 4FXYP 1AF0A 1PWPA 3TS4A 3EHXA 1SRPA 2CLTA 1BKCA 4J4MA 4AYKA 5CUHA 3LUNA 5D1SA 3WV3A 5LABA 2N8RA 4G0DA 1JIWP 3LJZA 4GWNA 1PWUA 1S4BP 1BM6A 4PKSA 3TT4A 4GQLA 1ASTA 1R1IA 2OVXA 2X7MA 4R3VA 3P1VA 1MMPA 1CK7A 4XM8A 1IACA 1A86A 5B5PA 2K2GA 2WO9A 3F1AA 3LE9A 2MZIA 1CIZA 2YB9A 4JA1A 3V96B 1AKLA 1B8YA 1A85A 3Q2GA 2W15A 2FV5A 1Z3JA 4H2EA 3KEKA 1K7GA 3WV2A 2E2DA 1C3IA 3AYKA 3F16A 1FBLA 3DWBA 2MLSA 5L7FA 1HFCA 1ND1A 1ATLA 3L0VA 2CKIA 1JH1A 3HDAP 3HDBA 3MA2A 2USNA 1J7NA 4FXQA 1I76A 2DDYA 1CGFA 5I12A 2JT6A 3F18A 4PKWA 1OM7A 3LJTA 3USNA 3LUMA 4H76A 2Y6CA 1HFSA 3KRYA 5JMYA 1Y93A 830CA 4PKQA 2E3XA 3E8RA 5H8XA 1CGLA 3LKAA 3OHOA 3NX7A 4ILWD 2JT5A 1OO9A 1GE5A 1JIZA 3DSLA 1ZXVA 4PKRA 4JP4A 1OM8A 1BSWA 1SLNA 5I2ZA 1QICA 4QKZA 4PKVA 4GR8A 5BPAA 3ZXHA 1G05A 1HOVA 1KUGA 4H82A 5I3MA 1QIAA 1SATA 2OVZA 3L0TA 3KEJA 4L6TA 2OI0A 1SLMA 2W0DA 2Y6DA 1JKYA 1PWWA 3Q2HA 4JIJA 3U1RA 2OW2A 2WO8A 2J83A 3UVCA 5I43A 2XS4A 1L6JA 2K9CA 1USNA 3EDGA 3HY7A 1B3DA 1SMPA 1BIWA 4EFSA 4IN9A 1EUBA 3HY9A 1GE7A 1YP1A 3ZVSA 1R54A 2JIHA 2I47A 1ROSA 1D5JA 5BOTA 1D7XA 4Q1LA 456CA 4AXQA 1FLSA 2ERQA 2DW2A 4A7BA 4CTHA 5CZMA 2D1OA 3N2UA 4GR0A 4H3XA 3G5CA 3LIKA 2SRTA 3P24A 1IABA 2YIGA 1FM1A 1CXVA 2OW0A 1D8FA 1K7QA 1XFVA 3DL1A 1OMJA 2X3CA 1JAPA 2JNPA 5L79A 1GO8P 4A3WA 4H84A 4H49A 2HU6A 3RTSA 1I1IP 3B8ZA 1KBCA 1KUIA 1IAGA 1MMBA 1HTDA 1I73A 3LQ0A 4DF9A 2XS3A 1BKCE 4GUYA 1R1JA 1C7KA 4FVLA 3I7IA 3BA0A 2O36A 4PKTA 4DV8A 4IUWA 2AIGP 3KMCA 1WNIA 2FV9A 1CQRA 2RJPA 3HB2P 1Q3AA 1QUAA 1XFWA 2MZEA 2L0RA 1SU3A 3WV1A 2D1NA 1XFXA 3OHLA 1AYKA 2X3BA 1C8TA 2J0TA 3B2ZA 1G9KA 1XFUA 1CGEA 2O3EA 1YOUA 1G4KA 4L63A 3LK8A 1RMZA 5CXAA 3O64A 1KUFA 1XFZA 5D3CA 1OS9A 1EB6A 4ON1A 2TCLA 2WOAA 1JAOA 2AYKA 1ZS0A 1Y0VA 3I7GA 3GBOA 1UEAA 1MNCA 1IAEA 1XFYA 1CAQA 1KUHA 3HBUP 1KUKA 4AUOA 4GR3A 1HY7A 2W14A 3O2XA 3LJGA 1XUCA 1BKCI 1UTZA 3N2VA 1UMTA 2A8HA 3TSKA 966CA 3G42A 1YQYA 1OS2A 3K7LA 4H30A 3AYUA 4WKIA 2KRJA 1KAPP 1BQOA 2OY4A 2MZHA 4XCTA 4GWMA 4DPEA 3DPFA 5BOYA 1RM8A 3LILA 1PWVA 1BUDA 1XUDA 3EWJA 1XURA 1ZXCA 1QIBA 1H71P 1O0TA 2OXWA 4WF6A 3SHIA 1DTHA 5D1UA 2MLRA 1G12A 3EDZA 5I4OA 1GE6A 3K7NA 1GKDA 5D1TA 1GKCA 4IJOA 1ZVXA 2OW9A 4WKEA 3LIRA 5I0LA 1UTTA 3RTTA 2RJQA 2X3AA 1JK3A 3HYGA 3KWVC 3LQBA 4I03A 2DW0A 3EDIA 3F15A 1GXDA 1O0QA 1BUVM 2OXUA 4WK7A 1JAQA 1ZP5A 1G49A 1K7IA 3EDHA 1D8MA 3KECA 3ZUKA 4PKUA 4AIGA 2PJTA 1IAAA 1EAKA 3EHYA 4H1QA 3LEAA 4JQGA 2W12A 1BZSA 5D2BA 4HMAA 4I35A 1UMSA 3F17A 2EROA 1IADA 1MMRA 3VTGA 5D7WA 3AIGA 3VI1A 4HX3A 4XM6A 3HBVP 1GO7P 1PWQA 5B5OA 3ELMA 4WZVA 1R55A
chains in the Genus database with same CATH superfamily
4DD8A 1DMTA 1QJJA 1JANA 1BQQM 2DDFA 1R1HA 4L19A 2OY2A 3KMEA 1JJ9A 1ZTQA 2OXZA 2POJA 4XBHA 1Y8JA 2W13A 3DNGA 2OZRA 4ZR5A 1HV5A 2OW1A 3TVCA 3LGPA 2V4BA 2YUFA 3F19A 3DPEA 1YCMA 2DW1A 1MMQA 3KHIA 3CKIA 4XM7A 3B92A 1QJIA 2JSDA 2QPJA 2ERPA 4JPAA 4GF1A 4FU4A 1OM6A 4G9LA 3LMCA 2Z2DA 4FXYP 1AF0A 1PWPA 3TS4A 3EHXA 1SRPA 2CLTA 1BKCA 4J4MA 4AYKA 5CUHA 3LUNA 5D1SA 3WV3A 5LABA 2N8RA 4G0DA 1JIWP 3LJZA 4GWNA 1PWUA 1S4BP 1BM6A 1OZ9A 4PKSA 3TT4A 4GQLA 1ASTA 1R1IA 2OVXA 2X7MA 4R3VA 3P1VA 1MMPA 1CK7A 4XM8A 1IACA 1A86A 5B5PA 2K2GA 2WO9A 3F1AA 3LE9A 1TVIA 1CIZA 2MZIA 2YB9A 4JA1A 3V96B 1AKLA 1B8YA 1A85A 3Q2GA 2W15A 2FV5A 1Z3JA 4H2EA 3KEKA 1K7GA 3WV2A 2E2DA 1C3IA 3AYKA 3F16A 1FBLA 3DWBA 2MLSA 5L7FA 1HFCA 1ND1A 1ATLA 3L0VA 2CKIA 1JH1A 3HDAP 3HDBA 3MA2A 2USNA 1J7NA 4FXQA 1I76A 2DDYA 1CGFA 5I12A 2JT6A 3F18A 4PKWA 1OM7A 3LJTA 3USNA 3LUMA 4H76A 2Y6CA 1HFSA 3KRYA 5JMYA 1Y93A 830CA 4PKQA 2E3XA 3E8RA 5H8XA 1CGLA 3LKAA 3OHOA 3NX7A 4ILWD 2JT5A 1OO9A 1GE5A 1JIZA 3DSLA 1ZXVA 4PKRA 4JP4A 1OM8A 1BSWA 1SLNA 5I2ZA 1QICA 4QKZA 4PKVA 4GR8A 5BPAA 3ZXHA 1G05A 1HOVA 1KUGA 4H82A 5I3MA 1QIAA 1SATA 2OVZA 3L0TA 3KEJA 4L6TA 2OI0A 1SLMA 2W0DA 2Y6DA 1JKYA 1PWWA 3Q2HA 4JIJA 3U1RA 2OW2A 2WO8A 2J83A 3UVCA 5I43A 2XS4A 1L6JA 2K9CA 1USNA 3EDGA 3HY7A 1B3DA 1SMPA 1BIWA 4EFSA 3DTKA 4IN9A 1EUBA 3HY9A 1GE7A 1YP1A 3ZVSA 1R54A 2JIHA 2I47A 1ROSA 1D5JA 5BOTA 1D7XA 4Q1LA 456CA 4AXQA 1FLSA 2ERQA 2DW2A 4A7BA 4CTHA 5CZMA 2D1OA 3N2UA 4GR0A 4H3XA 3G5CA 3LIKA 2SRTA 3P24A 1IABA 2YIGA 1FM1A 1CXVA 2OW0A 1D8FA 1XAXA 1K7QA 1XFVA 3DL1A 1OMJA 2X3CA 1JAPA 2JNPA 5L79A 1GO8P 4A3WA 4H84A 4H49A 2HU6A 3RTSA 1I1IP 3B8ZA 1KBCA 1KUIA 1IAGA 1MMBA 1HTDA 1I73A 3LQ0A 4DF9A 2XS3A 1BKCE 4GUYA 1R1JA 1C7KA 4FVLA 3I7IA 3BA0A 2O36A 4PKTA 4DV8A 4IUWA 2AIGP 3KMCA 1WNIA 2FV9A 1CQRA 2RJPA 3HB2P 1Q3AA 1QUAA 1XFWA 2MZEA 2L0RA 1SU3A 3WV1A 2D1NA 1XFXA 3OHLA 1AYKA 2X3BA 1C8TA 2J0TA 3B2ZA 1G9KA 1XFUA 1CGEA 2O3EA 1YOUA 1G4KA 4L63A 1XM5A 3LK8A 1RMZA 5CXAA 3O64A 1KUFA 1XFZA 5D3CA 1OS9A 1EB6A 4ON1A 2TCLA 2WOAA 1JAOA 2AYKA 1ZS0A 1Y0VA 3I7GA 3GBOA 1UEAA 1MNCA 1IAEA 1XFYA 1CAQA 1KUHA 3HBUP 1KUKA 3DTEA 4AUOA 4GR3A 1HY7A 2W14A 3O2XA 3LJGA 1XUCA 1BKCI 1UTZA 3N2VA 1UMTA 2A8HA 3TSKA 966CA 3G42A 1YQYA 1OS2A 3K7LA 4H30A 3AYUA 4WKIA 2KRJA 1KAPP 1BQOA 2OY4A 2MZHA 4XCTA 4GWMA 4DPEA 3DPFA 5BOYA 1RM8A 3LILA 1PWVA 1BUDA 1XUDA 3EWJA 1XURA 1ZXCA 1QIBA 1H71P 1O0TA 2OXWA 4WF6A 3SHIA 1DTHA 5D1UA 2MLRA 1G12A 3EDZA 5I4OA 1GE6A 3K7NA 1GKDA 5D1TA 1GKCA 4IJOA 1ZVXA 2OW9A 4WKEA 3LIRA 5I0LA 1UTTA 3RTTA 2RJQA 2X3AA 1JK3A 3HYGA 3KWVC 3LQBA 4I03A 2DW0A 3EDIA 3F15A 1GXDA 1O0QA 1BUVM 2OXUA 3DTIA 4WK7A 1JAQA 1ZP5A 1G49A 1K7IA 3EDHA 1D8MA 3KECA 3ZUKA 4PKUA 4AIGA 2PJTA 1IAAA 1EAKA 3EHYA 4H1QA 3LEAA 4JQGA 2W12A 1BZSA 5D2BA 4HMAA 4I35A 1UMSA 3F17A 2EROA 1IADA 1MMRA 3VTGA 5D7WA 3AIGA 4L7AA 3VI1A 4HX3A 4XM6A 3HBVP 1GO7P 1PWQA 5B5OA 3ELMA 4WZVA 1R55A
chains in the Genus database with same CATH topology
4DD8A 1DMTA 1QJJA 1JANA 1BQQM 2DDFA 1R1HA 4L19A 2OY2A 3KMEA 1JJ9A 1ZTQA 2OXZA 2POJA 4XBHA 1Y8JA 2W13A 3DNGA 2OZRA 4ZR5A 1HV5A 2OW1A 3TVCA 3LGPA 2V4BA 2YUFA 3F19A 3DPEA 1YCMA 2DW1A 1MMQA 3KHIA 3CKIA 4XM7A 3B92A 1QJIA 2JSDA 2QPJA 2ERPA 4JPAA 4GF1A 4FU4A 1OM6A 4G9LA 3LMCA 2Z2DA 4FXYP 1AF0A 1PWPA 3TS4A 3EHXA 1SRPA 2CLTA 1BKCA 4J4MA 4AYKA 5CUHA 3LUNA 5D1SA 3WV3A 5LABA 2N8RA 4G0DA 1JIWP 3LJZA 4GWNA 1PWUA 1S4BP 1BM6A 4PKSA 3TT4A 4GQLA 1ASTA 1R1IA 2OVXA 2X7MA 4R3VA 3P1VA 1MMPA 1CK7A 4XM8A 1IACA 1A86A 5B5PA 2K2GA 2WO9A 3F1AA 3LE9A 2MZIA 1CIZA 2YB9A 4JA1A 3V96B 1AKLA 1B8YA 1A85A 3Q2GA 2W15A 2FV5A 1Z3JA 4H2EA 3KEKA 1K7GA 3WV2A 2E2DA 1C3IA 3AYKA 3F16A 1FBLA 3DWBA 2MLSA 5L7FA 1HFCA 1ND1A 1ATLA 3L0VA 2CKIA 1JH1A 3HDAP 3HDBA 3MA2A 2USNA 1J7NA 4FXQA 1I76A 2DDYA 1CGFA 5I12A 2JT6A 3F18A 4PKWA 1OM7A 3LJTA 3USNA 3LUMA 4H76A 2Y6CA 1HFSA 3KRYA 5JMYA 1Y93A 830CA 4PKQA 2E3XA 3E8RA 5H8XA 1CGLA 3LKAA 3OHOA 3NX7A 4ILWD 2JT5A 1OO9A 1GE5A 1JIZA 3DSLA 1ZXVA 4PKRA 4JP4A 1OM8A 1BSWA 1SLNA 5I2ZA 1QICA 4QKZA 4PKVA 4GR8A 5BPAA 3ZXHA 1G05A 1HOVA 1KUGA 4H82A 5I3MA 1QIAA 1SATA 2OVZA 3L0TA 3KEJA 4L6TA 2OI0A 1SLMA 2W0DA 2Y6DA 1JKYA 1PWWA 3Q2HA 4JIJA 3U1RA 2OW2A 2WO8A 2J83A 3UVCA 5I43A 2XS4A 1L6JA 2K9CA 1USNA 3EDGA 3HY7A 1B3DA 1SMPA 1BIWA 4EFSA 3DTKA 4IN9A 1EUBA 3HY9A 1GE7A 1YP1A 3ZVSA 1R54A 2JIHA 2I47A 1ROSA 1D5JA 5BOTA 1D7XA 4Q1LA 456CA 4AXQA 1FLSA 2ERQA 2DW2A 4A7BA 4CTHA 5CZMA 2D1OA 3N2UA 4GR0A 4H3XA 3G5CA 3LIKA 2SRTA 3P24A 1IABA 2YIGA 1FM1A 1CXVA 2OW0A 1D8FA 1K7QA 1XFVA 3DL1A 1OMJA 2X3CA 1JAPA 2JNPA 5L79A 1GO8P 4A3WA 4H84A 4H49A 2HU6A 3RTSA 1I1IP 3B8ZA 1KBCA 1KUIA 1IAGA 1MMBA 1HTDA 1I73A 3LQ0A 4DF9A 2XS3A 1BKCE 4GUYA 1R1JA 1C7KA 4FVLA 3I7IA 3BA0A 2O36A 4PKTA 4DV8A 4IUWA 2AIGP 3KMCA 1WNIA 2FV9A 1CQRA 2RJPA 3HB2P 1Q3AA 1QUAA 1XFWA 2MZEA 2L0RA 1SU3A 3WV1A 2D1NA 1XFXA 3OHLA 1AYKA 2X3BA 1C8TA 2J0TA 3B2ZA 1G9KA 1XFUA 1CGEA 2O3EA 1YOUA 1G4KA 4L63A 3LK8A 1RMZA 5CXAA 3O64A 1KUFA 1XFZA 5D3CA 1OS9A 1EB6A 4ON1A 2TCLA 2WOAA 1JAOA 2AYKA 1ZS0A 1Y0VA 3I7GA 3GBOA 1UEAA 1MNCA 1IAEA 1XFYA 1CAQA 1KUHA 3HBUP 1KUKA 3DTEA 4AUOA 4GR3A 1HY7A 2W14A 3O2XA 3LJGA 1XUCA 1BKCI 1UTZA 3N2VA 1UMTA 2A8HA 3TSKA 966CA 3G42A 1YQYA 1OS2A 3K7LA 4H30A 3AYUA 4WKIA 2KRJA 1KAPP 1BQOA 2OY4A 2MZHA 4XCTA 4GWMA 4DPEA 3DPFA 5BOYA 1RM8A 3LILA 1PWVA 1BUDA 1XUDA 3EWJA 1XURA 1ZXCA 1QIBA 1H71P 1O0TA 2OXWA 4WF6A 3SHIA 1DTHA 5D1UA 2MLRA 1G12A 3EDZA 5I4OA 1GE6A 3K7NA 1GKDA 5D1TA 1GKCA 4IJOA 1ZVXA 2OW9A 4WKEA 3LIRA 5I0LA 1UTTA 3RTTA 2RJQA 2X3AA 1JK3A 3HYGA 3KWVC 3LQBA 4I03A 2DW0A 3EDIA 3F15A 1GXDA 1O0QA 1BUVM 2OXUA 3DTIA 4WK7A 1JAQA 1ZP5A 1G49A 1K7IA 3EDHA 1D8MA 3KECA 3ZUKA 4PKUA 4AIGA 2PJTA 1IAAA 1EAKA 3EHYA 4H1QA 3LEAA 4JQGA 2W12A 1BZSA 5D2BA 4HMAA 4I35A 1UMSA 3F17A 2EROA 1IADA 1MMRA 3VTGA 5D7WA 3AIGA 4L7AA 3VI1A 4HX3A 4XM6A 3HBVP 1GO7P 1PWQA 5B5OA 3ELMA 4WZVA 1R55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DD8 A;  1DMT A;  1QJJ A;  1JAN A;  1BQQ M;  2DDF A;  1R1H A;  4L19 A;  2OY2 A;  3KME A;  1JJ9 A;  1ZTQ A;  2OXZ A;  2POJ A;  4XBH A;  1Y8J A;  2W13 A;  3DNG A;  2OZR A;  4ZR5 A;  1HV5 A;  2OW1 A;  3TVC A;  3LGP A;  2V4B A;  3F19 A;  3DPE A;  1YCM A;  2DW1 A;  1MMQ A;  3KHI A;  3CKI A;  4XM7 A;  3B92 A;  1QJI A;  2JSD A;  2QPJ A;  2ERP A;  4JPA A;  4GF1 A;  4FU4 A;  1OM6 A;  4G9L A;  3LMC A;  2Z2D A;  4FXY P;  1AF0 A;  1PWP A;  3TS4 A;  3EHX A;  1SRP A;  2CLT A;  1BKC A;  4J4M A;  4AYK A;  5CUH A;  3LUN A;  5D1S A;  3WV3 A;  5LAB A;  2N8R A;  4G0D A;  1JIW P;  3LJZ A;  4GWN A;  1PWU A;  1S4B P;  1BM6 A;  4PKS A;  3TT4 A;  4GQL A;  1AST A;  1R1I A;  2OVX A;  2X7M A;  4R3V A;  3P1V A;  1MMP A;  1CK7 A;  4XM8 A;  1IAC A;  1A86 A;  5B5P A;  2K2G A;  2WO9 A;  3F1A A;  3LE9 A;  2MZI A;  1CIZ A;  2YB9 A;  4JA1 A;  3V96 B;  1AKL A;  1B8Y A;  1A85 A;  3Q2G A;  2W15 A;  2FV5 A;  1Z3J A;  4H2E A;  3KEK A;  1K7G A;  3WV2 A;  2E2D A;  1C3I A;  3AYK A;  3F16 A;  1FBL A;  3DWB A;  2MLS A;  5L7F A;  1HFC A;  1ND1 A;  1ATL A;  3L0V A;  2CKI A;  1JH1 A;  3HDA P;  3HDB A;  3MA2 A;  2USN A;  1J7N A;  4FXQ A;  1I76 A;  2DDY A;  1CGF A;  5I12 A;  2JT6 A;  3F18 A;  4PKW A;  1OM7 A;  3LJT A;  3USN A;  3LUM A;  4H76 A;  2Y6C A;  1HFS A;  3KRY A;  5JMY A;  1Y93 A;  830C A;  4PKQ A;  2E3X A;  3E8R A;  5H8X A;  1CGL A;  3LKA A;  3OHO A;  3NX7 A;  4ILW D;  2JT5 A;  1OO9 A;  1GE5 A;  1JIZ A;  3DSL A;  1ZXV A;  4PKR A;  4JP4 A;  1OM8 A;  1BSW A;  1SLN A;  5I2Z A;  1QIC A;  4QKZ A;  4PKV A;  4GR8 A;  5BPA A;  3ZXH A;  1G05 A;  1HOV A;  1KUG A;  4H82 A;  5I3M A;  1QIA A;  1SAT A;  2OVZ A;  3L0T A;  3KEJ A;  4L6T A;  2OI0 A;  1SLM A;  2W0D A;  2Y6D A;  1JKY A;  1PWW A;  3Q2H A;  4JIJ A;  3U1R A;  2OW2 A;  2WO8 A;  2J83 A;  3UVC A;  5I43 A;  2XS4 A;  1L6J A;  2K9C A;  1USN A;  3EDG A;  3HY7 A;  1B3D A;  1SMP A;  1BIW A;  4EFS A;  4IN9 A;  1EUB A;  3HY9 A;  1GE7 A;  1YP1 A;  3ZVS A;  1R54 A;  2JIH A;  2I47 A;  1ROS A;  1D5J A;  5BOT A;  1D7X A;  4Q1L A;  456C A;  4AXQ A;  1FLS A;  2ERQ A;  2DW2 A;  4A7B A;  4CTH A;  5CZM A;  2D1O A;  3N2U A;  4GR0 A;  4H3X A;  3G5C A;  3LIK A;  2SRT A;  3P24 A;  1IAB A;  2YIG A;  1FM1 A;  1CXV A;  2OW0 A;  1D8F A;  1K7Q A;  1XFV A;  3DL1 A;  1OMJ A;  2X3C A;  1JAP A;  2JNP A;  5L79 A;  1GO8 P;  4A3W A;  4H84 A;  4H49 A;  2HU6 A;  3RTS A;  1I1I P;  3B8Z A;  1KBC A;  1KUI A;  1IAG A;  1MMB A;  1HTD A;  1I73 A;  3LQ0 A;  4DF9 A;  2XS3 A;  1BKC E;  4GUY A;  1R1J A;  1C7K A;  4FVL A;  3I7I A;  3BA0 A;  2O36 A;  4PKT A;  4DV8 A;  4IUW A;  2AIG P;  3KMC A;  1WNI A;  2FV9 A;  1CQR A;  2RJP A;  3HB2 P;  1Q3A A;  1QUA A;  1XFW A;  2MZE A;  2L0R A;  1SU3 A;  3WV1 A;  2D1N A;  1XFX A;  3OHL A;  1AYK A;  2X3B A;  1C8T A;  2J0T A;  3B2Z A;  1G9K A;  1XFU A;  1CGE A;  2O3E A;  1YOU A;  1G4K A;  4L63 A;  3LK8 A;  1RMZ A;  5CXA A;  3O64 A;  1KUF A;  1XFZ A;  5D3C A;  1OS9 A;  1EB6 A;  4ON1 A;  2TCL A;  2WOA A;  1JAO A;  2AYK A;  1ZS0 A;  1Y0V A;  3I7G A;  3GBO A;  1UEA A;  1MNC A;  1IAE A;  1XFY A;  1CAQ A;  1KUH A;  3HBU P;  1KUK A;  4AUO A;  4GR3 A;  1HY7 A;  2W14 A;  3O2X A;  3LJG A;  1XUC A;  1BKC I;  1UTZ A;  3N2V A;  1UMT A;  2A8H A;  3TSK A;  966C A;  3G42 A;  1YQY A;  1OS2 A;  3K7L A;  4H30 A;  3AYU A;  4WKI A;  2KRJ A;  1KAP P;  1BQO A;  2OY4 A;  2MZH A;  4XCT A;  4GWM A;  4DPE A;  3DPF A;  5BOY A;  1RM8 A;  3LIL A;  1PWV A;  1BUD A;  1XUD A;  3EWJ A;  1XUR A;  1ZXC A;  1QIB A;  1H71 P;  1O0T A;  2OXW A;  4WF6 A;  3SHI A;  1DTH A;  5D1U A;  2MLR A;  1G12 A;  3EDZ A;  5I4O A;  1GE6 A;  3K7N A;  1GKD A;  5D1T A;  1GKC A;  4IJO A;  1ZVX A;  2OW9 A;  4WKE A;  3LIR A;  5I0L A;  1UTT A;  3RTT A;  2RJQ A;  2X3A A;  1JK3 A;  3HYG A;  3KWV C;  3LQB A;  4I03 A;  2DW0 A;  3EDI A;  3F15 A;  1GXD A;  1O0Q A;  1BUV M;  2OXU A;  4WK7 A;  1JAQ A;  1ZP5 A;  1G49 A;  1K7I A;  3EDH A;  1D8M A;  3KEC A;  3ZUK A;  4PKU A;  4AIG A;  2PJT A;  1IAA A;  1EAK A;  3EHY A;  4H1Q A;  3LEA A;  4JQG A;  2W12 A;  1BZS A;  5D2B A;  4HMA A;  4I35 A;  1UMS A;  3F17 A;  2ERO A;  1IAD A;  1MMR A;  3VTG A;  5D7W A;  3AIG A;  3VI1 A;  4HX3 A;  4XM6 A;  3HBV P;  1GO7 P;  1PWQ A;  5B5O A;  3ELM A;  4WZV A;  1R55 A; 
#chains in the Genus database with same CATH topology
 4DD8 A;  1DMT A;  1QJJ A;  1JAN A;  1BQQ M;  2DDF A;  1R1H A;  4L19 A;  2OY2 A;  3KME A;  1JJ9 A;  1ZTQ A;  2OXZ A;  2POJ A;  4XBH A;  1Y8J A;  2W13 A;  3DNG A;  2OZR A;  4ZR5 A;  1HV5 A;  2OW1 A;  3TVC A;  3LGP A;  2V4B A;  2YUF A;  3F19 A;  3DPE A;  1YCM A;  2DW1 A;  1MMQ A;  3KHI A;  3CKI A;  4XM7 A;  3B92 A;  1QJI A;  2JSD A;  2QPJ A;  2ERP A;  4JPA A;  4GF1 A;  4FU4 A;  1OM6 A;  4G9L A;  3LMC A;  2Z2D A;  4FXY P;  1AF0 A;  1PWP A;  3TS4 A;  3EHX A;  1SRP A;  2CLT A;  1BKC A;  4J4M A;  4AYK A;  5CUH A;  3LUN A;  5D1S A;  3WV3 A;  5LAB A;  2N8R A;  4G0D A;  1JIW P;  3LJZ A;  4GWN A;  1PWU A;  1S4B P;  1BM6 A;  1OZ9 A;  4PKS A;  3TT4 A;  4GQL A;  1AST A;  1R1I A;  2OVX A;  2X7M A;  4R3V A;  3P1V A;  1MMP A;  1CK7 A;  4XM8 A;  1IAC A;  1A86 A;  5B5P A;  2K2G A;  2WO9 A;  3F1A A;  3LE9 A;  1TVI A;  1CIZ A;  2MZI A;  2YB9 A;  4JA1 A;  3V96 B;  1AKL A;  1B8Y A;  1A85 A;  3Q2G A;  2W15 A;  2FV5 A;  1Z3J A;  4H2E A;  3KEK A;  1K7G A;  3WV2 A;  2E2D A;  1C3I A;  3AYK A;  3F16 A;  1FBL A;  3DWB A;  2MLS A;  5L7F A;  1HFC A;  1ND1 A;  1ATL A;  3L0V A;  2CKI A;  1JH1 A;  3HDA P;  3HDB A;  3MA2 A;  2USN A;  1J7N A;  4FXQ A;  1I76 A;  2DDY A;  1CGF A;  5I12 A;  2JT6 A;  3F18 A;  4PKW A;  1OM7 A;  3LJT A;  3USN A;  3LUM A;  4H76 A;  2Y6C A;  1HFS A;  3KRY A;  5JMY A;  1Y93 A;  830C A;  4PKQ A;  2E3X A;  3E8R A;  5H8X A;  1CGL A;  3LKA A;  3OHO A;  3NX7 A;  4ILW D;  2JT5 A;  1OO9 A;  1GE5 A;  1JIZ A;  3DSL A;  1ZXV A;  4PKR A;  4JP4 A;  1OM8 A;  1BSW A;  1SLN A;  5I2Z A;  1QIC A;  4QKZ A;  4PKV A;  4GR8 A;  5BPA A;  3ZXH A;  1G05 A;  1HOV A;  1KUG A;  4H82 A;  5I3M A;  1QIA A;  1SAT A;  2OVZ A;  3L0T A;  3KEJ A;  4L6T A;  2OI0 A;  1SLM A;  2W0D A;  2Y6D A;  1JKY A;  1PWW A;  3Q2H A;  4JIJ A;  3U1R A;  2OW2 A;  2WO8 A;  2J83 A;  3UVC A;  5I43 A;  2XS4 A;  1L6J A;  2K9C A;  1USN A;  3EDG A;  3HY7 A;  1B3D A;  1SMP A;  1BIW A;  4EFS A;  3DTK A;  4IN9 A;  1EUB A;  3HY9 A;  1GE7 A;  1YP1 A;  3ZVS A;  1R54 A;  2JIH A;  2I47 A;  1ROS A;  1D5J A;  5BOT A;  1D7X A;  4Q1L A;  456C A;  4AXQ A;  1FLS A;  2ERQ A;  2DW2 A;  4A7B A;  4CTH A;  5CZM A;  2D1O A;  3N2U A;  4GR0 A;  4H3X A;  3G5C A;  3LIK A;  2SRT A;  3P24 A;  1IAB A;  2YIG A;  1FM1 A;  1CXV A;  2OW0 A;  1D8F A;  1XAX A;  1K7Q A;  1XFV A;  3DL1 A;  1OMJ A;  2X3C A;  1JAP A;  2JNP A;  5L79 A;  1GO8 P;  4A3W A;  4H84 A;  4H49 A;  2HU6 A;  3RTS A;  1I1I P;  3B8Z A;  1KBC A;  1KUI A;  1IAG A;  1MMB A;  1HTD A;  1I73 A;  3LQ0 A;  4DF9 A;  2XS3 A;  1BKC E;  4GUY A;  1R1J A;  1C7K A;  4FVL A;  3I7I A;  3BA0 A;  2O36 A;  4PKT A;  4DV8 A;  4IUW A;  2AIG P;  3KMC A;  1WNI A;  2FV9 A;  1CQR A;  2RJP A;  3HB2 P;  1Q3A A;  1QUA A;  1XFW A;  2MZE A;  2L0R A;  1SU3 A;  3WV1 A;  2D1N A;  1XFX A;  3OHL A;  1AYK A;  2X3B A;  1C8T A;  2J0T A;  3B2Z A;  1G9K A;  1XFU A;  1CGE A;  2O3E A;  1YOU A;  1G4K A;  4L63 A;  1XM5 A;  3LK8 A;  1RMZ A;  5CXA A;  3O64 A;  1KUF A;  1XFZ A;  5D3C A;  1OS9 A;  1EB6 A;  4ON1 A;  2TCL A;  2WOA A;  1JAO A;  2AYK A;  1ZS0 A;  1Y0V A;  3I7G A;  3GBO A;  1UEA A;  1MNC A;  1IAE A;  1XFY A;  1CAQ A;  1KUH A;  3HBU P;  1KUK A;  3DTE A;  4AUO A;  4GR3 A;  1HY7 A;  2W14 A;  3O2X A;  3LJG A;  1XUC A;  1BKC I;  1UTZ A;  3N2V A;  1UMT A;  2A8H A;  3TSK A;  966C A;  3G42 A;  1YQY A;  1OS2 A;  3K7L A;  4H30 A;  3AYU A;  4WKI A;  2KRJ A;  1KAP P;  1BQO A;  2OY4 A;  2MZH A;  4XCT A;  4GWM A;  4DPE A;  3DPF A;  5BOY A;  1RM8 A;  3LIL A;  1PWV A;  1BUD A;  1XUD A;  3EWJ A;  1XUR A;  1ZXC A;  1QIB A;  1H71 P;  1O0T A;  2OXW A;  4WF6 A;  3SHI A;  1DTH A;  5D1U A;  2MLR A;  1G12 A;  3EDZ A;  5I4O A;  1GE6 A;  3K7N A;  1GKD A;  5D1T A;  1GKC A;  4IJO A;  1ZVX A;  2OW9 A;  4WKE A;  3LIR A;  5I0L A;  1UTT A;  3RTT A;  2RJQ A;  2X3A A;  1JK3 A;  3HYG A;  3KWV C;  3LQB A;  4I03 A;  2DW0 A;  3EDI A;  3F15 A;  1GXD A;  1O0Q A;  1BUV M;  2OXU A;  3DTI A;  4WK7 A;  1JAQ A;  1ZP5 A;  1G49 A;  1K7I A;  3EDH A;  1D8M A;  3KEC A;  3ZUK A;  4PKU A;  4AIG A;  2PJT A;  1IAA A;  1EAK A;  3EHY A;  4H1Q A;  3LEA A;  4JQG A;  2W12 A;  1BZS A;  5D2B A;  4HMA A;  4I35 A;  1UMS A;  3F17 A;  2ERO A;  1IAD A;  1MMR A;  3VTG A;  5D7W A;  3AIG A;  4L7A A;  3VI1 A;  4HX3 A;  4XM6 A;  3HBV P;  1GO7 P;  1PWQ A;  5B5O A;  3ELM A;  4WZV A;  1R55 A; 
#chains in the Genus database with same CATH homology
 4DD8 A;  1DMT A;  1QJJ A;  1JAN A;  1BQQ M;  2DDF A;  1R1H A;  4L19 A;  2OY2 A;  3KME A;  1JJ9 A;  1ZTQ A;  2OXZ A;  2POJ A;  4XBH A;  1Y8J A;  2W13 A;  3DNG A;  2OZR A;  4ZR5 A;  1HV5 A;  2OW1 A;  3TVC A;  3LGP A;  2V4B A;  2YUF A;  3F19 A;  3DPE A;  1YCM A;  2DW1 A;  1MMQ A;  3KHI A;  3CKI A;  4XM7 A;  3B92 A;  1QJI A;  2JSD A;  2QPJ A;  2ERP A;  4JPA A;  4GF1 A;  4FU4 A;  1OM6 A;  4G9L A;  3LMC A;  2Z2D A;  4FXY P;  1AF0 A;  1PWP A;  3TS4 A;  3EHX A;  1SRP A;  2CLT A;  1BKC A;  4J4M A;  4AYK A;  5CUH A;  3LUN A;  5D1S A;  3WV3 A;  5LAB A;  2N8R A;  4G0D A;  1JIW P;  3LJZ A;  4GWN A;  1PWU A;  1S4B P;  1BM6 A;  4PKS A;  3TT4 A;  4GQL A;  1AST A;  1R1I A;  2OVX A;  2X7M A;  4R3V A;  3P1V A;  1MMP A;  1CK7 A;  4XM8 A;  1IAC A;  1A86 A;  5B5P A;  2K2G A;  2WO9 A;  3F1A A;  3LE9 A;  2MZI A;  1CIZ A;  2YB9 A;  4JA1 A;  3V96 B;  1AKL A;  1B8Y A;  1A85 A;  3Q2G A;  2W15 A;  2FV5 A;  1Z3J A;  4H2E A;  3KEK A;  1K7G A;  3WV2 A;  2E2D A;  1C3I A;  3AYK A;  3F16 A;  1FBL A;  3DWB A;  2MLS A;  5L7F A;  1HFC A;  1ND1 A;  1ATL A;  3L0V A;  2CKI A;  1JH1 A;  3HDA P;  3HDB A;  3MA2 A;  2USN A;  1J7N A;  4FXQ A;  1I76 A;  2DDY A;  1CGF A;  5I12 A;  2JT6 A;  3F18 A;  4PKW A;  1OM7 A;  3LJT A;  3USN A;  3LUM A;  4H76 A;  2Y6C A;  1HFS A;  3KRY A;  5JMY A;  1Y93 A;  830C A;  4PKQ A;  2E3X A;  3E8R A;  5H8X A;  1CGL A;  3LKA A;  3OHO A;  3NX7 A;  4ILW D;  2JT5 A;  1OO9 A;  1GE5 A;  1JIZ A;  3DSL A;  1ZXV A;  4PKR A;  4JP4 A;  1OM8 A;  1BSW A;  1SLN A;  5I2Z A;  1QIC A;  4QKZ A;  4PKV A;  4GR8 A;  5BPA A;  3ZXH A;  1G05 A;  1HOV A;  1KUG A;  4H82 A;  5I3M A;  1QIA A;  1SAT A;  2OVZ A;  3L0T A;  3KEJ A;  4L6T A;  2OI0 A;  1SLM A;  2W0D A;  2Y6D A;  1JKY A;  1PWW A;  3Q2H A;  4JIJ A;  3U1R A;  2OW2 A;  2WO8 A;  2J83 A;  3UVC A;  5I43 A;  2XS4 A;  1L6J A;  2K9C A;  1USN A;  3EDG A;  3HY7 A;  1B3D A;  1SMP A;  1BIW A;  4EFS A;  3DTK A;  4IN9 A;  1EUB A;  3HY9 A;  1GE7 A;  1YP1 A;  3ZVS A;  1R54 A;  2JIH A;  2I47 A;  1ROS A;  1D5J A;  5BOT A;  1D7X A;  4Q1L A;  456C A;  4AXQ A;  1FLS A;  2ERQ A;  2DW2 A;  4A7B A;  4CTH A;  5CZM A;  2D1O A;  3N2U A;  4GR0 A;  4H3X A;  3G5C A;  3LIK A;  2SRT A;  3P24 A;  1IAB A;  2YIG A;  1FM1 A;  1CXV A;  2OW0 A;  1D8F A;  1K7Q A;  1XFV A;  3DL1 A;  1OMJ A;  2X3C A;  1JAP A;  2JNP A;  5L79 A;  1GO8 P;  4A3W A;  4H84 A;  4H49 A;  2HU6 A;  3RTS A;  1I1I P;  3B8Z A;  1KBC A;  1KUI A;  1IAG A;  1MMB A;  1HTD A;  1I73 A;  3LQ0 A;  4DF9 A;  2XS3 A;  1BKC E;  4GUY A;  1R1J A;  1C7K A;  4FVL A;  3I7I A;  3BA0 A;  2O36 A;  4PKT A;  4DV8 A;  4IUW A;  2AIG P;  3KMC A;  1WNI A;  2FV9 A;  1CQR A;  2RJP A;  3HB2 P;  1Q3A A;  1QUA A;  1XFW A;  2MZE A;  2L0R A;  1SU3 A;  3WV1 A;  2D1N A;  1XFX A;  3OHL A;  1AYK A;  2X3B A;  1C8T A;  2J0T A;  3B2Z A;  1G9K A;  1XFU A;  1CGE A;  2O3E A;  1YOU A;  1G4K A;  4L63 A;  3LK8 A;  1RMZ A;  5CXA A;  3O64 A;  1KUF A;  1XFZ A;  5D3C A;  1OS9 A;  1EB6 A;  4ON1 A;  2TCL A;  2WOA A;  1JAO A;  2AYK A;  1ZS0 A;  1Y0V A;  3I7G A;  3GBO A;  1UEA A;  1MNC A;  1IAE A;  1XFY A;  1CAQ A;  1KUH A;  3HBU P;  1KUK A;  3DTE A;  4AUO A;  4GR3 A;  1HY7 A;  2W14 A;  3O2X A;  3LJG A;  1XUC A;  1BKC I;  1UTZ A;  3N2V A;  1UMT A;  2A8H A;  3TSK A;  966C A;  3G42 A;  1YQY A;  1OS2 A;  3K7L A;  4H30 A;  3AYU A;  4WKI A;  2KRJ A;  1KAP P;  1BQO A;  2OY4 A;  2MZH A;  4XCT A;  4GWM A;  4DPE A;  3DPF A;  5BOY A;  1RM8 A;  3LIL A;  1PWV A;  1BUD A;  1XUD A;  3EWJ A;  1XUR A;  1ZXC A;  1QIB A;  1H71 P;  1O0T A;  2OXW A;  4WF6 A;  3SHI A;  1DTH A;  5D1U A;  2MLR A;  1G12 A;  3EDZ A;  5I4O A;  1GE6 A;  3K7N A;  1GKD A;  5D1T A;  1GKC A;  4IJO A;  1ZVX A;  2OW9 A;  4WKE A;  3LIR A;  5I0L A;  1UTT A;  3RTT A;  2RJQ A;  2X3A A;  1JK3 A;  3HYG A;  3KWV C;  3LQB A;  4I03 A;  2DW0 A;  3EDI A;  3F15 A;  1GXD A;  1O0Q A;  1BUV M;  2OXU A;  3DTI A;  4WK7 A;  1JAQ A;  1ZP5 A;  1G49 A;  1K7I A;  3EDH A;  1D8M A;  3KEC A;  3ZUK A;  4PKU A;  4AIG A;  2PJT A;  1IAA A;  1EAK A;  3EHY A;  4H1Q A;  3LEA A;  4JQG A;  2W12 A;  1BZS A;  5D2B A;  4HMA A;  4I35 A;  1UMS A;  3F17 A;  2ERO A;  1IAD A;  1MMR A;  3VTG A;  5D7W A;  3AIG A;  4L7A A;  3VI1 A;  4HX3 A;  4XM6 A;  3HBV P;  1GO7 P;  1PWQ A;  5B5O A;  3ELM A;  4WZV A;  1R55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...