3K7LA

Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the d domain of adamalysin family proteins
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
422
structure length
409
Chain Sequence
b'TNTPEQDRYLQAKKYIEFYVVVDNIMYRHYKRDQPVIKRKVYEMINTMNMIYRRLNFHIALIGLEIWSNINEINVQSDVRATLNLFGEWREKKLLPRKRNDNAQLLTGIDFNGTPVGLAYIGSICNPKTSAAVVQDYSSRTRMVAITMAHEMGHNLGMNHDRGFCTCGFYQFSSCSVREHQRYLLRDRPQCILNKPLSTDIVSPPICGNYFVEVGEECDCGSPADCQSACCNATTCKLQHEAQCDSEECCEKCKFKGARAECRAAKDDCDLPELCTGQSAECPTDVFQRNGLPCQNNQGYCYNGKCPIMTNQCIALRGPGVKVSRDSCFTLNQRTRGCGLCRMEYGRKIPCAAKDVKCGRLFCKRRNSMICNCSISPRDPNYGMVEPGTKCGDGMVCSNRQCVDVKTAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Atragin
publication title Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the D domain of ADAMalysin family proteins
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 409
sequence length 422
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3k7lA01
1XURA 4R3VA 1JAOA 5D3CA 1S4BP 4H82A 1YCMA 2X3AA 1R1HA 4PKTA 3O2XA 3BA0A 3DWBA 1PWPA 1J7NA 3CKIA 3LMCA 1XFXA 3LIRA 4WF6A 1SU3A 1G9KA 3OHOA 1IAEA 1MNCA 1SLMA 4Q1LA 3LUMA 2Y6DA 1GE7A 1ZS0A 1JAPA 2DW2A 1RM8A 4GR0A 1MMRA 1XUCA 2OW9A 5D1UA 1JAQA 3HY7A 3WV3A 2D1OA 4H76A 5I0LA 1C8TA 3LK8A 2O36A 2SRTA 1C7KA 1UEAA 2EROA 2OVXA 3DPEA 1CGFA 2RJPA 3I7GA 1OM6A 1KUIA 3LE9A 3HDBA 3LGPA 4GR8A 1USNA 1CQRA 1KUGA 3TVCA 4WK7A 2D1NA 4A7BA 1D7XA 3G5CA 1IABA 1OM8A 2OY4A 3AYUA 4XM8A 2POJA 1CIZA 4GUYA 4XCTA 2J83A 1EUBA 2E3XA 1QIBA 1KUKA 3GBOA 3N2UA 4DV8A 3F18A 1CAQA 1OMJA 1R1IA 4FXQA 1BQOA 3LUNA 3WV2A 3P1VA 5I43A 3KMCA 2FV9A 1XUDA 3EWJA 1JK3A 2PJTA 4FXYP 1K7IA 4AXQA 1YOUA 1QJJA 1A86A 3TT4A 5D7WA 1IAGA 4GR3A 1XFYA 1AYKA 1QUAA 1Q3AA 1ZP5A 1GO8P 2I47A 1Z3JA 3F15A 3LEAA 4WKIA 3HBVP 1OS2A 2OXUA 1ZTQA 2DDYA 3AYKA 5B5PA 4PKQA 4GWNA 1FM1A 3LQBA 1D8FA 4HX3A 3HBUP 1HFCA 1I73A 4IN9A 3L0VA 4GWMA 1Y93A 1IAAA 2DW0A 1BZSA 3U1RA 1PWUA 4QKZA 4L6TA 2W12A 4JP4A 2Z2DA 1SLNA 1A85A 4HMAA 1I76A 1HY7A 4ILWD 3ZVSA 4JA1A 1HFSA 1R54A 1UTZA 1XFWA 2MZHA 1BQQM 2E2DA 1GE5A 1MMBA 2OXWA 2RJQA 2X7MA 3Q2HA 5JMYA 1Y8JA 1JJ9A 2DDFA 4XM6A 1QICA 2V4BA 2X3CA 3EDZA 1CXVA 2MZIA 1XFUA 3TSKA 2WO8A 1G05A 1GO7P 1K7QA 3K7LA 3KWVC 4L63A 1BM6A 1BKCI 1SATA 2JSDA 3LJZA 1R1JA 4JPAA 1JKYA 3P24A 1G4KA 5BOTA 1IADA 4PKWA 1KUHA 3G42A 1BIWA 1ZXVA 4H2EA 2JIHA 2X3BA 3ZUKA 3LQ0A 1ATLA 2OVZA 3RTSA 3DL1A 2L0RA 1ZXCA 4A3WA 1I1IP 2JT6A 3I7IA 1R55A 4PKVA 3V96B 4CTHA 1GKDA 4H49A 4ON1A 3LKAA 1C3IA 4PKSA 2USNA 2QPJA 5LABA 3UVCA 1FLSA 1IACA 4JIJA 1DTHA 1Y0VA 1B3DA 3F19A 3EHYA 3F17A 1EAKA 1G49A 1MMPA 1OS9A 1BSWA 1GKCA 2K9CA 3KECA 2XS4A 4G9LA 4EFSA 1YP1A 2TCLA 3F1AA 1L6JA 1ASTA 5L7FA 5I4OA 1PWVA 4G0DA 3AIGA 2K2GA 4H3XA 5CXAA 1PWWA 2MLSA 4AUOA 2J0TA 2W0DA 1RMZA 1AF0A 5D1TA 1KBCA 2ERPA 5L79A 1D5JA 1G12A 3EDHA 3KRYA 1WNIA 2MLRA 1UMTA 2JT5A 3DSLA 3O64A 2YB9A 3K7NA 1BUVM 4I35A 2HU6A 2CKIA 4PKUA 830CA 3ELMA 3HB2P 3HYGA 2Y6CA 4I03A 4AYKA 3LIKA 1CGEA 1ND1A 3LJGA 4IJOA 1ROSA 3KMEA 3ZXHA 1D8MA 1BUDA 3B8ZA 3HY9A 1UMSA 2O3EA 4J4MA 2DW1A 4XM7A 3E8RA 1XFZA 1OM7A 5CZMA 1HTDA 4GQLA 1UTTA 4IUWA 3HDAP 3SHIA 1MMQA 3DPFA 4DD8A 2OW2A 1K7GA 1GE6A 3EDGA 4XBHA 3MA2A 4H1QA 5BOYA 3Q2GA 2AIGP 3DNGA 4GF1A 3B92A 1EB6A 2OY2A 5H8XA 3L0TA 2CLTA 3KEJA 1O0QA 2MZEA 3NX7A 5B5OA 2AYKA 2YIGA 3USNA 1DMTA 4DPEA 1O0TA 2XS3A 4DF9A 966CA 1JIZA 2W15A 1KAPP 2ERQA 1AKLA 1GXDA 5D1SA 4ZR5A 4L19A 1SMPA 3KHIA 1ZVXA 2W13A 1JIWP 1PWQA 456CA 1JANA 3B2ZA 5D2BA 1BKCE 2KRJA 3VI1A 1CK7A 4H30A 1B8YA 1QJIA 1JH1A 3LJTA 1BKCA 4H84A 3KEKA 4PKRA 5CUHA 3VTGA 1QIAA 2A8HA 2N8RA 3EHXA 4JQGA 4AIGA 1OO9A 5I12A 3N2VA 4WKEA 4WZVA 2WOAA 1KUFA 5BPAA 3RTTA 5I3MA 1SRPA 2OW0A 3OHLA 3TS4A 3WV1A 1HV5A 1HOVA 2OW1A 2FV5A 3LILA 4FVLA 1CGLA 5I2ZA 1XFVA 1YQYA 2OZRA 4FU4A 2WO9A 3F16A 1H71P 2OI0A 2W14A 3EDIA 2OXZA 2JNPA 1FBLA
chains in the Genus database with same CATH superfamily
1TVIA 1XURA 4R3VA 1JAOA 5D3CA 1S4BP 4H82A 1YCMA 2X3AA 1R1HA 4PKTA 3O2XA 3BA0A 3DWBA 1PWPA 1J7NA 3CKIA 3LMCA 1XFXA 3LIRA 4WF6A 1SU3A 1G9KA 3OHOA 1IAEA 1MNCA 1SLMA 4Q1LA 3LUMA 2Y6DA 1GE7A 1ZS0A 1JAPA 2DW2A 1RM8A 4GR0A 1MMRA 1XUCA 2OW9A 5D1UA 1JAQA 3HY7A 3WV3A 2D1OA 4H76A 5I0LA 1C8TA 3LK8A 2O36A 2SRTA 1C7KA 1UEAA 2EROA 2OVXA 3DPEA 1CGFA 2RJPA 3I7GA 1OM6A 1KUIA 3LE9A 3HDBA 3LGPA 4GR8A 1USNA 1CQRA 1KUGA 3TVCA 4WK7A 2D1NA 4A7BA 1D7XA 3G5CA 1IABA 1OM8A 2OY4A 3AYUA 4XM8A 2POJA 1CIZA 4GUYA 4XCTA 2J83A 1XM5A 1EUBA 2E3XA 1QIBA 1KUKA 3GBOA 3N2UA 4DV8A 3F18A 1CAQA 1OMJA 1R1IA 4FXQA 1BQOA 3LUNA 3WV2A 3P1VA 5I43A 3KMCA 2FV9A 1XUDA 3EWJA 1JK3A 2PJTA 4FXYP 1K7IA 4AXQA 1YOUA 1QJJA 1A86A 3TT4A 5D7WA 1IAGA 4GR3A 1XFYA 1AYKA 1QUAA 1Q3AA 1ZP5A 1GO8P 2I47A 1Z3JA 3F15A 3LEAA 4WKIA 3HBVP 1OS2A 2OXUA 1ZTQA 2DDYA 3AYKA 5B5PA 4PKQA 4GWNA 1FM1A 3LQBA 1D8FA 4HX3A 3HBUP 1HFCA 1I73A 4IN9A 3L0VA 4GWMA 1Y93A 1IAAA 2DW0A 1BZSA 3U1RA 1PWUA 4QKZA 4L6TA 2W12A 4JP4A 2Z2DA 1SLNA 1A85A 4HMAA 1I76A 1HY7A 4ILWD 3ZVSA 4JA1A 1HFSA 1R54A 1UTZA 1XFWA 2MZHA 1BQQM 2E2DA 1GE5A 1MMBA 2OXWA 2RJQA 2X7MA 3Q2HA 5JMYA 1Y8JA 1JJ9A 2DDFA 4XM6A 1QICA 2V4BA 2X3CA 3EDZA 1CXVA 2MZIA 1XFUA 3TSKA 2WO8A 1G05A 4L7AA 1GO7P 3DTEA 1K7QA 3K7LA 3KWVC 4L63A 1BM6A 1BKCI 1SATA 2JSDA 3LJZA 1R1JA 4JPAA 1JKYA 3P24A 1G4KA 5BOTA 1IADA 4PKWA 1KUHA 3G42A 1BIWA 1ZXVA 4H2EA 2JIHA 2X3BA 3ZUKA 3LQ0A 1ATLA 2OVZA 3RTSA 3DL1A 2L0RA 1ZXCA 4A3WA 1I1IP 2JT6A 3I7IA 1R55A 4PKVA 3V96B 4CTHA 1GKDA 4H49A 4ON1A 3LKAA 1C3IA 4PKSA 2USNA 2QPJA 5LABA 3UVCA 1FLSA 1IACA 1OZ9A 4JIJA 1DTHA 1Y0VA 1B3DA 3F19A 3EHYA 3F17A 1EAKA 1G49A 1MMPA 1OS9A 1BSWA 1GKCA 2K9CA 3KECA 2XS4A 4G9LA 4EFSA 1YP1A 2TCLA 3F1AA 1L6JA 1ASTA 5L7FA 5I4OA 1PWVA 4G0DA 3AIGA 2K2GA 4H3XA 5CXAA 1PWWA 2MLSA 4AUOA 2J0TA 2W0DA 1RMZA 1AF0A 5D1TA 1KBCA 2ERPA 5L79A 1D5JA 1G12A 3EDHA 3KRYA 1WNIA 2MLRA 1UMTA 2JT5A 3DSLA 3O64A 2YB9A 3K7NA 1BUVM 2YUFA 4I35A 2HU6A 2CKIA 4PKUA 830CA 3ELMA 3HB2P 3HYGA 2Y6CA 4I03A 4AYKA 3LIKA 1CGEA 1ND1A 3LJGA 4IJOA 1ROSA 3KMEA 3ZXHA 1D8MA 1BUDA 3B8ZA 3HY9A 1XAXA 1UMSA 2O3EA 4J4MA 2DW1A 4XM7A 3E8RA 1XFZA 1OM7A 5CZMA 1HTDA 4GQLA 1UTTA 4IUWA 3HDAP 3SHIA 1MMQA 3DPFA 4DD8A 2OW2A 1K7GA 1GE6A 3EDGA 4XBHA 3MA2A 4H1QA 5BOYA 3Q2GA 2AIGP 3DNGA 4GF1A 3B92A 1EB6A 2OY2A 5H8XA 3L0TA 2CLTA 3KEJA 1O0QA 2MZEA 3NX7A 5B5OA 2AYKA 2YIGA 3USNA 1DMTA 4DPEA 1O0TA 2XS3A 4DF9A 966CA 1JIZA 2W15A 1KAPP 2ERQA 1AKLA 1GXDA 5D1SA 4ZR5A 4L19A 1SMPA 3KHIA 1ZVXA 2W13A 1JIWP 3DTKA 1PWQA 456CA 1JANA 3B2ZA 5D2BA 1BKCE 2KRJA 3VI1A 1CK7A 4H30A 1B8YA 1QJIA 1JH1A 3LJTA 1BKCA 4H84A 3KEKA 4PKRA 5CUHA 3VTGA 1QIAA 2A8HA 2N8RA 3EHXA 4JQGA 4AIGA 1OO9A 5I12A 3N2VA 4WKEA 4WZVA 2WOAA 1KUFA 5BPAA 3RTTA 5I3MA 1SRPA 2OW0A 3OHLA 3TS4A 3WV1A 1HV5A 1HOVA 2OW1A 2FV5A 3LILA 4FVLA 1CGLA 5I2ZA 1XFVA 1YQYA 2OZRA 4FU4A 2WO9A 3F16A 1H71P 2OI0A 2W14A 3EDIA 2OXZA 2JNPA 1FBLA 3DTIA
chains in the Genus database with same CATH topology
1XURA 4R3VA 1JAOA 5D3CA 1S4BP 4H82A 1YCMA 2X3AA 1R1HA 4PKTA 3O2XA 3BA0A 3DWBA 1PWPA 1J7NA 3CKIA 3LMCA 1XFXA 3LIRA 4WF6A 1SU3A 1G9KA 3OHOA 1IAEA 1MNCA 1SLMA 4Q1LA 3LUMA 2Y6DA 1GE7A 1ZS0A 1JAPA 2DW2A 1RM8A 4GR0A 1MMRA 1XUCA 2OW9A 5D1UA 1JAQA 3HY7A 3WV3A 2D1OA 4H76A 5I0LA 1C8TA 3LK8A 2O36A 2SRTA 1C7KA 1UEAA 2EROA 2OVXA 3DPEA 1CGFA 2RJPA 3I7GA 1OM6A 1KUIA 3LE9A 3HDBA 3LGPA 4GR8A 1USNA 1CQRA 1KUGA 3TVCA 4WK7A 2D1NA 4A7BA 1D7XA 3G5CA 1IABA 1OM8A 2OY4A 3AYUA 4XM8A 2POJA 1CIZA 4GUYA 4XCTA 2J83A 1EUBA 2E3XA 1QIBA 1KUKA 3GBOA 3N2UA 4DV8A 3F18A 1CAQA 1OMJA 1R1IA 4FXQA 1BQOA 3LUNA 3WV2A 3P1VA 5I43A 3KMCA 2FV9A 1XUDA 3EWJA 1JK3A 2PJTA 4FXYP 1K7IA 4AXQA 1YOUA 1QJJA 1A86A 3TT4A 5D7WA 1IAGA 4GR3A 1XFYA 1AYKA 1QUAA 1Q3AA 1ZP5A 1GO8P 2I47A 1Z3JA 3F15A 3LEAA 4WKIA 3HBVP 1OS2A 2OXUA 1ZTQA 2DDYA 3AYKA 5B5PA 4PKQA 4GWNA 1FM1A 3LQBA 1D8FA 4HX3A 3HBUP 1HFCA 1I73A 4IN9A 3L0VA 4GWMA 1Y93A 1IAAA 2DW0A 1BZSA 3U1RA 1PWUA 4QKZA 4L6TA 2W12A 4JP4A 2Z2DA 1SLNA 1A85A 4HMAA 1I76A 1HY7A 4ILWD 3ZVSA 4JA1A 1HFSA 1R54A 1UTZA 1XFWA 2MZHA 1BQQM 2E2DA 1GE5A 1MMBA 2OXWA 2RJQA 2X7MA 3Q2HA 5JMYA 1Y8JA 1JJ9A 2DDFA 4XM6A 1QICA 2V4BA 2X3CA 3EDZA 1CXVA 2MZIA 1XFUA 3TSKA 2WO8A 1G05A 4L7AA 1GO7P 3DTEA 1K7QA 3K7LA 3KWVC 4L63A 1BM6A 1BKCI 1SATA 2JSDA 3LJZA 1R1JA 4JPAA 1JKYA 3P24A 1G4KA 5BOTA 1IADA 4PKWA 1KUHA 3G42A 1BIWA 1ZXVA 4H2EA 2JIHA 2X3BA 3ZUKA 3LQ0A 1ATLA 2OVZA 3RTSA 3DL1A 2L0RA 1ZXCA 4A3WA 1I1IP 2JT6A 3I7IA 1R55A 4PKVA 3V96B 4CTHA 1GKDA 4H49A 4ON1A 3LKAA 1C3IA 4PKSA 2USNA 2QPJA 5LABA 3UVCA 1FLSA 1IACA 4JIJA 1DTHA 1Y0VA 1B3DA 3F19A 3EHYA 3F17A 1EAKA 1G49A 1MMPA 1OS9A 1BSWA 1GKCA 2K9CA 3KECA 2XS4A 4G9LA 4EFSA 1YP1A 2TCLA 3F1AA 1L6JA 1ASTA 5L7FA 5I4OA 1PWVA 4G0DA 3AIGA 2K2GA 4H3XA 5CXAA 1PWWA 2MLSA 4AUOA 2J0TA 2W0DA 1RMZA 1AF0A 5D1TA 1KBCA 2ERPA 5L79A 1D5JA 1G12A 3EDHA 3KRYA 1WNIA 2MLRA 1UMTA 2JT5A 3DSLA 3O64A 2YB9A 3K7NA 1BUVM 2YUFA 4I35A 2HU6A 2CKIA 4PKUA 830CA 3ELMA 3HB2P 3HYGA 2Y6CA 4I03A 4AYKA 3LIKA 1CGEA 1ND1A 3LJGA 4IJOA 1ROSA 3KMEA 3ZXHA 1D8MA 1BUDA 3B8ZA 3HY9A 1UMSA 2O3EA 4J4MA 2DW1A 4XM7A 3E8RA 1XFZA 1OM7A 5CZMA 1HTDA 4GQLA 1UTTA 4IUWA 3HDAP 3SHIA 1MMQA 3DPFA 4DD8A 2OW2A 1K7GA 1GE6A 3EDGA 4XBHA 3MA2A 4H1QA 5BOYA 3Q2GA 2AIGP 3DNGA 4GF1A 3B92A 1EB6A 2OY2A 5H8XA 3L0TA 2CLTA 3KEJA 1O0QA 2MZEA 3NX7A 5B5OA 2AYKA 2YIGA 3USNA 1DMTA 4DPEA 1O0TA 2XS3A 4DF9A 966CA 1JIZA 2W15A 1KAPP 2ERQA 1AKLA 1GXDA 5D1SA 4ZR5A 4L19A 1SMPA 3KHIA 1ZVXA 2W13A 1JIWP 3DTKA 1PWQA 456CA 1JANA 3B2ZA 5D2BA 1BKCE 2KRJA 3VI1A 1CK7A 4H30A 1B8YA 1QJIA 1JH1A 3LJTA 1BKCA 4H84A 3KEKA 4PKRA 5CUHA 3VTGA 1QIAA 2A8HA 2N8RA 3EHXA 4JQGA 4AIGA 1OO9A 5I12A 3N2VA 4WKEA 4WZVA 2WOAA 1KUFA 5BPAA 3RTTA 5I3MA 1SRPA 2OW0A 3OHLA 3TS4A 3WV1A 1HV5A 1HOVA 2OW1A 2FV5A 3LILA 4FVLA 1CGLA 5I2ZA 1XFVA 1YQYA 2OZRA 4FU4A 2WO9A 3F16A 1H71P 2OI0A 2W14A 3EDIA 2OXZA 2JNPA 1FBLA 3DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUR A;  4R3V A;  1JAO A;  5D3C A;  1S4B P;  4H82 A;  1YCM A;  2X3A A;  1R1H A;  4PKT A;  3O2X A;  3BA0 A;  3DWB A;  1PWP A;  1J7N A;  3CKI A;  3LMC A;  1XFX A;  3LIR A;  4WF6 A;  1SU3 A;  1G9K A;  3OHO A;  1IAE A;  1MNC A;  1SLM A;  4Q1L A;  3LUM A;  2Y6D A;  1GE7 A;  1ZS0 A;  1JAP A;  2DW2 A;  1RM8 A;  4GR0 A;  1MMR A;  1XUC A;  2OW9 A;  5D1U A;  1JAQ A;  3HY7 A;  3WV3 A;  2D1O A;  4H76 A;  5I0L A;  1C8T A;  3LK8 A;  2O36 A;  2SRT A;  1C7K A;  1UEA A;  2ERO A;  2OVX A;  3DPE A;  1CGF A;  2RJP A;  3I7G A;  1OM6 A;  1KUI A;  3LE9 A;  3HDB A;  3LGP A;  4GR8 A;  1USN A;  1CQR A;  1KUG A;  3TVC A;  4WK7 A;  2D1N A;  4A7B A;  1D7X A;  3G5C A;  1IAB A;  1OM8 A;  2OY4 A;  3AYU A;  4XM8 A;  2POJ A;  1CIZ A;  4GUY A;  4XCT A;  2J83 A;  1EUB A;  2E3X A;  1QIB A;  1KUK A;  3GBO A;  3N2U A;  4DV8 A;  3F18 A;  1CAQ A;  1OMJ A;  1R1I A;  4FXQ A;  1BQO A;  3LUN A;  3WV2 A;  3P1V A;  5I43 A;  3KMC A;  2FV9 A;  1XUD A;  3EWJ A;  1JK3 A;  2PJT A;  4FXY P;  1K7I A;  4AXQ A;  1YOU A;  1QJJ A;  1A86 A;  3TT4 A;  5D7W A;  1IAG A;  4GR3 A;  1XFY A;  1AYK A;  1QUA A;  1Q3A A;  1ZP5 A;  1GO8 P;  2I47 A;  1Z3J A;  3F15 A;  3LEA A;  4WKI A;  3HBV P;  1OS2 A;  2OXU A;  1ZTQ A;  2DDY A;  3AYK A;  5B5P A;  4PKQ A;  4GWN A;  1FM1 A;  3LQB A;  1D8F A;  4HX3 A;  3HBU P;  1HFC A;  1I73 A;  4IN9 A;  3L0V A;  4GWM A;  1Y93 A;  1IAA A;  2DW0 A;  1BZS A;  3U1R A;  1PWU A;  4QKZ A;  4L6T A;  2W12 A;  4JP4 A;  2Z2D A;  1SLN A;  1A85 A;  4HMA A;  1I76 A;  1HY7 A;  4ILW D;  3ZVS A;  4JA1 A;  1HFS A;  1R54 A;  1UTZ A;  1XFW A;  2MZH A;  1BQQ M;  2E2D A;  1GE5 A;  1MMB A;  2OXW A;  2RJQ A;  2X7M A;  3Q2H A;  5JMY A;  1Y8J A;  1JJ9 A;  2DDF A;  4XM6 A;  1QIC A;  2V4B A;  2X3C A;  3EDZ A;  1CXV A;  2MZI A;  1XFU A;  3TSK A;  2WO8 A;  1G05 A;  1GO7 P;  1K7Q A;  3K7L A;  3KWV C;  4L63 A;  1BM6 A;  1BKC I;  1SAT A;  2JSD A;  3LJZ A;  1R1J A;  4JPA A;  1JKY A;  3P24 A;  1G4K A;  5BOT A;  1IAD A;  4PKW A;  1KUH A;  3G42 A;  1BIW A;  1ZXV A;  4H2E A;  2JIH A;  2X3B A;  3ZUK A;  3LQ0 A;  1ATL A;  2OVZ A;  3RTS A;  3DL1 A;  2L0R A;  1ZXC A;  4A3W A;  1I1I P;  2JT6 A;  3I7I A;  1R55 A;  4PKV A;  3V96 B;  4CTH A;  1GKD A;  4H49 A;  4ON1 A;  3LKA A;  1C3I A;  4PKS A;  2USN A;  2QPJ A;  5LAB A;  3UVC A;  1FLS A;  1IAC A;  4JIJ A;  1DTH A;  1Y0V A;  1B3D A;  3F19 A;  3EHY A;  3F17 A;  1EAK A;  1G49 A;  1MMP A;  1OS9 A;  1BSW A;  1GKC A;  2K9C A;  3KEC A;  2XS4 A;  4G9L A;  4EFS A;  1YP1 A;  2TCL A;  3F1A A;  1L6J A;  1AST A;  5L7F A;  5I4O A;  1PWV A;  4G0D A;  3AIG A;  2K2G A;  4H3X A;  5CXA A;  1PWW A;  2MLS A;  4AUO A;  2J0T A;  2W0D A;  1RMZ A;  1AF0 A;  5D1T A;  1KBC A;  2ERP A;  5L79 A;  1D5J A;  1G12 A;  3EDH A;  3KRY A;  1WNI A;  2MLR A;  1UMT A;  2JT5 A;  3DSL A;  3O64 A;  2YB9 A;  3K7N A;  1BUV M;  4I35 A;  2HU6 A;  2CKI A;  4PKU A;  830C A;  3ELM A;  3HB2 P;  3HYG A;  2Y6C A;  4I03 A;  4AYK A;  3LIK A;  1CGE A;  1ND1 A;  3LJG A;  4IJO A;  1ROS A;  3KME A;  3ZXH A;  1D8M A;  1BUD A;  3B8Z A;  3HY9 A;  1UMS A;  2O3E A;  4J4M A;  2DW1 A;  4XM7 A;  3E8R A;  1XFZ A;  1OM7 A;  5CZM A;  1HTD A;  4GQL A;  1UTT A;  4IUW A;  3HDA P;  3SHI A;  1MMQ A;  3DPF A;  4DD8 A;  2OW2 A;  1K7G A;  1GE6 A;  3EDG A;  4XBH A;  3MA2 A;  4H1Q A;  5BOY A;  3Q2G A;  2AIG P;  3DNG A;  4GF1 A;  3B92 A;  1EB6 A;  2OY2 A;  5H8X A;  3L0T A;  2CLT A;  3KEJ A;  1O0Q A;  2MZE A;  3NX7 A;  5B5O A;  2AYK A;  2YIG A;  3USN A;  1DMT A;  4DPE A;  1O0T A;  2XS3 A;  4DF9 A;  966C A;  1JIZ A;  2W15 A;  1KAP P;  2ERQ A;  1AKL A;  1GXD A;  5D1S A;  4ZR5 A;  4L19 A;  1SMP A;  3KHI A;  1ZVX A;  2W13 A;  1JIW P;  1PWQ A;  456C A;  1JAN A;  3B2Z A;  5D2B A;  1BKC E;  2KRJ A;  3VI1 A;  1CK7 A;  4H30 A;  1B8Y A;  1QJI A;  1JH1 A;  3LJT A;  1BKC A;  4H84 A;  3KEK A;  4PKR A;  5CUH A;  3VTG A;  1QIA A;  2A8H A;  2N8R A;  3EHX A;  4JQG A;  4AIG A;  1OO9 A;  5I12 A;  3N2V A;  4WKE A;  4WZV A;  2WOA A;  1KUF A;  5BPA A;  3RTT A;  5I3M A;  1SRP A;  2OW0 A;  3OHL A;  3TS4 A;  3WV1 A;  1HV5 A;  1HOV A;  2OW1 A;  2FV5 A;  3LIL A;  4FVL A;  1CGL A;  5I2Z A;  1XFV A;  1YQY A;  2OZR A;  4FU4 A;  2WO9 A;  3F16 A;  1H71 P;  2OI0 A;  2W14 A;  3EDI A;  2OXZ A;  2JNP A;  1FBL A; 
#chains in the Genus database with same CATH topology
 1TVI A;  1XUR A;  4R3V A;  1JAO A;  5D3C A;  1S4B P;  4H82 A;  1YCM A;  2X3A A;  1R1H A;  4PKT A;  3O2X A;  3BA0 A;  3DWB A;  1PWP A;  1J7N A;  3CKI A;  3LMC A;  1XFX A;  3LIR A;  4WF6 A;  1SU3 A;  1G9K A;  3OHO A;  1IAE A;  1MNC A;  1SLM A;  4Q1L A;  3LUM A;  2Y6D A;  1GE7 A;  1ZS0 A;  1JAP A;  2DW2 A;  1RM8 A;  4GR0 A;  1MMR A;  1XUC A;  2OW9 A;  5D1U A;  1JAQ A;  3HY7 A;  3WV3 A;  2D1O A;  4H76 A;  5I0L A;  1C8T A;  3LK8 A;  2O36 A;  2SRT A;  1C7K A;  1UEA A;  2ERO A;  2OVX A;  3DPE A;  1CGF A;  2RJP A;  3I7G A;  1OM6 A;  1KUI A;  3LE9 A;  3HDB A;  3LGP A;  4GR8 A;  1USN A;  1CQR A;  1KUG A;  3TVC A;  4WK7 A;  2D1N A;  4A7B A;  1D7X A;  3G5C A;  1IAB A;  1OM8 A;  2OY4 A;  3AYU A;  4XM8 A;  2POJ A;  1CIZ A;  4GUY A;  4XCT A;  2J83 A;  1XM5 A;  1EUB A;  2E3X A;  1QIB A;  1KUK A;  3GBO A;  3N2U A;  4DV8 A;  3F18 A;  1CAQ A;  1OMJ A;  1R1I A;  4FXQ A;  1BQO A;  3LUN A;  3WV2 A;  3P1V A;  5I43 A;  3KMC A;  2FV9 A;  1XUD A;  3EWJ A;  1JK3 A;  2PJT A;  4FXY P;  1K7I A;  4AXQ A;  1YOU A;  1QJJ A;  1A86 A;  3TT4 A;  5D7W A;  1IAG A;  4GR3 A;  1XFY A;  1AYK A;  1QUA A;  1Q3A A;  1ZP5 A;  1GO8 P;  2I47 A;  1Z3J A;  3F15 A;  3LEA A;  4WKI A;  3HBV P;  1OS2 A;  2OXU A;  1ZTQ A;  2DDY A;  3AYK A;  5B5P A;  4PKQ A;  4GWN A;  1FM1 A;  3LQB A;  1D8F A;  4HX3 A;  3HBU P;  1HFC A;  1I73 A;  4IN9 A;  3L0V A;  4GWM A;  1Y93 A;  1IAA A;  2DW0 A;  1BZS A;  3U1R A;  1PWU A;  4QKZ A;  4L6T A;  2W12 A;  4JP4 A;  2Z2D A;  1SLN A;  1A85 A;  4HMA A;  1I76 A;  1HY7 A;  4ILW D;  3ZVS A;  4JA1 A;  1HFS A;  1R54 A;  1UTZ A;  1XFW A;  2MZH A;  1BQQ M;  2E2D A;  1GE5 A;  1MMB A;  2OXW A;  2RJQ A;  2X7M A;  3Q2H A;  5JMY A;  1Y8J A;  1JJ9 A;  2DDF A;  4XM6 A;  1QIC A;  2V4B A;  2X3C A;  3EDZ A;  1CXV A;  2MZI A;  1XFU A;  3TSK A;  2WO8 A;  1G05 A;  4L7A A;  1GO7 P;  3DTE A;  1K7Q A;  3K7L A;  3KWV C;  4L63 A;  1BM6 A;  1BKC I;  1SAT A;  2JSD A;  3LJZ A;  1R1J A;  4JPA A;  1JKY A;  3P24 A;  1G4K A;  5BOT A;  1IAD A;  4PKW A;  1KUH A;  3G42 A;  1BIW A;  1ZXV A;  4H2E A;  2JIH A;  2X3B A;  3ZUK A;  3LQ0 A;  1ATL A;  2OVZ A;  3RTS A;  3DL1 A;  2L0R A;  1ZXC A;  4A3W A;  1I1I P;  2JT6 A;  3I7I A;  1R55 A;  4PKV A;  3V96 B;  4CTH A;  1GKD A;  4H49 A;  4ON1 A;  3LKA A;  1C3I A;  4PKS A;  2USN A;  2QPJ A;  5LAB A;  3UVC A;  1FLS A;  1IAC A;  1OZ9 A;  4JIJ A;  1DTH A;  1Y0V A;  1B3D A;  3F19 A;  3EHY A;  3F17 A;  1EAK A;  1G49 A;  1MMP A;  1OS9 A;  1BSW A;  1GKC A;  2K9C A;  3KEC A;  2XS4 A;  4G9L A;  4EFS A;  1YP1 A;  2TCL A;  3F1A A;  1L6J A;  1AST A;  5L7F A;  5I4O A;  1PWV A;  4G0D A;  3AIG A;  2K2G A;  4H3X A;  5CXA A;  1PWW A;  2MLS A;  4AUO A;  2J0T A;  2W0D A;  1RMZ A;  1AF0 A;  5D1T A;  1KBC A;  2ERP A;  5L79 A;  1D5J A;  1G12 A;  3EDH A;  3KRY A;  1WNI A;  2MLR A;  1UMT A;  2JT5 A;  3DSL A;  3O64 A;  2YB9 A;  3K7N A;  1BUV M;  2YUF A;  4I35 A;  2HU6 A;  2CKI A;  4PKU A;  830C A;  3ELM A;  3HB2 P;  3HYG A;  2Y6C A;  4I03 A;  4AYK A;  3LIK A;  1CGE A;  1ND1 A;  3LJG A;  4IJO A;  1ROS A;  3KME A;  3ZXH A;  1D8M A;  1BUD A;  3B8Z A;  3HY9 A;  1XAX A;  1UMS A;  2O3E A;  4J4M A;  2DW1 A;  4XM7 A;  3E8R A;  1XFZ A;  1OM7 A;  5CZM A;  1HTD A;  4GQL A;  1UTT A;  4IUW A;  3HDA P;  3SHI A;  1MMQ A;  3DPF A;  4DD8 A;  2OW2 A;  1K7G A;  1GE6 A;  3EDG A;  4XBH A;  3MA2 A;  4H1Q A;  5BOY A;  3Q2G A;  2AIG P;  3DNG A;  4GF1 A;  3B92 A;  1EB6 A;  2OY2 A;  5H8X A;  3L0T A;  2CLT A;  3KEJ A;  1O0Q A;  2MZE A;  3NX7 A;  5B5O A;  2AYK A;  2YIG A;  3USN A;  1DMT A;  4DPE A;  1O0T A;  2XS3 A;  4DF9 A;  966C A;  1JIZ A;  2W15 A;  1KAP P;  2ERQ A;  1AKL A;  1GXD A;  5D1S A;  4ZR5 A;  4L19 A;  1SMP A;  3KHI A;  1ZVX A;  2W13 A;  1JIW P;  3DTK A;  1PWQ A;  456C A;  1JAN A;  3B2Z A;  5D2B A;  1BKC E;  2KRJ A;  3VI1 A;  1CK7 A;  4H30 A;  1B8Y A;  1QJI A;  1JH1 A;  3LJT A;  1BKC A;  4H84 A;  3KEK A;  4PKR A;  5CUH A;  3VTG A;  1QIA A;  2A8H A;  2N8R A;  3EHX A;  4JQG A;  4AIG A;  1OO9 A;  5I12 A;  3N2V A;  4WKE A;  4WZV A;  2WOA A;  1KUF A;  5BPA A;  3RTT A;  5I3M A;  1SRP A;  2OW0 A;  3OHL A;  3TS4 A;  3WV1 A;  1HV5 A;  1HOV A;  2OW1 A;  2FV5 A;  3LIL A;  4FVL A;  1CGL A;  5I2Z A;  1XFV A;  1YQY A;  2OZR A;  4FU4 A;  2WO9 A;  3F16 A;  1H71 P;  2OI0 A;  2W14 A;  3EDI A;  2OXZ A;  2JNP A;  1FBL A;  3DTI A; 
#chains in the Genus database with same CATH homology
 1XUR A;  4R3V A;  1JAO A;  5D3C A;  1S4B P;  4H82 A;  1YCM A;  2X3A A;  1R1H A;  4PKT A;  3O2X A;  3BA0 A;  3DWB A;  1PWP A;  1J7N A;  3CKI A;  3LMC A;  1XFX A;  3LIR A;  4WF6 A;  1SU3 A;  1G9K A;  3OHO A;  1IAE A;  1MNC A;  1SLM A;  4Q1L A;  3LUM A;  2Y6D A;  1GE7 A;  1ZS0 A;  1JAP A;  2DW2 A;  1RM8 A;  4GR0 A;  1MMR A;  1XUC A;  2OW9 A;  5D1U A;  1JAQ A;  3HY7 A;  3WV3 A;  2D1O A;  4H76 A;  5I0L A;  1C8T A;  3LK8 A;  2O36 A;  2SRT A;  1C7K A;  1UEA A;  2ERO A;  2OVX A;  3DPE A;  1CGF A;  2RJP A;  3I7G A;  1OM6 A;  1KUI A;  3LE9 A;  3HDB A;  3LGP A;  4GR8 A;  1USN A;  1CQR A;  1KUG A;  3TVC A;  4WK7 A;  2D1N A;  4A7B A;  1D7X A;  3G5C A;  1IAB A;  1OM8 A;  2OY4 A;  3AYU A;  4XM8 A;  2POJ A;  1CIZ A;  4GUY A;  4XCT A;  2J83 A;  1EUB A;  2E3X A;  1QIB A;  1KUK A;  3GBO A;  3N2U A;  4DV8 A;  3F18 A;  1CAQ A;  1OMJ A;  1R1I A;  4FXQ A;  1BQO A;  3LUN A;  3WV2 A;  3P1V A;  5I43 A;  3KMC A;  2FV9 A;  1XUD A;  3EWJ A;  1JK3 A;  2PJT A;  4FXY P;  1K7I A;  4AXQ A;  1YOU A;  1QJJ A;  1A86 A;  3TT4 A;  5D7W A;  1IAG A;  4GR3 A;  1XFY A;  1AYK A;  1QUA A;  1Q3A A;  1ZP5 A;  1GO8 P;  2I47 A;  1Z3J A;  3F15 A;  3LEA A;  4WKI A;  3HBV P;  1OS2 A;  2OXU A;  1ZTQ A;  2DDY A;  3AYK A;  5B5P A;  4PKQ A;  4GWN A;  1FM1 A;  3LQB A;  1D8F A;  4HX3 A;  3HBU P;  1HFC A;  1I73 A;  4IN9 A;  3L0V A;  4GWM A;  1Y93 A;  1IAA A;  2DW0 A;  1BZS A;  3U1R A;  1PWU A;  4QKZ A;  4L6T A;  2W12 A;  4JP4 A;  2Z2D A;  1SLN A;  1A85 A;  4HMA A;  1I76 A;  1HY7 A;  4ILW D;  3ZVS A;  4JA1 A;  1HFS A;  1R54 A;  1UTZ A;  1XFW A;  2MZH A;  1BQQ M;  2E2D A;  1GE5 A;  1MMB A;  2OXW A;  2RJQ A;  2X7M A;  3Q2H A;  5JMY A;  1Y8J A;  1JJ9 A;  2DDF A;  4XM6 A;  1QIC A;  2V4B A;  2X3C A;  3EDZ A;  1CXV A;  2MZI A;  1XFU A;  3TSK A;  2WO8 A;  1G05 A;  4L7A A;  1GO7 P;  3DTE A;  1K7Q A;  3K7L A;  3KWV C;  4L63 A;  1BM6 A;  1BKC I;  1SAT A;  2JSD A;  3LJZ A;  1R1J A;  4JPA A;  1JKY A;  3P24 A;  1G4K A;  5BOT A;  1IAD A;  4PKW A;  1KUH A;  3G42 A;  1BIW A;  1ZXV A;  4H2E A;  2JIH A;  2X3B A;  3ZUK A;  3LQ0 A;  1ATL A;  2OVZ A;  3RTS A;  3DL1 A;  2L0R A;  1ZXC A;  4A3W A;  1I1I P;  2JT6 A;  3I7I A;  1R55 A;  4PKV A;  3V96 B;  4CTH A;  1GKD A;  4H49 A;  4ON1 A;  3LKA A;  1C3I A;  4PKS A;  2USN A;  2QPJ A;  5LAB A;  3UVC A;  1FLS A;  1IAC A;  4JIJ A;  1DTH A;  1Y0V A;  1B3D A;  3F19 A;  3EHY A;  3F17 A;  1EAK A;  1G49 A;  1MMP A;  1OS9 A;  1BSW A;  1GKC A;  2K9C A;  3KEC A;  2XS4 A;  4G9L A;  4EFS A;  1YP1 A;  2TCL A;  3F1A A;  1L6J A;  1AST A;  5L7F A;  5I4O A;  1PWV A;  4G0D A;  3AIG A;  2K2G A;  4H3X A;  5CXA A;  1PWW A;  2MLS A;  4AUO A;  2J0T A;  2W0D A;  1RMZ A;  1AF0 A;  5D1T A;  1KBC A;  2ERP A;  5L79 A;  1D5J A;  1G12 A;  3EDH A;  3KRY A;  1WNI A;  2MLR A;  1UMT A;  2JT5 A;  3DSL A;  3O64 A;  2YB9 A;  3K7N A;  1BUV M;  2YUF A;  4I35 A;  2HU6 A;  2CKI A;  4PKU A;  830C A;  3ELM A;  3HB2 P;  3HYG A;  2Y6C A;  4I03 A;  4AYK A;  3LIK A;  1CGE A;  1ND1 A;  3LJG A;  4IJO A;  1ROS A;  3KME A;  3ZXH A;  1D8M A;  1BUD A;  3B8Z A;  3HY9 A;  1UMS A;  2O3E A;  4J4M A;  2DW1 A;  4XM7 A;  3E8R A;  1XFZ A;  1OM7 A;  5CZM A;  1HTD A;  4GQL A;  1UTT A;  4IUW A;  3HDA P;  3SHI A;  1MMQ A;  3DPF A;  4DD8 A;  2OW2 A;  1K7G A;  1GE6 A;  3EDG A;  4XBH A;  3MA2 A;  4H1Q A;  5BOY A;  3Q2G A;  2AIG P;  3DNG A;  4GF1 A;  3B92 A;  1EB6 A;  2OY2 A;  5H8X A;  3L0T A;  2CLT A;  3KEJ A;  1O0Q A;  2MZE A;  3NX7 A;  5B5O A;  2AYK A;  2YIG A;  3USN A;  1DMT A;  4DPE A;  1O0T A;  2XS3 A;  4DF9 A;  966C A;  1JIZ A;  2W15 A;  1KAP P;  2ERQ A;  1AKL A;  1GXD A;  5D1S A;  4ZR5 A;  4L19 A;  1SMP A;  3KHI A;  1ZVX A;  2W13 A;  1JIW P;  3DTK A;  1PWQ A;  456C A;  1JAN A;  3B2Z A;  5D2B A;  1BKC E;  2KRJ A;  3VI1 A;  1CK7 A;  4H30 A;  1B8Y A;  1QJI A;  1JH1 A;  3LJT A;  1BKC A;  4H84 A;  3KEK A;  4PKR A;  5CUH A;  3VTG A;  1QIA A;  2A8H A;  2N8R A;  3EHX A;  4JQG A;  4AIG A;  1OO9 A;  5I12 A;  3N2V A;  4WKE A;  4WZV A;  2WOA A;  1KUF A;  5BPA A;  3RTT A;  5I3M A;  1SRP A;  2OW0 A;  3OHL A;  3TS4 A;  3WV1 A;  1HV5 A;  1HOV A;  2OW1 A;  2FV5 A;  3LIL A;  4FVL A;  1CGL A;  5I2Z A;  1XFV A;  1YQY A;  2OZR A;  4FU4 A;  2WO9 A;  3F16 A;  1H71 P;  2OI0 A;  2W14 A;  3EDI A;  2OXZ A;  2JNP A;  1FBL A;  3DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...