3K7LA

Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the d domain of adamalysin family proteins
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
422
structure length
409
Chain Sequence
TNTPEQDRYLQAKKYIEFYVVVDNIMYRHYKRDQPVIKRKVYEMINTMNMIYRRLNFHIALIGLEIWSNINEINVQSDVRATLNLFGEWREKKLLPRKRNDNAQLLTGIDFNGTPVGLAYIGSICNPKTSAAVVQDYSSRTRMVAITMAHEMGHNLGMNHDRGFCTCGFYQFSSCSVREHQRYLLRDRPQCILNKPLSTDIVSPPICGNYFVEVGEECDCGSPADCQSACCNATTCKLQHEAQCDSEECCEKCKFKGARAECRAAKDDCDLPELCTGQSAECPTDVFQRNGLPCQNNQGYCYNGKCPIMTNQCIALRGPGVKVSRDSCFTLNQRTRGCGLCRMEYGRKIPCAAKDVKCGRLFCKRRNSMICNCSISPRDPNYGMVEPGTKCGDGMVCSNRQCVDVKTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Atragin
publication title Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the D domain of ADAMalysin family proteins
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 409
sequence length 422
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3k7lA01
1JAPA 3DSLA 1OM8A 3AYUA 3AIGA 2K9CA 2E3XA 2WO9A 1XFZA 1JJ9A 2OVXA 1UTZA 3HB2P 1R1JA 1MMQA 3ELMA 5H8XA 3HY9A 4H82A 1JIZA 1UMSA 2OXWA 1DMTA 2YIGA 830CA 2OW1A 1QUAA 1FLSA 1XFXA 2CKIA 1EB6A 4I03A 3U1RA 4H1QA 1FM1A 3B8ZA 3NX7A 2JNPA 5D2BA 4J4MA 1O0QA 1AF0A 3I7GA 1ROSA 2XS4A 3HDBA 2JSDA 2CLTA 4PKVA 1Z3JA 1UMTA 3LQ0A 4GR0A 1XFVA 1CIZA 3KEJA 4JPAA 2FV9A 3B92A 1A86A 1HFSA 1KUHA 3B2ZA 3P24A 1B3DA 1I73A 3LILA 3ZVSA 2W0DA 1K7GA 1ZVXA 3E8RA 4FXQA 1GE6A 2JT6A 3P1VA 1BKCI 1IAEA 2MZEA 1G9KA 2O3EA 4DF9A 1Q3AA 3EHYA 1R55A 1DTHA 2YB9A 2RJPA 1RMZA 2J0TA 3O64A 1BSWA 2WOAA 1MNCA 3F17A 3N2VA 2V4BA 1BQOA 1MMBA 1R54A 2HU6A 4ZR5A 4H76A 3LJZA 2AIGP 3GBOA 5I2ZA 5D1TA 1BZSA 3EWJA 2A8HA 4ILWD 456CA 4FXYP 4WZVA 4XM7A 1CXVA 1K7QA 5D1UA 5B5PA 2MZIA 1G05A 4H2EA 3ZUKA 1AYKA 3KWVC 2MZHA 3F15A 3LEAA 4H30A 2Y6CA 1QJIA 1PWWA 2MLRA 4GWMA 3KMCA 4IUWA 1PWUA 1ZP5A 1CK7A 3F19A 3BA0A 1ND1A 3DWBA 5L7FA 2TCLA 1JANA 2DW0A 1OO9A 4XM8A 1D7XA 2RJQA 3ZXHA 1QICA 1AKLA 3LUNA 2PJTA 4GUYA 4IJOA 1KUFA 1XFYA 2ERQA 1BKCE 3Q2HA 2ERPA 1XUDA 4EFSA 1JH1A 2I47A 4GWNA 1KUKA 2POJA 4PKQA 3K7LA 1S4BP 2L0RA 5I43A 1ZTQA 1JKYA 4JQGA 4XM6A 2OI0A 1YOUA 4WK7A 1C7KA 1GO8P 1L6JA 1D5JA 2W12A 3HBVP 1BKCA 1BM6A 1R1IA 1K7IA 3DPFA 4H49A 2FV5A 2X3CA 3MA2A 1Y0VA 2SRTA 2WO8A 4JP4A 5D1SA 3VI1A 3K7NA 3LUMA 1B8YA 1KUGA 3DNGA 3LGPA 4GQLA 1OM7A 1CQRA 3EDIA 1A85A 1SLMA 3F16A 1BUDA 2DDFA 3TS4A 3VTGA 1G49A 3LQBA 4QKZA 3SHIA 3AYKA 1BUVM 3TVCA 3F18A 4DV8A 2Y6DA 3LIKA 4PKRA 4H84A 1MMRA 1Y8JA 1JAOA 1QIBA 1SMPA 1FBLA 5L79A 4CTHA 2X3BA 4L19A 3KMEA 1EUBA 5CUHA 4HMAA 4WF6A 4DD8A 1PWPA 3N2UA 1C3IA 1I76A 3G42A 1GO7P 1UEAA 3V96B 1IABA 1SU3A 3LMCA 1KBCA 1BQQM 3HYGA 4AXQA 1USNA 3OHOA 5I12A 3LJTA 5CXAA 4A3WA 1ATLA 3USNA 2W13A 1OMJA 1XURA 1GE5A 3KHIA 2OW0A 5JMYA 1CGLA 4DPEA 4AIGA 4AYKA 1YP1A 5B5OA 1OS9A 3DL1A 1I1IP 3L0TA 3EDZA 4HX3A 2OW9A 1JK3A 1J7NA 3LJGA 1Y93A 966CA 4FVLA 3I7IA 3LIRA 1KUIA 1HFCA 3CKIA 3TT4A 2DW2A 1SATA 5CZMA 1ZS0A 1CGEA 1XFUA 1IAGA 4PKTA 4AUOA 3O2XA 5BOTA 4L6TA 1JIWP 3WV1A 2OY4A 2Z2DA 2JIHA 5D3CA 1R1HA 5I0LA 1OS2A 4G0DA 2D1NA 2KRJA 1RM8A 2QPJA 1ASTA 1O0TA 2N8RA 1SRPA 4ON1A 3Q2GA 4XBHA 2DW1A 2O36A 4G9LA 1BIWA 4R3VA 1QIAA 2DDYA 1UTTA 1HOVA 1IACA 1ZXCA 3KECA 2X7MA 2K2GA 3LK8A 2J83A 2EROA 4GR3A 3TSKA 4XCTA 4I35A 3F1AA 5D7WA 4PKSA 3HDAP 1QJJA 1D8MA 2OW2A 2XS3A 2W14A 1HY7A 4PKWA 1ZXVA 2OXUA 1WNIA 3EDHA 1MMPA 3DPEA 2OXZA 1XUCA 1KAPP 1PWVA 2D1OA 3HY7A 3KEKA 1JAQA 1SLNA 3LKAA 4GR8A 1G12A 3KRYA 4L63A 2OVZA 1GE7A 4WKIA 3WV3A 1XFWA 5I4OA 5BOYA 3RTTA 4IN9A 1OM6A 3EHXA 1GXDA 1EAKA 1D8FA 1GKDA 2MLSA 2OZRA 4A7BA 3EDGA 1CAQA 2X3AA 3UVCA 2W15A 1YCMA 1PWQA 3OHLA 4JIJA 4WKEA 1YQYA 5I3MA 3L0VA 2E2DA 2JT5A 5BPAA 1GKCA 1IAAA 4PKUA 1C8TA 3G5CA 4GF1A 4H3XA 2OY2A 4Q1LA 4JA1A 1G4KA 5LABA 1IADA 4FU4A 3RTSA 2USNA 3WV2A 2AYKA 1H71P 3LE9A 1CGFA 1HV5A 1HTDA 3HBUP
chains in the Genus database with same CATH superfamily
1JAPA 3DSLA 1OM8A 3AYUA 3AIGA 2K9CA 2E3XA 2WO9A 1XFZA 1JJ9A 2OVXA 1UTZA 3HB2P 1R1JA 1MMQA 3ELMA 5H8XA 3HY9A 4H82A 1JIZA 1UMSA 2OXWA 1DMTA 2YIGA 830CA 2OW1A 1QUAA 1FLSA 1XFXA 2CKIA 1EB6A 4I03A 3U1RA 4H1QA 1FM1A 3B8ZA 3NX7A 2JNPA 5D2BA 4J4MA 1O0QA 1AF0A 3I7GA 1ROSA 2XS4A 3HDBA 2JSDA 2CLTA 4PKVA 1Z3JA 1UMTA 3LQ0A 4GR0A 1XFVA 1CIZA 3KEJA 4JPAA 2FV9A 3B92A 1A86A 1HFSA 1KUHA 3B2ZA 3P24A 1B3DA 1I73A 3LILA 3ZVSA 2W0DA 1K7GA 1ZVXA 3E8RA 4FXQA 1GE6A 2JT6A 3P1VA 1BKCI 1IAEA 2MZEA 1G9KA 2O3EA 4DF9A 1Q3AA 3EHYA 1R55A 1DTHA 2YB9A 2RJPA 1RMZA 2J0TA 3O64A 1BSWA 2WOAA 1MNCA 3F17A 3N2VA 2V4BA 1BQOA 1MMBA 1R54A 2HU6A 4ZR5A 4H76A 3LJZA 2AIGP 3GBOA 5I2ZA 5D1TA 1BZSA 3EWJA 2A8HA 4ILWD 456CA 4FXYP 4WZVA 4XM7A 1CXVA 1K7QA 5D1UA 5B5PA 2MZIA 1G05A 4H2EA 3ZUKA 1AYKA 3KWVC 2MZHA 1XAXA 3F15A 3LEAA 4H30A 2Y6CA 1QJIA 1PWWA 2MLRA 4GWMA 3KMCA 4IUWA 1PWUA 1ZP5A 1CK7A 3F19A 3BA0A 1ND1A 3DWBA 5L7FA 2TCLA 1JANA 2DW0A 1OO9A 4XM8A 4L7AA 1D7XA 2RJQA 3ZXHA 1QICA 1AKLA 3LUNA 2PJTA 4GUYA 4IJOA 1KUFA 1XFYA 2ERQA 1BKCE 3Q2HA 2ERPA 1XUDA 4EFSA 1JH1A 2I47A 4GWNA 1KUKA 2POJA 4PKQA 3K7LA 1S4BP 2L0RA 5I43A 1ZTQA 1JKYA 4JQGA 3DTKA 4XM6A 2OI0A 1YOUA 4WK7A 1C7KA 1GO8P 1L6JA 1D5JA 2W12A 3HBVP 1BKCA 1TVIA 1BM6A 1R1IA 1K7IA 3DPFA 4H49A 2FV5A 2X3CA 3MA2A 1Y0VA 2SRTA 2WO8A 4JP4A 5D1SA 3VI1A 3K7NA 3LUMA 1B8YA 1KUGA 3DNGA 3LGPA 4GQLA 1OM7A 1CQRA 3EDIA 1A85A 1SLMA 3F16A 1BUDA 2DDFA 3TS4A 3VTGA 1G49A 3LQBA 4QKZA 3SHIA 3AYKA 1BUVM 3TVCA 3F18A 4DV8A 2Y6DA 3LIKA 4PKRA 4H84A 1MMRA 1Y8JA 1JAOA 1QIBA 1SMPA 1FBLA 5L79A 4CTHA 2X3BA 4L19A 3KMEA 1EUBA 5CUHA 4HMAA 4WF6A 4DD8A 1PWPA 3N2UA 1C3IA 1I76A 2YUFA 3G42A 1GO7P 1UEAA 3V96B 1IABA 1SU3A 3LMCA 1KBCA 1BQQM 3HYGA 4AXQA 1USNA 3OHOA 5I12A 3LJTA 5CXAA 4A3WA 1ATLA 3USNA 2W13A 1OMJA 1XURA 1GE5A 3KHIA 2OW0A 5JMYA 1CGLA 4DPEA 4AIGA 4AYKA 1YP1A 5B5OA 1OS9A 3DL1A 1I1IP 3L0TA 3EDZA 4HX3A 2OW9A 1JK3A 1J7NA 3LJGA 1Y93A 966CA 4FVLA 3I7IA 3LIRA 1KUIA 1HFCA 3CKIA 3TT4A 2DW2A 1XM5A 1SATA 5CZMA 1ZS0A 1CGEA 1XFUA 1IAGA 4PKTA 4AUOA 3O2XA 5BOTA 4L6TA 1JIWP 3WV1A 2OY4A 2Z2DA 2JIHA 5D3CA 1R1HA 5I0LA 1OS2A 4G0DA 2D1NA 2KRJA 1RM8A 2QPJA 1ASTA 1O0TA 2N8RA 1SRPA 4ON1A 3Q2GA 4XBHA 2DW1A 2O36A 4G9LA 1BIWA 4R3VA 1QIAA 2DDYA 1UTTA 1HOVA 1IACA 1ZXCA 3KECA 2X7MA 2K2GA 3LK8A 2J83A 3DTIA 2EROA 4GR3A 3TSKA 4XCTA 4I35A 3F1AA 5D7WA 4PKSA 3HDAP 1QJJA 1D8MA 2OW2A 2XS3A 2W14A 1HY7A 4PKWA 1ZXVA 2OXUA 1WNIA 3EDHA 1MMPA 3DPEA 2OXZA 1XUCA 1KAPP 1PWVA 2D1OA 3HY7A 3KEKA 1JAQA 1SLNA 3LKAA 1OZ9A 4GR8A 1G12A 3KRYA 4L63A 2OVZA 1GE7A 4WKIA 3WV3A 1XFWA 5I4OA 5BOYA 3DTEA 3RTTA 4IN9A 1OM6A 3EHXA 1GXDA 1EAKA 1D8FA 1GKDA 2MLSA 2OZRA 4A7BA 3EDGA 1CAQA 2X3AA 3UVCA 2W15A 1YCMA 1PWQA 3OHLA 4JIJA 4WKEA 1YQYA 5I3MA 3L0VA 2E2DA 2JT5A 5BPAA 1GKCA 1IAAA 4PKUA 1C8TA 3G5CA 4GF1A 4H3XA 2OY2A 4Q1LA 4JA1A 1G4KA 5LABA 1IADA 4FU4A 3RTSA 2USNA 3WV2A 2AYKA 1H71P 3LE9A 1CGFA 1HV5A 1HTDA 3HBUP
chains in the Genus database with same CATH topology
1JAPA 3DSLA 1OM8A 3AYUA 3AIGA 2K9CA 2E3XA 2WO9A 1XFZA 1JJ9A 2OVXA 1UTZA 3HB2P 1R1JA 1MMQA 3ELMA 5H8XA 3HY9A 4H82A 1JIZA 1UMSA 2OXWA 1DMTA 2YIGA 830CA 2OW1A 1QUAA 1FLSA 1XFXA 2CKIA 1EB6A 4I03A 3U1RA 4H1QA 1FM1A 3B8ZA 3NX7A 2JNPA 5D2BA 4J4MA 1O0QA 1AF0A 3I7GA 1ROSA 2XS4A 3HDBA 2JSDA 2CLTA 4PKVA 1Z3JA 1UMTA 3LQ0A 4GR0A 1XFVA 1CIZA 3KEJA 4JPAA 2FV9A 3B92A 1A86A 1HFSA 1KUHA 3B2ZA 3P24A 1B3DA 1I73A 3LILA 3ZVSA 2W0DA 1K7GA 1ZVXA 3E8RA 4FXQA 1GE6A 2JT6A 3P1VA 1BKCI 1IAEA 2MZEA 1G9KA 2O3EA 4DF9A 1Q3AA 3EHYA 1R55A 1DTHA 2YB9A 2RJPA 1RMZA 2J0TA 3O64A 1BSWA 2WOAA 1MNCA 3F17A 3N2VA 2V4BA 1BQOA 1MMBA 1R54A 2HU6A 4ZR5A 4H76A 3LJZA 2AIGP 3GBOA 5I2ZA 5D1TA 1BZSA 3EWJA 2A8HA 4ILWD 456CA 4FXYP 4WZVA 4XM7A 1CXVA 1K7QA 5D1UA 5B5PA 2MZIA 1G05A 4H2EA 3ZUKA 1AYKA 3KWVC 2MZHA 3F15A 3LEAA 4H30A 2Y6CA 1QJIA 1PWWA 2MLRA 4GWMA 3KMCA 4IUWA 1PWUA 1ZP5A 1CK7A 3F19A 3BA0A 1ND1A 3DWBA 5L7FA 2TCLA 1JANA 2DW0A 1OO9A 4XM8A 4L7AA 1D7XA 2RJQA 3ZXHA 1QICA 1AKLA 3LUNA 2PJTA 4GUYA 4IJOA 1KUFA 1XFYA 2ERQA 1BKCE 3Q2HA 2ERPA 1XUDA 4EFSA 1JH1A 2I47A 4GWNA 1KUKA 2POJA 4PKQA 3K7LA 1S4BP 2L0RA 5I43A 1ZTQA 1JKYA 4JQGA 3DTKA 4XM6A 2OI0A 1YOUA 4WK7A 1C7KA 1GO8P 1L6JA 1D5JA 2W12A 3HBVP 1BKCA 1BM6A 1R1IA 1K7IA 3DPFA 4H49A 2FV5A 2X3CA 3MA2A 1Y0VA 2SRTA 2WO8A 4JP4A 5D1SA 3VI1A 3K7NA 3LUMA 1B8YA 1KUGA 3DNGA 3LGPA 4GQLA 1OM7A 1CQRA 3EDIA 1A85A 1SLMA 3F16A 1BUDA 2DDFA 3TS4A 3VTGA 1G49A 3LQBA 4QKZA 3SHIA 3AYKA 1BUVM 3TVCA 3F18A 4DV8A 2Y6DA 3LIKA 4PKRA 4H84A 1MMRA 1Y8JA 1JAOA 1QIBA 1SMPA 1FBLA 5L79A 4CTHA 2X3BA 4L19A 3KMEA 1EUBA 5CUHA 4HMAA 4WF6A 4DD8A 1PWPA 3N2UA 1C3IA 1I76A 2YUFA 3G42A 1GO7P 1UEAA 3V96B 1IABA 1SU3A 3LMCA 1KBCA 1BQQM 3HYGA 4AXQA 1USNA 3OHOA 5I12A 3LJTA 5CXAA 4A3WA 1ATLA 3USNA 2W13A 1OMJA 1XURA 1GE5A 3KHIA 2OW0A 5JMYA 1CGLA 4DPEA 4AIGA 4AYKA 1YP1A 5B5OA 1OS9A 3DL1A 1I1IP 3L0TA 3EDZA 4HX3A 2OW9A 1JK3A 1J7NA 3LJGA 1Y93A 966CA 4FVLA 3I7IA 3LIRA 1KUIA 1HFCA 3CKIA 3TT4A 2DW2A 1SATA 5CZMA 1ZS0A 1CGEA 1XFUA 1IAGA 4PKTA 4AUOA 3O2XA 5BOTA 4L6TA 1JIWP 3WV1A 2OY4A 2Z2DA 2JIHA 5D3CA 1R1HA 5I0LA 1OS2A 4G0DA 2D1NA 2KRJA 1RM8A 2QPJA 1ASTA 1O0TA 2N8RA 1SRPA 4ON1A 3Q2GA 4XBHA 2DW1A 2O36A 4G9LA 1BIWA 4R3VA 1QIAA 2DDYA 1UTTA 1HOVA 1IACA 1ZXCA 3KECA 2X7MA 2K2GA 3LK8A 2J83A 3DTIA 2EROA 4GR3A 3TSKA 4XCTA 4I35A 3F1AA 5D7WA 4PKSA 3HDAP 1QJJA 1D8MA 2OW2A 2XS3A 2W14A 1HY7A 4PKWA 1ZXVA 2OXUA 1WNIA 3EDHA 1MMPA 3DPEA 2OXZA 1XUCA 1KAPP 1PWVA 2D1OA 3HY7A 3KEKA 1JAQA 1SLNA 3LKAA 4GR8A 1G12A 3KRYA 4L63A 2OVZA 1GE7A 4WKIA 3WV3A 1XFWA 5I4OA 5BOYA 3DTEA 3RTTA 4IN9A 1OM6A 3EHXA 1GXDA 1EAKA 1D8FA 1GKDA 2MLSA 2OZRA 4A7BA 3EDGA 1CAQA 2X3AA 3UVCA 2W15A 1YCMA 1PWQA 3OHLA 4JIJA 4WKEA 1YQYA 5I3MA 3L0VA 2E2DA 2JT5A 5BPAA 1GKCA 1IAAA 4PKUA 1C8TA 3G5CA 4GF1A 4H3XA 2OY2A 4Q1LA 4JA1A 1G4KA 5LABA 1IADA 4FU4A 3RTSA 2USNA 3WV2A 2AYKA 1H71P 3LE9A 1CGFA 1HV5A 1HTDA 3HBUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAP A;  3DSL A;  1OM8 A;  3AYU A;  3AIG A;  2K9C A;  2E3X A;  2WO9 A;  1XFZ A;  1JJ9 A;  2OVX A;  1UTZ A;  3HB2 P;  1R1J A;  1MMQ A;  3ELM A;  5H8X A;  3HY9 A;  4H82 A;  1JIZ A;  1UMS A;  2OXW A;  1DMT A;  2YIG A;  830C A;  2OW1 A;  1QUA A;  1FLS A;  1XFX A;  2CKI A;  1EB6 A;  4I03 A;  3U1R A;  4H1Q A;  1FM1 A;  3B8Z A;  3NX7 A;  2JNP A;  5D2B A;  4J4M A;  1O0Q A;  1AF0 A;  3I7G A;  1ROS A;  2XS4 A;  3HDB A;  2JSD A;  2CLT A;  4PKV A;  1Z3J A;  1UMT A;  3LQ0 A;  4GR0 A;  1XFV A;  1CIZ A;  3KEJ A;  4JPA A;  2FV9 A;  3B92 A;  1A86 A;  1HFS A;  1KUH A;  3B2Z A;  3P24 A;  1B3D A;  1I73 A;  3LIL A;  3ZVS A;  2W0D A;  1K7G A;  1ZVX A;  3E8R A;  4FXQ A;  1GE6 A;  2JT6 A;  3P1V A;  1BKC I;  1IAE A;  2MZE A;  1G9K A;  2O3E A;  4DF9 A;  1Q3A A;  3EHY A;  1R55 A;  1DTH A;  2YB9 A;  2RJP A;  1RMZ A;  2J0T A;  3O64 A;  1BSW A;  2WOA A;  1MNC A;  3F17 A;  3N2V A;  2V4B A;  1BQO A;  1MMB A;  1R54 A;  2HU6 A;  4ZR5 A;  4H76 A;  3LJZ A;  2AIG P;  3GBO A;  5I2Z A;  5D1T A;  1BZS A;  3EWJ A;  2A8H A;  4ILW D;  456C A;  4FXY P;  4WZV A;  4XM7 A;  1CXV A;  1K7Q A;  5D1U A;  5B5P A;  2MZI A;  1G05 A;  4H2E A;  3ZUK A;  1AYK A;  3KWV C;  2MZH A;  3F15 A;  3LEA A;  4H30 A;  2Y6C A;  1QJI A;  1PWW A;  2MLR A;  4GWM A;  3KMC A;  4IUW A;  1PWU A;  1ZP5 A;  1CK7 A;  3F19 A;  3BA0 A;  1ND1 A;  3DWB A;  5L7F A;  2TCL A;  1JAN A;  2DW0 A;  1OO9 A;  4XM8 A;  1D7X A;  2RJQ A;  3ZXH A;  1QIC A;  1AKL A;  3LUN A;  2PJT A;  4GUY A;  4IJO A;  1KUF A;  1XFY A;  2ERQ A;  1BKC E;  3Q2H A;  2ERP A;  1XUD A;  4EFS A;  1JH1 A;  2I47 A;  4GWN A;  1KUK A;  2POJ A;  4PKQ A;  3K7L A;  1S4B P;  2L0R A;  5I43 A;  1ZTQ A;  1JKY A;  4JQG A;  4XM6 A;  2OI0 A;  1YOU A;  4WK7 A;  1C7K A;  1GO8 P;  1L6J A;  1D5J A;  2W12 A;  3HBV P;  1BKC A;  1BM6 A;  1R1I A;  1K7I A;  3DPF A;  4H49 A;  2FV5 A;  2X3C A;  3MA2 A;  1Y0V A;  2SRT A;  2WO8 A;  4JP4 A;  5D1S A;  3VI1 A;  3K7N A;  3LUM A;  1B8Y A;  1KUG A;  3DNG A;  3LGP A;  4GQL A;  1OM7 A;  1CQR A;  3EDI A;  1A85 A;  1SLM A;  3F16 A;  1BUD A;  2DDF A;  3TS4 A;  3VTG A;  1G49 A;  3LQB A;  4QKZ A;  3SHI A;  3AYK A;  1BUV M;  3TVC A;  3F18 A;  4DV8 A;  2Y6D A;  3LIK A;  4PKR A;  4H84 A;  1MMR A;  1Y8J A;  1JAO A;  1QIB A;  1SMP A;  1FBL A;  5L79 A;  4CTH A;  2X3B A;  4L19 A;  3KME A;  1EUB A;  5CUH A;  4HMA A;  4WF6 A;  4DD8 A;  1PWP A;  3N2U A;  1C3I A;  1I76 A;  3G42 A;  1GO7 P;  1UEA A;  3V96 B;  1IAB A;  1SU3 A;  3LMC A;  1KBC A;  1BQQ M;  3HYG A;  4AXQ A;  1USN A;  3OHO A;  5I12 A;  3LJT A;  5CXA A;  4A3W A;  1ATL A;  3USN A;  2W13 A;  1OMJ A;  1XUR A;  1GE5 A;  3KHI A;  2OW0 A;  5JMY A;  1CGL A;  4DPE A;  4AIG A;  4AYK A;  1YP1 A;  5B5O A;  1OS9 A;  3DL1 A;  1I1I P;  3L0T A;  3EDZ A;  4HX3 A;  2OW9 A;  1JK3 A;  1J7N A;  3LJG A;  1Y93 A;  966C A;  4FVL A;  3I7I A;  3LIR A;  1KUI A;  1HFC A;  3CKI A;  3TT4 A;  2DW2 A;  1SAT A;  5CZM A;  1ZS0 A;  1CGE A;  1XFU A;  1IAG A;  4PKT A;  4AUO A;  3O2X A;  5BOT A;  4L6T A;  1JIW P;  3WV1 A;  2OY4 A;  2Z2D A;  2JIH A;  5D3C A;  1R1H A;  5I0L A;  1OS2 A;  4G0D A;  2D1N A;  2KRJ A;  1RM8 A;  2QPJ A;  1AST A;  1O0T A;  2N8R A;  1SRP A;  4ON1 A;  3Q2G A;  4XBH A;  2DW1 A;  2O36 A;  4G9L A;  1BIW A;  4R3V A;  1QIA A;  2DDY A;  1UTT A;  1HOV A;  1IAC A;  1ZXC A;  3KEC A;  2X7M A;  2K2G A;  3LK8 A;  2J83 A;  2ERO A;  4GR3 A;  3TSK A;  4XCT A;  4I35 A;  3F1A A;  5D7W A;  4PKS A;  3HDA P;  1QJJ A;  1D8M A;  2OW2 A;  2XS3 A;  2W14 A;  1HY7 A;  4PKW A;  1ZXV A;  2OXU A;  1WNI A;  3EDH A;  1MMP A;  3DPE A;  2OXZ A;  1XUC A;  1KAP P;  1PWV A;  2D1O A;  3HY7 A;  3KEK A;  1JAQ A;  1SLN A;  3LKA A;  4GR8 A;  1G12 A;  3KRY A;  4L63 A;  2OVZ A;  1GE7 A;  4WKI A;  3WV3 A;  1XFW A;  5I4O A;  5BOY A;  3RTT A;  4IN9 A;  1OM6 A;  3EHX A;  1GXD A;  1EAK A;  1D8F A;  1GKD A;  2MLS A;  2OZR A;  4A7B A;  3EDG A;  1CAQ A;  2X3A A;  3UVC A;  2W15 A;  1YCM A;  1PWQ A;  3OHL A;  4JIJ A;  4WKE A;  1YQY A;  5I3M A;  3L0V A;  2E2D A;  2JT5 A;  5BPA A;  1GKC A;  1IAA A;  4PKU A;  1C8T A;  3G5C A;  4GF1 A;  4H3X A;  2OY2 A;  4Q1L A;  4JA1 A;  1G4K A;  5LAB A;  1IAD A;  4FU4 A;  3RTS A;  2USN A;  3WV2 A;  2AYK A;  1H71 P;  3LE9 A;  1CGF A;  1HV5 A;  1HTD A;  3HBU P; 
#chains in the Genus database with same CATH topology
 1JAP A;  3DSL A;  1OM8 A;  3AYU A;  3AIG A;  2K9C A;  2E3X A;  2WO9 A;  1XFZ A;  1JJ9 A;  2OVX A;  1UTZ A;  3HB2 P;  1R1J A;  1MMQ A;  3ELM A;  5H8X A;  3HY9 A;  4H82 A;  1JIZ A;  1UMS A;  2OXW A;  1DMT A;  2YIG A;  830C A;  2OW1 A;  1QUA A;  1FLS A;  1XFX A;  2CKI A;  1EB6 A;  4I03 A;  3U1R A;  4H1Q A;  1FM1 A;  3B8Z A;  3NX7 A;  2JNP A;  5D2B A;  4J4M A;  1O0Q A;  1AF0 A;  3I7G A;  1ROS A;  2XS4 A;  3HDB A;  2JSD A;  2CLT A;  4PKV A;  1Z3J A;  1UMT A;  3LQ0 A;  4GR0 A;  1XFV A;  1CIZ A;  3KEJ A;  4JPA A;  2FV9 A;  3B92 A;  1A86 A;  1HFS A;  1KUH A;  3B2Z A;  3P24 A;  1B3D A;  1I73 A;  3LIL A;  3ZVS A;  2W0D A;  1K7G A;  1ZVX A;  3E8R A;  4FXQ A;  1GE6 A;  2JT6 A;  3P1V A;  1BKC I;  1IAE A;  2MZE A;  1G9K A;  2O3E A;  4DF9 A;  1Q3A A;  3EHY A;  1R55 A;  1DTH A;  2YB9 A;  2RJP A;  1RMZ A;  2J0T A;  3O64 A;  1BSW A;  2WOA A;  1MNC A;  3F17 A;  3N2V A;  2V4B A;  1BQO A;  1MMB A;  1R54 A;  2HU6 A;  4ZR5 A;  4H76 A;  3LJZ A;  2AIG P;  3GBO A;  5I2Z A;  5D1T A;  1BZS A;  3EWJ A;  2A8H A;  4ILW D;  456C A;  4FXY P;  4WZV A;  4XM7 A;  1CXV A;  1K7Q A;  5D1U A;  5B5P A;  2MZI A;  1G05 A;  4H2E A;  3ZUK A;  1AYK A;  3KWV C;  2MZH A;  1XAX A;  3F15 A;  3LEA A;  4H30 A;  2Y6C A;  1QJI A;  1PWW A;  2MLR A;  4GWM A;  3KMC A;  4IUW A;  1PWU A;  1ZP5 A;  1CK7 A;  3F19 A;  3BA0 A;  1ND1 A;  3DWB A;  5L7F A;  2TCL A;  1JAN A;  2DW0 A;  1OO9 A;  4XM8 A;  4L7A A;  1D7X A;  2RJQ A;  3ZXH A;  1QIC A;  1AKL A;  3LUN A;  2PJT A;  4GUY A;  4IJO A;  1KUF A;  1XFY A;  2ERQ A;  1BKC E;  3Q2H A;  2ERP A;  1XUD A;  4EFS A;  1JH1 A;  2I47 A;  4GWN A;  1KUK A;  2POJ A;  4PKQ A;  3K7L A;  1S4B P;  2L0R A;  5I43 A;  1ZTQ A;  1JKY A;  4JQG A;  3DTK A;  4XM6 A;  2OI0 A;  1YOU A;  4WK7 A;  1C7K A;  1GO8 P;  1L6J A;  1D5J A;  2W12 A;  3HBV P;  1BKC A;  1TVI A;  1BM6 A;  1R1I A;  1K7I A;  3DPF A;  4H49 A;  2FV5 A;  2X3C A;  3MA2 A;  1Y0V A;  2SRT A;  2WO8 A;  4JP4 A;  5D1S A;  3VI1 A;  3K7N A;  3LUM A;  1B8Y A;  1KUG A;  3DNG A;  3LGP A;  4GQL A;  1OM7 A;  1CQR A;  3EDI A;  1A85 A;  1SLM A;  3F16 A;  1BUD A;  2DDF A;  3TS4 A;  3VTG A;  1G49 A;  3LQB A;  4QKZ A;  3SHI A;  3AYK A;  1BUV M;  3TVC A;  3F18 A;  4DV8 A;  2Y6D A;  3LIK A;  4PKR A;  4H84 A;  1MMR A;  1Y8J A;  1JAO A;  1QIB A;  1SMP A;  1FBL A;  5L79 A;  4CTH A;  2X3B A;  4L19 A;  3KME A;  1EUB A;  5CUH A;  4HMA A;  4WF6 A;  4DD8 A;  1PWP A;  3N2U A;  1C3I A;  1I76 A;  2YUF A;  3G42 A;  1GO7 P;  1UEA A;  3V96 B;  1IAB A;  1SU3 A;  3LMC A;  1KBC A;  1BQQ M;  3HYG A;  4AXQ A;  1USN A;  3OHO A;  5I12 A;  3LJT A;  5CXA A;  4A3W A;  1ATL A;  3USN A;  2W13 A;  1OMJ A;  1XUR A;  1GE5 A;  3KHI A;  2OW0 A;  5JMY A;  1CGL A;  4DPE A;  4AIG A;  4AYK A;  1YP1 A;  5B5O A;  1OS9 A;  3DL1 A;  1I1I P;  3L0T A;  3EDZ A;  4HX3 A;  2OW9 A;  1JK3 A;  1J7N A;  3LJG A;  1Y93 A;  966C A;  4FVL A;  3I7I A;  3LIR A;  1KUI A;  1HFC A;  3CKI A;  3TT4 A;  2DW2 A;  1XM5 A;  1SAT A;  5CZM A;  1ZS0 A;  1CGE A;  1XFU A;  1IAG A;  4PKT A;  4AUO A;  3O2X A;  5BOT A;  4L6T A;  1JIW P;  3WV1 A;  2OY4 A;  2Z2D A;  2JIH A;  5D3C A;  1R1H A;  5I0L A;  1OS2 A;  4G0D A;  2D1N A;  2KRJ A;  1RM8 A;  2QPJ A;  1AST A;  1O0T A;  2N8R A;  1SRP A;  4ON1 A;  3Q2G A;  4XBH A;  2DW1 A;  2O36 A;  4G9L A;  1BIW A;  4R3V A;  1QIA A;  2DDY A;  1UTT A;  1HOV A;  1IAC A;  1ZXC A;  3KEC A;  2X7M A;  2K2G A;  3LK8 A;  2J83 A;  3DTI A;  2ERO A;  4GR3 A;  3TSK A;  4XCT A;  4I35 A;  3F1A A;  5D7W A;  4PKS A;  3HDA P;  1QJJ A;  1D8M A;  2OW2 A;  2XS3 A;  2W14 A;  1HY7 A;  4PKW A;  1ZXV A;  2OXU A;  1WNI A;  3EDH A;  1MMP A;  3DPE A;  2OXZ A;  1XUC A;  1KAP P;  1PWV A;  2D1O A;  3HY7 A;  3KEK A;  1JAQ A;  1SLN A;  3LKA A;  1OZ9 A;  4GR8 A;  1G12 A;  3KRY A;  4L63 A;  2OVZ A;  1GE7 A;  4WKI A;  3WV3 A;  1XFW A;  5I4O A;  5BOY A;  3DTE A;  3RTT A;  4IN9 A;  1OM6 A;  3EHX A;  1GXD A;  1EAK A;  1D8F A;  1GKD A;  2MLS A;  2OZR A;  4A7B A;  3EDG A;  1CAQ A;  2X3A A;  3UVC A;  2W15 A;  1YCM A;  1PWQ A;  3OHL A;  4JIJ A;  4WKE A;  1YQY A;  5I3M A;  3L0V A;  2E2D A;  2JT5 A;  5BPA A;  1GKC A;  1IAA A;  4PKU A;  1C8T A;  3G5C A;  4GF1 A;  4H3X A;  2OY2 A;  4Q1L A;  4JA1 A;  1G4K A;  5LAB A;  1IAD A;  4FU4 A;  3RTS A;  2USN A;  3WV2 A;  2AYK A;  1H71 P;  3LE9 A;  1CGF A;  1HV5 A;  1HTD A;  3HBU P; 
#chains in the Genus database with same CATH homology
 1JAP A;  3DSL A;  1OM8 A;  3AYU A;  3AIG A;  2K9C A;  2E3X A;  2WO9 A;  1XFZ A;  1JJ9 A;  2OVX A;  1UTZ A;  3HB2 P;  1R1J A;  1MMQ A;  3ELM A;  5H8X A;  3HY9 A;  4H82 A;  1JIZ A;  1UMS A;  2OXW A;  1DMT A;  2YIG A;  830C A;  2OW1 A;  1QUA A;  1FLS A;  1XFX A;  2CKI A;  1EB6 A;  4I03 A;  3U1R A;  4H1Q A;  1FM1 A;  3B8Z A;  3NX7 A;  2JNP A;  5D2B A;  4J4M A;  1O0Q A;  1AF0 A;  3I7G A;  1ROS A;  2XS4 A;  3HDB A;  2JSD A;  2CLT A;  4PKV A;  1Z3J A;  1UMT A;  3LQ0 A;  4GR0 A;  1XFV A;  1CIZ A;  3KEJ A;  4JPA A;  2FV9 A;  3B92 A;  1A86 A;  1HFS A;  1KUH A;  3B2Z A;  3P24 A;  1B3D A;  1I73 A;  3LIL A;  3ZVS A;  2W0D A;  1K7G A;  1ZVX A;  3E8R A;  4FXQ A;  1GE6 A;  2JT6 A;  3P1V A;  1BKC I;  1IAE A;  2MZE A;  1G9K A;  2O3E A;  4DF9 A;  1Q3A A;  3EHY A;  1R55 A;  1DTH A;  2YB9 A;  2RJP A;  1RMZ A;  2J0T A;  3O64 A;  1BSW A;  2WOA A;  1MNC A;  3F17 A;  3N2V A;  2V4B A;  1BQO A;  1MMB A;  1R54 A;  2HU6 A;  4ZR5 A;  4H76 A;  3LJZ A;  2AIG P;  3GBO A;  5I2Z A;  5D1T A;  1BZS A;  3EWJ A;  2A8H A;  4ILW D;  456C A;  4FXY P;  4WZV A;  4XM7 A;  1CXV A;  1K7Q A;  5D1U A;  5B5P A;  2MZI A;  1G05 A;  4H2E A;  3ZUK A;  1AYK A;  3KWV C;  2MZH A;  3F15 A;  3LEA A;  4H30 A;  2Y6C A;  1QJI A;  1PWW A;  2MLR A;  4GWM A;  3KMC A;  4IUW A;  1PWU A;  1ZP5 A;  1CK7 A;  3F19 A;  3BA0 A;  1ND1 A;  3DWB A;  5L7F A;  2TCL A;  1JAN A;  2DW0 A;  1OO9 A;  4XM8 A;  4L7A A;  1D7X A;  2RJQ A;  3ZXH A;  1QIC A;  1AKL A;  3LUN A;  2PJT A;  4GUY A;  4IJO A;  1KUF A;  1XFY A;  2ERQ A;  1BKC E;  3Q2H A;  2ERP A;  1XUD A;  4EFS A;  1JH1 A;  2I47 A;  4GWN A;  1KUK A;  2POJ A;  4PKQ A;  3K7L A;  1S4B P;  2L0R A;  5I43 A;  1ZTQ A;  1JKY A;  4JQG A;  3DTK A;  4XM6 A;  2OI0 A;  1YOU A;  4WK7 A;  1C7K A;  1GO8 P;  1L6J A;  1D5J A;  2W12 A;  3HBV P;  1BKC A;  1BM6 A;  1R1I A;  1K7I A;  3DPF A;  4H49 A;  2FV5 A;  2X3C A;  3MA2 A;  1Y0V A;  2SRT A;  2WO8 A;  4JP4 A;  5D1S A;  3VI1 A;  3K7N A;  3LUM A;  1B8Y A;  1KUG A;  3DNG A;  3LGP A;  4GQL A;  1OM7 A;  1CQR A;  3EDI A;  1A85 A;  1SLM A;  3F16 A;  1BUD A;  2DDF A;  3TS4 A;  3VTG A;  1G49 A;  3LQB A;  4QKZ A;  3SHI A;  3AYK A;  1BUV M;  3TVC A;  3F18 A;  4DV8 A;  2Y6D A;  3LIK A;  4PKR A;  4H84 A;  1MMR A;  1Y8J A;  1JAO A;  1QIB A;  1SMP A;  1FBL A;  5L79 A;  4CTH A;  2X3B A;  4L19 A;  3KME A;  1EUB A;  5CUH A;  4HMA A;  4WF6 A;  4DD8 A;  1PWP A;  3N2U A;  1C3I A;  1I76 A;  2YUF A;  3G42 A;  1GO7 P;  1UEA A;  3V96 B;  1IAB A;  1SU3 A;  3LMC A;  1KBC A;  1BQQ M;  3HYG A;  4AXQ A;  1USN A;  3OHO A;  5I12 A;  3LJT A;  5CXA A;  4A3W A;  1ATL A;  3USN A;  2W13 A;  1OMJ A;  1XUR A;  1GE5 A;  3KHI A;  2OW0 A;  5JMY A;  1CGL A;  4DPE A;  4AIG A;  4AYK A;  1YP1 A;  5B5O A;  1OS9 A;  3DL1 A;  1I1I P;  3L0T A;  3EDZ A;  4HX3 A;  2OW9 A;  1JK3 A;  1J7N A;  3LJG A;  1Y93 A;  966C A;  4FVL A;  3I7I A;  3LIR A;  1KUI A;  1HFC A;  3CKI A;  3TT4 A;  2DW2 A;  1SAT A;  5CZM A;  1ZS0 A;  1CGE A;  1XFU A;  1IAG A;  4PKT A;  4AUO A;  3O2X A;  5BOT A;  4L6T A;  1JIW P;  3WV1 A;  2OY4 A;  2Z2D A;  2JIH A;  5D3C A;  1R1H A;  5I0L A;  1OS2 A;  4G0D A;  2D1N A;  2KRJ A;  1RM8 A;  2QPJ A;  1AST A;  1O0T A;  2N8R A;  1SRP A;  4ON1 A;  3Q2G A;  4XBH A;  2DW1 A;  2O36 A;  4G9L A;  1BIW A;  4R3V A;  1QIA A;  2DDY A;  1UTT A;  1HOV A;  1IAC A;  1ZXC A;  3KEC A;  2X7M A;  2K2G A;  3LK8 A;  2J83 A;  3DTI A;  2ERO A;  4GR3 A;  3TSK A;  4XCT A;  4I35 A;  3F1A A;  5D7W A;  4PKS A;  3HDA P;  1QJJ A;  1D8M A;  2OW2 A;  2XS3 A;  2W14 A;  1HY7 A;  4PKW A;  1ZXV A;  2OXU A;  1WNI A;  3EDH A;  1MMP A;  3DPE A;  2OXZ A;  1XUC A;  1KAP P;  1PWV A;  2D1O A;  3HY7 A;  3KEK A;  1JAQ A;  1SLN A;  3LKA A;  4GR8 A;  1G12 A;  3KRY A;  4L63 A;  2OVZ A;  1GE7 A;  4WKI A;  3WV3 A;  1XFW A;  5I4O A;  5BOY A;  3DTE A;  3RTT A;  4IN9 A;  1OM6 A;  3EHX A;  1GXD A;  1EAK A;  1D8F A;  1GKD A;  2MLS A;  2OZR A;  4A7B A;  3EDG A;  1CAQ A;  2X3A A;  3UVC A;  2W15 A;  1YCM A;  1PWQ A;  3OHL A;  4JIJ A;  4WKE A;  1YQY A;  5I3M A;  3L0V A;  2E2D A;  2JT5 A;  5BPA A;  1GKC A;  1IAA A;  4PKU A;  1C8T A;  3G5C A;  4GF1 A;  4H3X A;  2OY2 A;  4Q1L A;  4JA1 A;  1G4K A;  5LAB A;  1IAD A;  4FU4 A;  3RTS A;  2USN A;  3WV2 A;  2AYK A;  1H71 P;  3LE9 A;  1CGF A;  1HV5 A;  1HTD A;  3HBU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...