4H84A

Crystal structure of the catalytic domain of human mmp12 in complex with a selective carboxylate based inhibitor.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
b'MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h84A00
1QJJA 1ATLA 1SRPA 4EFSA 1OM7A 1JANA 2EROA 2RJPA 1GO7P 5CUHA 2K2GA 4ZR5A 3DSLA 3KMCA 1J7NA 1Y8JA 2POJA 4DD8A 2E2DA 1XURA 5B5PA 1K7IA 3LMCA 4PKUA 2K9CA 1OS2A 4HX3A 1GE6A 5L79A 3B8ZA 3SHIA 1KUGA 1UEAA 2D1OA 4GUYA 1GKCA 1KUKA 3MA2A 3KRYA 2USNA 1JIWP 2MZEA 3EDHA 4WKEA 1BM6A 4IUWA 4H76A 3LJTA 2AYKA 2D1NA 1CXVA 1ND1A 1B3DA 3N2VA 2CKIA 3ZVSA 5H8XA 5D3CA 2Z2DA 1ZP5A 4H84A 4R3VA 3TVCA 1BZSA 1PWUA 1KUIA 2YB9A 2FV9A 1BQQM 1OM8A 1IABA 3EWJA 5I4OA 3HY7A 3DL1A 1MMQA 4PKWA 4XM6A 1XFWA 1G9KA 1HV5A 1SU3A 3DWBA 4JPAA 4H49A 4JA1A 2JNPA 2MZHA 2MZIA 2OW9A 1GKDA 2OZRA 3P1VA 1GE7A 1DMTA 2DW2A 3HBVP 2X3AA 4PKQA 1PWPA 3KWVC 2L0RA 3NX7A 4WF6A 1HOVA 1XFUA 3LQBA 1YQYA 1SATA 4DF9A 1UMSA 2DDYA 1PWWA 1I1IP 1QJIA 5B5OA 1KAPP 1IAAA 3VI1A 3LUNA 4PKTA 1G49A 4HMAA 1L6JA 1CIZA 3I7GA 1BKCA 1CGLA 2X7MA 4GR0A 1JAOA 1DTHA 1ROSA 1R54A 4FXYP 4GQLA 4FU4A 1UMTA 3LIRA 1PWQA 3V96B 1O0TA 3WV1A 3Q2HA 2CLTA 1BUVM 4DV8A 4H2EA 3G42A 1I76A 2WO9A 3BA0A 4PKRA 3F1AA 2ERPA 4GR8A 1FBLA 1XFXA 3LEAA 4PKSA 1Y93A 3KMEA 5D1TA 3EHYA 5D2BA 4L63A 3F16A 1QUAA 3K7NA 1JAPA 3KEJA 1OM6A 2JSDA 4GWMA 2X3BA 1USNA 2OY4A 3LKAA 3F19A 2XS3A 2DDFA 3N2UA 2HU6A 4JQGA 2RJQA 1G4KA 2WO8A 3HDAP 4H82A 4FVLA 5LABA 2O36A 3KHIA 1EB6A 2E3XA 5D1SA 1OO9A 4GF1A 2O3EA 4AIGA 2DW0A 3RTTA 4I35A 1AKLA 966CA 1MMBA 3WV3A 1ZS0A 1Y0VA 1G05A 3O2XA 4JP4A 2JT5A 2DW1A 2QPJA 1R1HA 3UVCA 1A85A 2Y6DA 4J4MA 1XUDA 5I12A 3L0VA 1BQOA 1D8MA 1BKCI 1PWVA 4ILWD 5CZMA 2OVZA 1R55A 1A86A 2MLSA 4IN9A 3KECA 1MMPA 2TCLA 3RTSA 4A3WA 1SLMA 2X3CA 2JT6A 4L19A 4G0DA 1K7QA 1MNCA 1ZXCA 3GBOA 2W0DA 3F18A 3K7LA 4FXQA 2N8RA 3B92A 2OI0A 4H3XA 3LUMA 1R1JA 4XM7A 3Q2GA 1EUBA 3LIKA 3TSKA 5I43A 1CAQA 2OXZA 2W15A 1C8TA 4XCTA 2OW0A 1GE5A 3F17A 1GO8P 3L0TA 1CGFA 4GR3A 3LQ0A 1UTTA 1HFCA 3CKIA 3DNGA 3VTGA 1D5JA 4CTHA 1JIZA 2XS4A 1OS9A 1EAKA 3LILA 2WOAA 2FV5A 3KEKA 1CGEA 1CK7A 1BUDA 3LK8A 2J0TA 1XFYA 1O0QA 2ERQA 3O64A 3HDBA 1JJ9A 4GWNA 4G9LA 3EHXA 4DPEA 3G5CA 1AYKA 1C7KA 1QIAA 5I3MA 1KUHA 2OXWA 4AXQA 4WK7A 1FM1A 1FLSA 3EDGA 5BOTA 2MLRA 1KBCA 3WV2A 1GXDA 5I0LA 1SLNA 3HYGA 3TS4A 1ZVXA 1OMJA 4WKIA 3DPEA 4IJOA 3AYKA 5D1UA 1IAGA 1YP1A 1JKYA 4AUOA 1CQRA 1JH1A 1G12A 1ZXVA 4L6TA 2OW1A 4QKZA 3AYUA 3E8RA 3LGPA 3I7IA 2PJTA 3U1RA 3USNA 1AF0A 2W13A 1XFVA 2SRTA 1RMZA 1B8YA 2Y6CA 4ON1A 2J83A 3LJGA 3LJZA 4AYKA 1HTDA 1UTZA 4WZVA 2OY2A 3P24A 3OHOA 1IACA 1D8FA 3HBUP 3AIGA 1JK3A 2OW2A 456CA 1ZTQA 3OHLA 1S4BP 4JIJA 1K7GA 2OXUA 2AIGP 4XBHA 1BSWA 3ZUKA 1QICA 1MMRA 1WNIA 4I03A 1QIBA 1RM8A 2W14A 1BKCE 1SMPA 3ZXHA 5JMYA 5CXAA 3F15A 1JAQA 3HY9A 3LE9A 5D7WA 3DPFA 2YIGA 3B2ZA 1HY7A 1BIWA 1I73A 830CA 1XUCA 4A7BA 3TT4A 1ASTA 1Z3JA 5BOYA 5I2ZA 1Q3AA 4H30A 2OVXA 4H1QA 2I47A 1R1IA 4PKVA 2KRJA 1H71P 1YOUA 3ELMA 1IADA 4XM8A 1KUFA 2JIHA 4Q1LA 5BPAA 3EDIA 1IAEA 2V4BA 3HB2P 2W12A 1C3IA 1D7XA 1XFZA 2A8HA 5L7FA 3EDZA 1YCMA 1HFSA
chains in the Genus database with same CATH superfamily
1QJJA 1ATLA 1SRPA 4EFSA 1OM7A 1JANA 2EROA 2RJPA 1GO7P 5CUHA 2K2GA 4ZR5A 3DSLA 3KMCA 1J7NA 1Y8JA 2POJA 4DD8A 2E2DA 1XURA 5B5PA 1K7IA 3LMCA 4PKUA 3DTKA 2K9CA 1OS2A 4HX3A 1GE6A 5L79A 3B8ZA 3SHIA 1KUGA 1UEAA 2D1OA 4GUYA 1GKCA 1KUKA 3MA2A 3KRYA 2USNA 1JIWP 2MZEA 3EDHA 4WKEA 1BM6A 4IUWA 4H76A 3LJTA 2AYKA 2D1NA 1CXVA 1ND1A 1B3DA 3N2VA 2CKIA 3ZVSA 5H8XA 5D3CA 2Z2DA 1ZP5A 4H84A 4R3VA 3TVCA 1BZSA 1PWUA 1KUIA 2YB9A 2FV9A 1BQQM 1OM8A 1IABA 3EWJA 5I4OA 3HY7A 3DL1A 1MMQA 4PKWA 4XM6A 1XFWA 1G9KA 4L7AA 1HV5A 1SU3A 3DWBA 4JPAA 4H49A 4JA1A 2JNPA 2MZHA 2MZIA 2OW9A 1GKDA 2OZRA 3P1VA 1GE7A 1DMTA 2DW2A 3HBVP 2X3AA 4PKQA 1PWPA 3KWVC 2L0RA 3NX7A 4WF6A 1HOVA 1XFUA 3LQBA 1YQYA 1SATA 4DF9A 1UMSA 2DDYA 1PWWA 1I1IP 1QJIA 5B5OA 1KAPP 1IAAA 3VI1A 3LUNA 4PKTA 1G49A 4HMAA 1L6JA 1CIZA 3I7GA 1BKCA 1CGLA 2X7MA 4GR0A 1JAOA 1DTHA 1ROSA 1R54A 4FXYP 4GQLA 4FU4A 1UMTA 3LIRA 1PWQA 3V96B 1O0TA 3WV1A 3Q2HA 2CLTA 1BUVM 4DV8A 4H2EA 3G42A 1I76A 2WO9A 3BA0A 4PKRA 3F1AA 2ERPA 4GR8A 1FBLA 1XFXA 3LEAA 4PKSA 1Y93A 3KMEA 5D1TA 3EHYA 5D2BA 4L63A 3F16A 1QUAA 3K7NA 1JAPA 3KEJA 1OM6A 2JSDA 4GWMA 2X3BA 1USNA 2OY4A 3LKAA 3F19A 2XS3A 2DDFA 3N2UA 2HU6A 4JQGA 2RJQA 1G4KA 2WO8A 3HDAP 4H82A 4FVLA 5LABA 2O36A 3KHIA 1EB6A 2E3XA 5D1SA 1OO9A 4GF1A 2O3EA 4AIGA 2DW0A 3RTTA 4I35A 1AKLA 966CA 1MMBA 3WV3A 1ZS0A 1Y0VA 1G05A 3DTEA 3O2XA 4JP4A 2JT5A 1TVIA 2DW1A 2QPJA 1R1HA 3UVCA 1A85A 2Y6DA 4J4MA 1XUDA 5I12A 3L0VA 1BQOA 1D8MA 1BKCI 1PWVA 4ILWD 5CZMA 2OVZA 1R55A 1A86A 2MLSA 4IN9A 3KECA 1MMPA 2TCLA 3RTSA 4A3WA 1SLMA 2X3CA 2JT6A 4L19A 4G0DA 1K7QA 1MNCA 1ZXCA 3GBOA 2W0DA 3F18A 3K7LA 4FXQA 2N8RA 3B92A 2OI0A 4H3XA 3LUMA 1R1JA 4XM7A 3Q2GA 1EUBA 3LIKA 3TSKA 5I43A 1CAQA 2OXZA 2W15A 1C8TA 1OZ9A 4XCTA 2OW0A 1GE5A 3F17A 1GO8P 3L0TA 1CGFA 4GR3A 3LQ0A 1UTTA 1HFCA 3CKIA 3DNGA 3VTGA 1D5JA 4CTHA 1JIZA 2XS4A 1OS9A 1EAKA 3LILA 2WOAA 2FV5A 3KEKA 1CGEA 1CK7A 1BUDA 3LK8A 2J0TA 1XFYA 1O0QA 2ERQA 3O64A 3HDBA 1JJ9A 4GWNA 4G9LA 3EHXA 4DPEA 3G5CA 1AYKA 1C7KA 1QIAA 5I3MA 1KUHA 2OXWA 4AXQA 4WK7A 1FM1A 1FLSA 3EDGA 5BOTA 2MLRA 1KBCA 3WV2A 1GXDA 5I0LA 1SLNA 3HYGA 3TS4A 1ZVXA 1OMJA 4WKIA 3DPEA 4IJOA 3AYKA 5D1UA 1IAGA 1YP1A 1JKYA 4AUOA 1CQRA 1JH1A 1G12A 1ZXVA 4L6TA 2OW1A 4QKZA 3AYUA 3E8RA 3LGPA 3I7IA 2PJTA 3U1RA 3USNA 1AF0A 2W13A 1XFVA 2SRTA 1RMZA 1B8YA 2Y6CA 4ON1A 2J83A 3LJGA 3LJZA 2YUFA 4AYKA 1HTDA 1UTZA 4WZVA 2OY2A 3P24A 3OHOA 1IACA 1D8FA 3HBUP 3AIGA 1JK3A 2OW2A 456CA 1ZTQA 3OHLA 1S4BP 4JIJA 1K7GA 2OXUA 2AIGP 4XBHA 1BSWA 3ZUKA 1QICA 1MMRA 1WNIA 4I03A 1QIBA 1RM8A 2W14A 1XM5A 1BKCE 1SMPA 3ZXHA 5JMYA 5CXAA 3F15A 1JAQA 3HY9A 3LE9A 5D7WA 3DPFA 2YIGA 3B2ZA 1HY7A 1BIWA 1I73A 830CA 1XUCA 4A7BA 3TT4A 1ASTA 1Z3JA 5BOYA 5I2ZA 1Q3AA 4H30A 1XAXA 2OVXA 4H1QA 2I47A 1R1IA 4PKVA 2KRJA 1H71P 1YOUA 3ELMA 3DTIA 1IADA 4XM8A 1KUFA 2JIHA 4Q1LA 5BPAA 3EDIA 1IAEA 2V4BA 3HB2P 2W12A 1C3IA 1D7XA 1XFZA 2A8HA 5L7FA 3EDZA 1YCMA 1HFSA
chains in the Genus database with same CATH topology
1QJJA 1ATLA 1SRPA 4EFSA 1OM7A 1JANA 2EROA 2RJPA 1GO7P 5CUHA 2K2GA 4ZR5A 3DSLA 3KMCA 1J7NA 1Y8JA 2POJA 4DD8A 2E2DA 1XURA 5B5PA 1K7IA 3LMCA 4PKUA 3DTKA 2K9CA 1OS2A 4HX3A 1GE6A 5L79A 3B8ZA 3SHIA 1KUGA 1UEAA 2D1OA 4GUYA 1GKCA 1KUKA 3MA2A 3KRYA 2USNA 1JIWP 2MZEA 3EDHA 4WKEA 1BM6A 4IUWA 4H76A 3LJTA 2AYKA 2D1NA 1CXVA 1ND1A 1B3DA 3N2VA 2CKIA 3ZVSA 5H8XA 5D3CA 2Z2DA 1ZP5A 4H84A 4R3VA 3TVCA 1BZSA 1PWUA 1KUIA 2YB9A 2FV9A 1BQQM 1OM8A 1IABA 3EWJA 5I4OA 3HY7A 3DL1A 1MMQA 4PKWA 4XM6A 1XFWA 1G9KA 4L7AA 1HV5A 1SU3A 3DWBA 4JPAA 4H49A 4JA1A 2JNPA 2MZHA 2MZIA 2OW9A 1GKDA 2OZRA 3P1VA 1GE7A 1DMTA 2DW2A 3HBVP 2X3AA 4PKQA 1PWPA 3KWVC 2L0RA 3NX7A 4WF6A 1HOVA 1XFUA 3LQBA 1YQYA 1SATA 4DF9A 1UMSA 2DDYA 1PWWA 1I1IP 1QJIA 5B5OA 1KAPP 1IAAA 3VI1A 3LUNA 4PKTA 1G49A 4HMAA 1L6JA 1CIZA 3I7GA 1BKCA 1CGLA 2X7MA 4GR0A 1JAOA 1DTHA 1ROSA 1R54A 4FXYP 4GQLA 4FU4A 1UMTA 3LIRA 1PWQA 3V96B 1O0TA 3WV1A 3Q2HA 2CLTA 1BUVM 4DV8A 4H2EA 3G42A 1I76A 2WO9A 3BA0A 4PKRA 3F1AA 2ERPA 4GR8A 1FBLA 1XFXA 3LEAA 4PKSA 1Y93A 3KMEA 5D1TA 3EHYA 5D2BA 4L63A 3F16A 1QUAA 3K7NA 1JAPA 3KEJA 1OM6A 2JSDA 4GWMA 2X3BA 1USNA 2OY4A 3LKAA 3F19A 2XS3A 2DDFA 3N2UA 2HU6A 4JQGA 2RJQA 1G4KA 2WO8A 3HDAP 4H82A 4FVLA 5LABA 2O36A 3KHIA 1EB6A 2E3XA 5D1SA 1OO9A 4GF1A 2O3EA 4AIGA 2DW0A 3RTTA 4I35A 1AKLA 966CA 1MMBA 3WV3A 1ZS0A 1Y0VA 1G05A 3DTEA 3O2XA 4JP4A 2JT5A 2DW1A 2QPJA 1R1HA 3UVCA 1A85A 2Y6DA 4J4MA 1XUDA 5I12A 3L0VA 1BQOA 1D8MA 1BKCI 1PWVA 4ILWD 5CZMA 2OVZA 1R55A 1A86A 2MLSA 4IN9A 3KECA 1MMPA 2TCLA 3RTSA 4A3WA 1SLMA 2X3CA 2JT6A 4L19A 4G0DA 1K7QA 1MNCA 1ZXCA 3GBOA 2W0DA 3F18A 3K7LA 4FXQA 2N8RA 3B92A 2OI0A 4H3XA 3LUMA 1R1JA 4XM7A 3Q2GA 1EUBA 3LIKA 3TSKA 5I43A 1CAQA 2OXZA 2W15A 1C8TA 4XCTA 2OW0A 1GE5A 3F17A 1GO8P 3L0TA 1CGFA 4GR3A 3LQ0A 1UTTA 1HFCA 3CKIA 3DNGA 3VTGA 1D5JA 4CTHA 1JIZA 2XS4A 1OS9A 1EAKA 3LILA 2WOAA 2FV5A 3KEKA 1CGEA 1CK7A 1BUDA 3LK8A 2J0TA 1XFYA 1O0QA 2ERQA 3O64A 3HDBA 1JJ9A 4GWNA 4G9LA 3EHXA 4DPEA 3G5CA 1AYKA 1C7KA 1QIAA 5I3MA 1KUHA 2OXWA 4AXQA 4WK7A 1FM1A 1FLSA 3EDGA 5BOTA 2MLRA 1KBCA 3WV2A 1GXDA 5I0LA 1SLNA 3HYGA 3TS4A 1ZVXA 1OMJA 4WKIA 3DPEA 4IJOA 3AYKA 5D1UA 1IAGA 1YP1A 1JKYA 4AUOA 1CQRA 1JH1A 1G12A 1ZXVA 4L6TA 2OW1A 4QKZA 3AYUA 3E8RA 3LGPA 3I7IA 2PJTA 3U1RA 3USNA 1AF0A 2W13A 1XFVA 2SRTA 1RMZA 1B8YA 2Y6CA 4ON1A 2J83A 3LJGA 3LJZA 2YUFA 4AYKA 1HTDA 1UTZA 4WZVA 2OY2A 3P24A 3OHOA 1IACA 1D8FA 3HBUP 3AIGA 1JK3A 2OW2A 456CA 1ZTQA 3OHLA 1S4BP 4JIJA 1K7GA 2OXUA 2AIGP 4XBHA 1BSWA 3ZUKA 1QICA 1MMRA 1WNIA 4I03A 1QIBA 1RM8A 2W14A 1BKCE 1SMPA 3ZXHA 5JMYA 5CXAA 3F15A 1JAQA 3HY9A 3LE9A 5D7WA 3DPFA 2YIGA 3B2ZA 1HY7A 1BIWA 1I73A 830CA 1XUCA 4A7BA 3TT4A 1ASTA 1Z3JA 5BOYA 5I2ZA 1Q3AA 4H30A 2OVXA 4H1QA 2I47A 1R1IA 4PKVA 2KRJA 1H71P 1YOUA 3ELMA 3DTIA 1IADA 4XM8A 1KUFA 2JIHA 4Q1LA 5BPAA 3EDIA 1IAEA 2V4BA 3HB2P 2W12A 1C3IA 1D7XA 1XFZA 2A8HA 5L7FA 3EDZA 1YCMA 1HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJJ A;  1ATL A;  1SRP A;  4EFS A;  1OM7 A;  1JAN A;  2ERO A;  2RJP A;  1GO7 P;  5CUH A;  2K2G A;  4ZR5 A;  3DSL A;  3KMC A;  1J7N A;  1Y8J A;  2POJ A;  4DD8 A;  2E2D A;  1XUR A;  5B5P A;  1K7I A;  3LMC A;  4PKU A;  2K9C A;  1OS2 A;  4HX3 A;  1GE6 A;  5L79 A;  3B8Z A;  3SHI A;  1KUG A;  1UEA A;  2D1O A;  4GUY A;  1GKC A;  1KUK A;  3MA2 A;  3KRY A;  2USN A;  1JIW P;  2MZE A;  3EDH A;  4WKE A;  1BM6 A;  4IUW A;  4H76 A;  3LJT A;  2AYK A;  2D1N A;  1CXV A;  1ND1 A;  1B3D A;  3N2V A;  2CKI A;  3ZVS A;  5H8X A;  5D3C A;  2Z2D A;  1ZP5 A;  4H84 A;  4R3V A;  3TVC A;  1BZS A;  1PWU A;  1KUI A;  2YB9 A;  2FV9 A;  1BQQ M;  1OM8 A;  1IAB A;  3EWJ A;  5I4O A;  3HY7 A;  3DL1 A;  1MMQ A;  4PKW A;  4XM6 A;  1XFW A;  1G9K A;  1HV5 A;  1SU3 A;  3DWB A;  4JPA A;  4H49 A;  4JA1 A;  2JNP A;  2MZH A;  2MZI A;  2OW9 A;  1GKD A;  2OZR A;  3P1V A;  1GE7 A;  1DMT A;  2DW2 A;  3HBV P;  2X3A A;  4PKQ A;  1PWP A;  3KWV C;  2L0R A;  3NX7 A;  4WF6 A;  1HOV A;  1XFU A;  3LQB A;  1YQY A;  1SAT A;  4DF9 A;  1UMS A;  2DDY A;  1PWW A;  1I1I P;  1QJI A;  5B5O A;  1KAP P;  1IAA A;  3VI1 A;  3LUN A;  4PKT A;  1G49 A;  4HMA A;  1L6J A;  1CIZ A;  3I7G A;  1BKC A;  1CGL A;  2X7M A;  4GR0 A;  1JAO A;  1DTH A;  1ROS A;  1R54 A;  4FXY P;  4GQL A;  4FU4 A;  1UMT A;  3LIR A;  1PWQ A;  3V96 B;  1O0T A;  3WV1 A;  3Q2H A;  2CLT A;  1BUV M;  4DV8 A;  4H2E A;  3G42 A;  1I76 A;  2WO9 A;  3BA0 A;  4PKR A;  3F1A A;  2ERP A;  4GR8 A;  1FBL A;  1XFX A;  3LEA A;  4PKS A;  1Y93 A;  3KME A;  5D1T A;  3EHY A;  5D2B A;  4L63 A;  3F16 A;  1QUA A;  3K7N A;  1JAP A;  3KEJ A;  1OM6 A;  2JSD A;  4GWM A;  2X3B A;  1USN A;  2OY4 A;  3LKA A;  3F19 A;  2XS3 A;  2DDF A;  3N2U A;  2HU6 A;  4JQG A;  2RJQ A;  1G4K A;  2WO8 A;  3HDA P;  4H82 A;  4FVL A;  5LAB A;  2O36 A;  3KHI A;  1EB6 A;  2E3X A;  5D1S A;  1OO9 A;  4GF1 A;  2O3E A;  4AIG A;  2DW0 A;  3RTT A;  4I35 A;  1AKL A;  966C A;  1MMB A;  3WV3 A;  1ZS0 A;  1Y0V A;  1G05 A;  3O2X A;  4JP4 A;  2JT5 A;  2DW1 A;  2QPJ A;  1R1H A;  3UVC A;  1A85 A;  2Y6D A;  4J4M A;  1XUD A;  5I12 A;  3L0V A;  1BQO A;  1D8M A;  1BKC I;  1PWV A;  4ILW D;  5CZM A;  2OVZ A;  1R55 A;  1A86 A;  2MLS A;  4IN9 A;  3KEC A;  1MMP A;  2TCL A;  3RTS A;  4A3W A;  1SLM A;  2X3C A;  2JT6 A;  4L19 A;  4G0D A;  1K7Q A;  1MNC A;  1ZXC A;  3GBO A;  2W0D A;  3F18 A;  3K7L A;  4FXQ A;  2N8R A;  3B92 A;  2OI0 A;  4H3X A;  3LUM A;  1R1J A;  4XM7 A;  3Q2G A;  1EUB A;  3LIK A;  3TSK A;  5I43 A;  1CAQ A;  2OXZ A;  2W15 A;  1C8T A;  4XCT A;  2OW0 A;  1GE5 A;  3F17 A;  1GO8 P;  3L0T A;  1CGF A;  4GR3 A;  3LQ0 A;  1UTT A;  1HFC A;  3CKI A;  3DNG A;  3VTG A;  1D5J A;  4CTH A;  1JIZ A;  2XS4 A;  1OS9 A;  1EAK A;  3LIL A;  2WOA A;  2FV5 A;  3KEK A;  1CGE A;  1CK7 A;  1BUD A;  3LK8 A;  2J0T A;  1XFY A;  1O0Q A;  2ERQ A;  3O64 A;  3HDB A;  1JJ9 A;  4GWN A;  4G9L A;  3EHX A;  4DPE A;  3G5C A;  1AYK A;  1C7K A;  1QIA A;  5I3M A;  1KUH A;  2OXW A;  4AXQ A;  4WK7 A;  1FM1 A;  1FLS A;  3EDG A;  5BOT A;  2MLR A;  1KBC A;  3WV2 A;  1GXD A;  5I0L A;  1SLN A;  3HYG A;  3TS4 A;  1ZVX A;  1OMJ A;  4WKI A;  3DPE A;  4IJO A;  3AYK A;  5D1U A;  1IAG A;  1YP1 A;  1JKY A;  4AUO A;  1CQR A;  1JH1 A;  1G12 A;  1ZXV A;  4L6T A;  2OW1 A;  4QKZ A;  3AYU A;  3E8R A;  3LGP A;  3I7I A;  2PJT A;  3U1R A;  3USN A;  1AF0 A;  2W13 A;  1XFV A;  2SRT A;  1RMZ A;  1B8Y A;  2Y6C A;  4ON1 A;  2J83 A;  3LJG A;  3LJZ A;  4AYK A;  1HTD A;  1UTZ A;  4WZV A;  2OY2 A;  3P24 A;  3OHO A;  1IAC A;  1D8F A;  3HBU P;  3AIG A;  1JK3 A;  2OW2 A;  456C A;  1ZTQ A;  3OHL A;  1S4B P;  4JIJ A;  1K7G A;  2OXU A;  2AIG P;  4XBH A;  1BSW A;  3ZUK A;  1QIC A;  1MMR A;  1WNI A;  4I03 A;  1QIB A;  1RM8 A;  2W14 A;  1BKC E;  1SMP A;  3ZXH A;  5JMY A;  5CXA A;  3F15 A;  1JAQ A;  3HY9 A;  3LE9 A;  5D7W A;  3DPF A;  2YIG A;  3B2Z A;  1HY7 A;  1BIW A;  1I73 A;  830C A;  1XUC A;  4A7B A;  3TT4 A;  1AST A;  1Z3J A;  5BOY A;  5I2Z A;  1Q3A A;  4H30 A;  2OVX A;  4H1Q A;  2I47 A;  1R1I A;  4PKV A;  2KRJ A;  1H71 P;  1YOU A;  3ELM A;  1IAD A;  4XM8 A;  1KUF A;  2JIH A;  4Q1L A;  5BPA A;  3EDI A;  1IAE A;  2V4B A;  3HB2 P;  2W12 A;  1C3I A;  1D7X A;  1XFZ A;  2A8H A;  5L7F A;  3EDZ A;  1YCM A;  1HFS A; 
#chains in the Genus database with same CATH topology
 1QJJ A;  1ATL A;  1SRP A;  4EFS A;  1OM7 A;  1JAN A;  2ERO A;  2RJP A;  1GO7 P;  5CUH A;  2K2G A;  4ZR5 A;  3DSL A;  3KMC A;  1J7N A;  1Y8J A;  2POJ A;  4DD8 A;  2E2D A;  1XUR A;  5B5P A;  1K7I A;  3LMC A;  4PKU A;  3DTK A;  2K9C A;  1OS2 A;  4HX3 A;  1GE6 A;  5L79 A;  3B8Z A;  3SHI A;  1KUG A;  1UEA A;  2D1O A;  4GUY A;  1GKC A;  1KUK A;  3MA2 A;  3KRY A;  2USN A;  1JIW P;  2MZE A;  3EDH A;  4WKE A;  1BM6 A;  4IUW A;  4H76 A;  3LJT A;  2AYK A;  2D1N A;  1CXV A;  1ND1 A;  1B3D A;  3N2V A;  2CKI A;  3ZVS A;  5H8X A;  5D3C A;  2Z2D A;  1ZP5 A;  4H84 A;  4R3V A;  3TVC A;  1BZS A;  1PWU A;  1KUI A;  2YB9 A;  2FV9 A;  1BQQ M;  1OM8 A;  1IAB A;  3EWJ A;  5I4O A;  3HY7 A;  3DL1 A;  1MMQ A;  4PKW A;  4XM6 A;  1XFW A;  1G9K A;  4L7A A;  1HV5 A;  1SU3 A;  3DWB A;  4JPA A;  4H49 A;  4JA1 A;  2JNP A;  2MZH A;  2MZI A;  2OW9 A;  1GKD A;  2OZR A;  3P1V A;  1GE7 A;  1DMT A;  2DW2 A;  3HBV P;  2X3A A;  4PKQ A;  1PWP A;  3KWV C;  2L0R A;  3NX7 A;  4WF6 A;  1HOV A;  1XFU A;  3LQB A;  1YQY A;  1SAT A;  4DF9 A;  1UMS A;  2DDY A;  1PWW A;  1I1I P;  1QJI A;  5B5O A;  1KAP P;  1IAA A;  3VI1 A;  3LUN A;  4PKT A;  1G49 A;  4HMA A;  1L6J A;  1CIZ A;  3I7G A;  1BKC A;  1CGL A;  2X7M A;  4GR0 A;  1JAO A;  1DTH A;  1ROS A;  1R54 A;  4FXY P;  4GQL A;  4FU4 A;  1UMT A;  3LIR A;  1PWQ A;  3V96 B;  1O0T A;  3WV1 A;  3Q2H A;  2CLT A;  1BUV M;  4DV8 A;  4H2E A;  3G42 A;  1I76 A;  2WO9 A;  3BA0 A;  4PKR A;  3F1A A;  2ERP A;  4GR8 A;  1FBL A;  1XFX A;  3LEA A;  4PKS A;  1Y93 A;  3KME A;  5D1T A;  3EHY A;  5D2B A;  4L63 A;  3F16 A;  1QUA A;  3K7N A;  1JAP A;  3KEJ A;  1OM6 A;  2JSD A;  4GWM A;  2X3B A;  1USN A;  2OY4 A;  3LKA A;  3F19 A;  2XS3 A;  2DDF A;  3N2U A;  2HU6 A;  4JQG A;  2RJQ A;  1G4K A;  2WO8 A;  3HDA P;  4H82 A;  4FVL A;  5LAB A;  2O36 A;  3KHI A;  1EB6 A;  2E3X A;  5D1S A;  1OO9 A;  4GF1 A;  2O3E A;  4AIG A;  2DW0 A;  3RTT A;  4I35 A;  1AKL A;  966C A;  1MMB A;  3WV3 A;  1ZS0 A;  1Y0V A;  1G05 A;  3DTE A;  3O2X A;  4JP4 A;  2JT5 A;  1TVI A;  2DW1 A;  2QPJ A;  1R1H A;  3UVC A;  1A85 A;  2Y6D A;  4J4M A;  1XUD A;  5I12 A;  3L0V A;  1BQO A;  1D8M A;  1BKC I;  1PWV A;  4ILW D;  5CZM A;  2OVZ A;  1R55 A;  1A86 A;  2MLS A;  4IN9 A;  3KEC A;  1MMP A;  2TCL A;  3RTS A;  4A3W A;  1SLM A;  2X3C A;  2JT6 A;  4L19 A;  4G0D A;  1K7Q A;  1MNC A;  1ZXC A;  3GBO A;  2W0D A;  3F18 A;  3K7L A;  4FXQ A;  2N8R A;  3B92 A;  2OI0 A;  4H3X A;  3LUM A;  1R1J A;  4XM7 A;  3Q2G A;  1EUB A;  3LIK A;  3TSK A;  5I43 A;  1CAQ A;  2OXZ A;  2W15 A;  1C8T A;  1OZ9 A;  4XCT A;  2OW0 A;  1GE5 A;  3F17 A;  1GO8 P;  3L0T A;  1CGF A;  4GR3 A;  3LQ0 A;  1UTT A;  1HFC A;  3CKI A;  3DNG A;  3VTG A;  1D5J A;  4CTH A;  1JIZ A;  2XS4 A;  1OS9 A;  1EAK A;  3LIL A;  2WOA A;  2FV5 A;  3KEK A;  1CGE A;  1CK7 A;  1BUD A;  3LK8 A;  2J0T A;  1XFY A;  1O0Q A;  2ERQ A;  3O64 A;  3HDB A;  1JJ9 A;  4GWN A;  4G9L A;  3EHX A;  4DPE A;  3G5C A;  1AYK A;  1C7K A;  1QIA A;  5I3M A;  1KUH A;  2OXW A;  4AXQ A;  4WK7 A;  1FM1 A;  1FLS A;  3EDG A;  5BOT A;  2MLR A;  1KBC A;  3WV2 A;  1GXD A;  5I0L A;  1SLN A;  3HYG A;  3TS4 A;  1ZVX A;  1OMJ A;  4WKI A;  3DPE A;  4IJO A;  3AYK A;  5D1U A;  1IAG A;  1YP1 A;  1JKY A;  4AUO A;  1CQR A;  1JH1 A;  1G12 A;  1ZXV A;  4L6T A;  2OW1 A;  4QKZ A;  3AYU A;  3E8R A;  3LGP A;  3I7I A;  2PJT A;  3U1R A;  3USN A;  1AF0 A;  2W13 A;  1XFV A;  2SRT A;  1RMZ A;  1B8Y A;  2Y6C A;  4ON1 A;  2J83 A;  3LJG A;  3LJZ A;  2YUF A;  4AYK A;  1HTD A;  1UTZ A;  4WZV A;  2OY2 A;  3P24 A;  3OHO A;  1IAC A;  1D8F A;  3HBU P;  3AIG A;  1JK3 A;  2OW2 A;  456C A;  1ZTQ A;  3OHL A;  1S4B P;  4JIJ A;  1K7G A;  2OXU A;  2AIG P;  4XBH A;  1BSW A;  3ZUK A;  1QIC A;  1MMR A;  1WNI A;  4I03 A;  1QIB A;  1RM8 A;  2W14 A;  1XM5 A;  1BKC E;  1SMP A;  3ZXH A;  5JMY A;  5CXA A;  3F15 A;  1JAQ A;  3HY9 A;  3LE9 A;  5D7W A;  3DPF A;  2YIG A;  3B2Z A;  1HY7 A;  1BIW A;  1I73 A;  830C A;  1XUC A;  4A7B A;  3TT4 A;  1AST A;  1Z3J A;  5BOY A;  5I2Z A;  1Q3A A;  4H30 A;  1XAX A;  2OVX A;  4H1Q A;  2I47 A;  1R1I A;  4PKV A;  2KRJ A;  1H71 P;  1YOU A;  3ELM A;  3DTI A;  1IAD A;  4XM8 A;  1KUF A;  2JIH A;  4Q1L A;  5BPA A;  3EDI A;  1IAE A;  2V4B A;  3HB2 P;  2W12 A;  1C3I A;  1D7X A;  1XFZ A;  2A8H A;  5L7F A;  3EDZ A;  1YCM A;  1HFS A; 
#chains in the Genus database with same CATH homology
 1QJJ A;  1ATL A;  1SRP A;  4EFS A;  1OM7 A;  1JAN A;  2ERO A;  2RJP A;  1GO7 P;  5CUH A;  2K2G A;  4ZR5 A;  3DSL A;  3KMC A;  1J7N A;  1Y8J A;  2POJ A;  4DD8 A;  2E2D A;  1XUR A;  5B5P A;  1K7I A;  3LMC A;  4PKU A;  3DTK A;  2K9C A;  1OS2 A;  4HX3 A;  1GE6 A;  5L79 A;  3B8Z A;  3SHI A;  1KUG A;  1UEA A;  2D1O A;  4GUY A;  1GKC A;  1KUK A;  3MA2 A;  3KRY A;  2USN A;  1JIW P;  2MZE A;  3EDH A;  4WKE A;  1BM6 A;  4IUW A;  4H76 A;  3LJT A;  2AYK A;  2D1N A;  1CXV A;  1ND1 A;  1B3D A;  3N2V A;  2CKI A;  3ZVS A;  5H8X A;  5D3C A;  2Z2D A;  1ZP5 A;  4H84 A;  4R3V A;  3TVC A;  1BZS A;  1PWU A;  1KUI A;  2YB9 A;  2FV9 A;  1BQQ M;  1OM8 A;  1IAB A;  3EWJ A;  5I4O A;  3HY7 A;  3DL1 A;  1MMQ A;  4PKW A;  4XM6 A;  1XFW A;  1G9K A;  4L7A A;  1HV5 A;  1SU3 A;  3DWB A;  4JPA A;  4H49 A;  4JA1 A;  2JNP A;  2MZH A;  2MZI A;  2OW9 A;  1GKD A;  2OZR A;  3P1V A;  1GE7 A;  1DMT A;  2DW2 A;  3HBV P;  2X3A A;  4PKQ A;  1PWP A;  3KWV C;  2L0R A;  3NX7 A;  4WF6 A;  1HOV A;  1XFU A;  3LQB A;  1YQY A;  1SAT A;  4DF9 A;  1UMS A;  2DDY A;  1PWW A;  1I1I P;  1QJI A;  5B5O A;  1KAP P;  1IAA A;  3VI1 A;  3LUN A;  4PKT A;  1G49 A;  4HMA A;  1L6J A;  1CIZ A;  3I7G A;  1BKC A;  1CGL A;  2X7M A;  4GR0 A;  1JAO A;  1DTH A;  1ROS A;  1R54 A;  4FXY P;  4GQL A;  4FU4 A;  1UMT A;  3LIR A;  1PWQ A;  3V96 B;  1O0T A;  3WV1 A;  3Q2H A;  2CLT A;  1BUV M;  4DV8 A;  4H2E A;  3G42 A;  1I76 A;  2WO9 A;  3BA0 A;  4PKR A;  3F1A A;  2ERP A;  4GR8 A;  1FBL A;  1XFX A;  3LEA A;  4PKS A;  1Y93 A;  3KME A;  5D1T A;  3EHY A;  5D2B A;  4L63 A;  3F16 A;  1QUA A;  3K7N A;  1JAP A;  3KEJ A;  1OM6 A;  2JSD A;  4GWM A;  2X3B A;  1USN A;  2OY4 A;  3LKA A;  3F19 A;  2XS3 A;  2DDF A;  3N2U A;  2HU6 A;  4JQG A;  2RJQ A;  1G4K A;  2WO8 A;  3HDA P;  4H82 A;  4FVL A;  5LAB A;  2O36 A;  3KHI A;  1EB6 A;  2E3X A;  5D1S A;  1OO9 A;  4GF1 A;  2O3E A;  4AIG A;  2DW0 A;  3RTT A;  4I35 A;  1AKL A;  966C A;  1MMB A;  3WV3 A;  1ZS0 A;  1Y0V A;  1G05 A;  3DTE A;  3O2X A;  4JP4 A;  2JT5 A;  2DW1 A;  2QPJ A;  1R1H A;  3UVC A;  1A85 A;  2Y6D A;  4J4M A;  1XUD A;  5I12 A;  3L0V A;  1BQO A;  1D8M A;  1BKC I;  1PWV A;  4ILW D;  5CZM A;  2OVZ A;  1R55 A;  1A86 A;  2MLS A;  4IN9 A;  3KEC A;  1MMP A;  2TCL A;  3RTS A;  4A3W A;  1SLM A;  2X3C A;  2JT6 A;  4L19 A;  4G0D A;  1K7Q A;  1MNC A;  1ZXC A;  3GBO A;  2W0D A;  3F18 A;  3K7L A;  4FXQ A;  2N8R A;  3B92 A;  2OI0 A;  4H3X A;  3LUM A;  1R1J A;  4XM7 A;  3Q2G A;  1EUB A;  3LIK A;  3TSK A;  5I43 A;  1CAQ A;  2OXZ A;  2W15 A;  1C8T A;  4XCT A;  2OW0 A;  1GE5 A;  3F17 A;  1GO8 P;  3L0T A;  1CGF A;  4GR3 A;  3LQ0 A;  1UTT A;  1HFC A;  3CKI A;  3DNG A;  3VTG A;  1D5J A;  4CTH A;  1JIZ A;  2XS4 A;  1OS9 A;  1EAK A;  3LIL A;  2WOA A;  2FV5 A;  3KEK A;  1CGE A;  1CK7 A;  1BUD A;  3LK8 A;  2J0T A;  1XFY A;  1O0Q A;  2ERQ A;  3O64 A;  3HDB A;  1JJ9 A;  4GWN A;  4G9L A;  3EHX A;  4DPE A;  3G5C A;  1AYK A;  1C7K A;  1QIA A;  5I3M A;  1KUH A;  2OXW A;  4AXQ A;  4WK7 A;  1FM1 A;  1FLS A;  3EDG A;  5BOT A;  2MLR A;  1KBC A;  3WV2 A;  1GXD A;  5I0L A;  1SLN A;  3HYG A;  3TS4 A;  1ZVX A;  1OMJ A;  4WKI A;  3DPE A;  4IJO A;  3AYK A;  5D1U A;  1IAG A;  1YP1 A;  1JKY A;  4AUO A;  1CQR A;  1JH1 A;  1G12 A;  1ZXV A;  4L6T A;  2OW1 A;  4QKZ A;  3AYU A;  3E8R A;  3LGP A;  3I7I A;  2PJT A;  3U1R A;  3USN A;  1AF0 A;  2W13 A;  1XFV A;  2SRT A;  1RMZ A;  1B8Y A;  2Y6C A;  4ON1 A;  2J83 A;  3LJG A;  3LJZ A;  2YUF A;  4AYK A;  1HTD A;  1UTZ A;  4WZV A;  2OY2 A;  3P24 A;  3OHO A;  1IAC A;  1D8F A;  3HBU P;  3AIG A;  1JK3 A;  2OW2 A;  456C A;  1ZTQ A;  3OHL A;  1S4B P;  4JIJ A;  1K7G A;  2OXU A;  2AIG P;  4XBH A;  1BSW A;  3ZUK A;  1QIC A;  1MMR A;  1WNI A;  4I03 A;  1QIB A;  1RM8 A;  2W14 A;  1BKC E;  1SMP A;  3ZXH A;  5JMY A;  5CXA A;  3F15 A;  1JAQ A;  3HY9 A;  3LE9 A;  5D7W A;  3DPF A;  2YIG A;  3B2Z A;  1HY7 A;  1BIW A;  1I73 A;  830C A;  1XUC A;  4A7B A;  3TT4 A;  1AST A;  1Z3J A;  5BOY A;  5I2Z A;  1Q3A A;  4H30 A;  2OVX A;  4H1Q A;  2I47 A;  1R1I A;  4PKV A;  2KRJ A;  1H71 P;  1YOU A;  3ELM A;  3DTI A;  1IAD A;  4XM8 A;  1KUF A;  2JIH A;  4Q1L A;  5BPA A;  3EDI A;  1IAE A;  2V4B A;  3HB2 P;  2W12 A;  1C3I A;  1D7X A;  1XFZ A;  2A8H A;  5L7F A;  3EDZ A;  1YCM A;  1HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...