4H84A

Crystal structure of the catalytic domain of human mmp12 in complex with a selective carboxylate based inhibitor.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Macrophage metalloelastase
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h84A00
2OW9A 1ZXVA 2WO8A 1UTTA 1DMTA 1J7NA 3KMCA 1UTZA 456CA 3F19A 3DWBA 1R1IA 3CKIA 3GBOA 1C3IA 3BA0A 3RTSA 830CA 1YOUA 1ASTA 4I03A 1BQQM 4JP4A 1L6JA 1FLSA 1GXDA 2DDYA 3P1VA 3L0TA 1XURA 3WV2A 4G0DA 1USNA 2EROA 4GR3A 1Y0VA 1KUHA 5I3MA 4Q1LA 3LJZA 1HOVA 1UMTA 1XUDA 1YQYA 3B2ZA 3U1RA 1Q3AA 4IN9A 2OZRA 2OXUA 1D8MA 4XBHA 1JH1A 1GO8P 1G12A 4DPEA 3G5CA 1KUGA 3EDHA 1IAAA 1QIAA 2X3CA 1BUDA 1QUAA 2L0RA 1QJJA 1G49A 4ILWD 1XUCA 4PKTA 3ZVSA 1WNIA 3EDIA 2W15A 3LMCA 1JIZA 1D5JA 5CZMA 1RM8A 4JPAA 1I76A 2DW0A 3HDBA 1BKCI 3HDAP 2FV5A 3KRYA 3UVCA 5LABA 2E2DA 2TCLA 3I7IA 4JIJA 5D7WA 3ELMA 3MA2A 3TS4A 1XFUA 3WV3A 5BOYA 3VI1A 3DPEA 3EHXA 1OS2A 3V96B 4DF9A 4WKEA 1BIWA 3K7NA 2A8HA 1MMBA 4GUYA 4L6TA 1SRPA 3HBUP 1IABA 4IUWA 5I12A 1EB6A 4H84A 4PKWA 1EUBA 2CKIA 1G4KA 4H49A 2WOAA 4L19A 1GE7A 1QICA 2W12A 3HY7A 2OW0A 2N8RA 4H1QA 3LJGA 5I0LA 3KHIA 1YCMA 1SU3A 1BSWA 4A3WA 2OVXA 4HX3A 1HTDA 4QKZA 1SLMA 3K7LA 1O0QA 3LKAA 3RTTA 1JANA 4CTHA 3TSKA 1K7GA 1XFXA 1EAKA 4WZVA 2JSDA 3LIRA 4FVLA 2OI0A 4FXQA 3SHIA 5BOTA 5I2ZA 3DL1A 4H76A 1SLNA 3LK8A 3DSLA 1BM6A 1FM1A 1GO7P 1B3DA 1IACA 1HY7A 2W0DA 3LE9A 1XFZA 1QIBA 1MMPA 2X3AA 1JIWP 1AKLA 4XM8A 3KEKA 2ERPA 3F15A 2XS3A 1HFCA 1R54A 4XM6A 3N2VA 2J83A 1JK3A 3HYGA 4PKUA 1IAEA 1AYKA 1OM7A 1HFSA 2MZHA 1KBCA 3KEJA 1PWPA 2MZIA 3LEAA 5B5PA 3NX7A 4IJOA 3EDGA 3KECA 3N2UA 3O2XA 2D1NA 2O36A 1BQOA 3L0VA 2DW2A 4H2EA 2PJTA 1PWWA 2Y6CA 2CLTA 1PWUA 3EHYA 4JA1A 4GQLA 2W14A 5CUHA 1GKCA 1JKYA 4PKQA 3F1AA 5D1UA 2K9CA 4AXQA 2AIGP 2JT5A 3DPFA 3OHOA 1CAQA 3F18A 4ON1A 2AYKA 1KUIA 4GF1A 1CGLA 1CK7A 2OY2A 3KWVC 2QPJA 2YIGA 2POJA 1GE6A 3B8ZA 2RJPA 3AYKA 3E8RA 1ZVXA 5D3CA 1BUVM 1MMQA 4R3VA 4DV8A 2JNPA 1OMJA 3OHLA 1UEAA 1IAGA 2HU6A 3LQ0A 1ZTQA 2X7MA 4GR8A 4PKRA 3ZUKA 4XCTA 3USNA 4XM7A 1KUFA 1JAOA 1GE5A 1MNCA 2I47A 3LUNA 2D1OA 2MLSA 2OY4A 5L7FA 2KRJA 1D7XA 4EFSA 1MMRA 2J0TA 1PWQA 966CA 3LJTA 1BZSA 3Q2GA 4GWNA 1R1JA 1RMZA 1FBLA 2X3BA 1Y93A 4H82A 5L79A 2W13A 4JQGA 1K7QA 4FXYP 2YB9A 1JAQA 1OO9A 3HB2P 1K7IA 4WF6A 1Z3JA 5BPAA 3F17A 3AYUA 2OW2A 2WO9A 1ND1A 3P24A 1A85A 1ZXCA 4GWMA 1C8TA 2K2GA 2O3EA 4L63A 1XFWA 3F16A 2Z2DA 1YP1A 1ZS0A 1SMPA 4PKVA 1XFYA 1AF0A 3LUMA 3VTGA 1XFVA 4AUOA 5I43A 2SRTA 1Y8JA 2XS4A 1IADA 2JT6A 5JMYA 2RJQA 3LILA 1DTHA 4AYKA 3LQBA 1CQRA 2MZEA 2OW1A 2FV9A 4GR0A 1I1IP 1ZP5A 2Y6DA 5CXAA 2E3XA 3O64A 1BKCA 1S4BP 1G05A 4J4MA 1JAPA 3Q2HA 3G42A 1OM8A 5H8XA 1QJIA 4H3XA 1KAPP 1SATA 4H30A 3DNGA 3I7GA 2OXZA 2DW1A 1I73A 5D1TA 3EDZA 3AIGA 4DD8A 1HV5A 3TVCA 1O0TA 4I35A 3HBVP 4WK7A 3ZXHA 3EWJA 1CGEA 1CIZA 2DDFA 1G9KA 3HY9A 2OXWA 4HMAA 1PWVA 3B92A 1R1HA 1ATLA 5B5OA 4FU4A 1JJ9A 3LGPA 1OM6A 2USNA 4PKSA 1KUKA 3WV1A 1H71P 5I4OA 1GKDA 1UMSA 1A86A 4A7BA 5D1SA 2V4BA 2JIHA 1D8FA 1B8YA 3LIKA 1OS9A 1CGFA 5D2BA 1CXVA 2MLRA 1C7KA 3KMEA 4ZR5A 4WKIA 3TT4A 2OVZA 2ERQA 4AIGA 4G9LA 1R55A 1BKCE 1ROSA
chains in the Genus database with same CATH superfamily
2OW9A 1ZXVA 2WO8A 1UTTA 1DMTA 1J7NA 3KMCA 1UTZA 456CA 3F19A 3DWBA 1R1IA 3CKIA 3GBOA 1C3IA 3BA0A 3RTSA 830CA 1YOUA 1ASTA 4I03A 1BQQM 4JP4A 1L6JA 1FLSA 1GXDA 2DDYA 3P1VA 3L0TA 1XURA 3WV2A 4G0DA 1USNA 2EROA 4GR3A 1Y0VA 1KUHA 5I3MA 4Q1LA 3LJZA 1HOVA 1UMTA 1XUDA 1YQYA 3B2ZA 3U1RA 1Q3AA 4IN9A 2OZRA 2OXUA 1D8MA 4XBHA 1JH1A 1GO8P 1G12A 3DTEA 4DPEA 3G5CA 1KUGA 3EDHA 1IAAA 1QIAA 2X3CA 1BUDA 1QUAA 2L0RA 1QJJA 1G49A 4ILWD 1XUCA 4PKTA 3ZVSA 1WNIA 3EDIA 2W15A 3LMCA 1JIZA 1D5JA 5CZMA 1RM8A 4JPAA 1I76A 2DW0A 3HDBA 1BKCI 3HDAP 2FV5A 3KRYA 3UVCA 5LABA 2E2DA 2TCLA 3I7IA 4JIJA 5D7WA 3ELMA 3MA2A 3TS4A 1XFUA 3WV3A 5BOYA 3VI1A 3DPEA 3EHXA 1OS2A 3V96B 4DF9A 4WKEA 1BIWA 3K7NA 2A8HA 1MMBA 4GUYA 4L6TA 3DTKA 1SRPA 3HBUP 1IABA 4IUWA 5I12A 1EB6A 4H84A 4PKWA 1EUBA 2CKIA 3DTIA 1G4KA 4H49A 2WOAA 1XAXA 4L19A 1GE7A 1QICA 2W12A 3HY7A 2OW0A 2N8RA 4H1QA 3LJGA 5I0LA 3KHIA 1YCMA 1SU3A 1BSWA 4A3WA 2OVXA 4HX3A 1HTDA 4QKZA 1SLMA 3K7LA 1O0QA 3LKAA 3RTTA 1JANA 4CTHA 3TSKA 1K7GA 1XFXA 1EAKA 4WZVA 2JSDA 3LIRA 4FVLA 2OI0A 4FXQA 3SHIA 5BOTA 5I2ZA 4L7AA 3DL1A 4H76A 1SLNA 3LK8A 3DSLA 1BM6A 1FM1A 1GO7P 1B3DA 1IACA 1HY7A 2W0DA 3LE9A 1XFZA 1QIBA 1MMPA 2X3AA 1JIWP 1XM5A 1AKLA 4XM8A 3KEKA 2ERPA 3F15A 2XS3A 1HFCA 1R54A 4XM6A 3N2VA 2J83A 1JK3A 3HYGA 4PKUA 1IAEA 1AYKA 1OM7A 1HFSA 2MZHA 1KBCA 3KEJA 1PWPA 2MZIA 3LEAA 5B5PA 3NX7A 4IJOA 3EDGA 3KECA 3N2UA 3O2XA 2D1NA 2O36A 1BQOA 3L0VA 2DW2A 4H2EA 2PJTA 1PWWA 2Y6CA 2CLTA 1PWUA 3EHYA 4JA1A 4GQLA 2W14A 5CUHA 1GKCA 1JKYA 4PKQA 3F1AA 5D1UA 2K9CA 4AXQA 2AIGP 2JT5A 3DPFA 3OHOA 1CAQA 3F18A 4ON1A 2AYKA 1KUIA 4GF1A 1CGLA 1CK7A 2OY2A 3KWVC 2QPJA 2YIGA 2POJA 1GE6A 3B8ZA 2RJPA 3AYKA 3E8RA 1ZVXA 5D3CA 1BUVM 1MMQA 4R3VA 4DV8A 2JNPA 1OMJA 3OHLA 1UEAA 1IAGA 2HU6A 3LQ0A 1ZTQA 2X7MA 4GR8A 4PKRA 3ZUKA 4XCTA 3USNA 4XM7A 1KUFA 1JAOA 1GE5A 1MNCA 1TVIA 2I47A 3LUNA 2D1OA 2MLSA 2OY4A 5L7FA 2KRJA 1D7XA 4EFSA 1MMRA 2J0TA 1PWQA 966CA 3LJTA 1BZSA 3Q2GA 4GWNA 1R1JA 1RMZA 1FBLA 2X3BA 1Y93A 4H82A 5L79A 2W13A 4JQGA 1K7QA 4FXYP 2YB9A 1JAQA 1OO9A 3HB2P 1K7IA 4WF6A 1Z3JA 5BPAA 3F17A 3AYUA 2OW2A 2WO9A 1ND1A 3P24A 1A85A 1ZXCA 4GWMA 1C8TA 2K2GA 2O3EA 4L63A 1XFWA 3F16A 2Z2DA 1YP1A 1ZS0A 1SMPA 4PKVA 1XFYA 1AF0A 3LUMA 3VTGA 1XFVA 4AUOA 5I43A 2SRTA 1Y8JA 2XS4A 1IADA 2JT6A 5JMYA 2RJQA 3LILA 1DTHA 4AYKA 3LQBA 1CQRA 2MZEA 2OW1A 2FV9A 1OZ9A 4GR0A 2YUFA 1I1IP 1ZP5A 2Y6DA 5CXAA 2E3XA 3O64A 1BKCA 1S4BP 1G05A 4J4MA 1JAPA 3Q2HA 3G42A 1OM8A 5H8XA 1QJIA 4H3XA 1KAPP 1SATA 4H30A 3DNGA 3I7GA 2OXZA 2DW1A 1I73A 5D1TA 3EDZA 3AIGA 4DD8A 1HV5A 3TVCA 1O0TA 4I35A 3HBVP 4WK7A 3ZXHA 3EWJA 1CGEA 1CIZA 2DDFA 1G9KA 3HY9A 2OXWA 4HMAA 1PWVA 3B92A 1R1HA 1ATLA 5B5OA 4FU4A 1JJ9A 3LGPA 1OM6A 2USNA 4PKSA 1KUKA 3WV1A 1H71P 5I4OA 1GKDA 1UMSA 1A86A 4A7BA 5D1SA 2V4BA 2JIHA 1D8FA 1B8YA 3LIKA 1OS9A 1CGFA 5D2BA 1CXVA 2MLRA 1C7KA 3KMEA 4ZR5A 4WKIA 3TT4A 2OVZA 2ERQA 4AIGA 4G9LA 1R55A 1BKCE 1ROSA
chains in the Genus database with same CATH topology
2OW9A 1ZXVA 2WO8A 1UTTA 1DMTA 1J7NA 3KMCA 1UTZA 456CA 3F19A 3DWBA 1R1IA 3CKIA 3GBOA 1C3IA 3BA0A 3RTSA 830CA 1YOUA 1ASTA 4I03A 1BQQM 4JP4A 1L6JA 1FLSA 1GXDA 2DDYA 3P1VA 3L0TA 1XURA 3WV2A 4G0DA 1USNA 2EROA 4GR3A 1Y0VA 1KUHA 5I3MA 4Q1LA 3LJZA 1HOVA 1UMTA 1XUDA 1YQYA 3B2ZA 3U1RA 1Q3AA 4IN9A 2OZRA 2OXUA 1D8MA 4XBHA 1JH1A 1GO8P 1G12A 3DTEA 4DPEA 3G5CA 1KUGA 3EDHA 1IAAA 1QIAA 2X3CA 1BUDA 1QUAA 2L0RA 1QJJA 1G49A 4ILWD 1XUCA 4PKTA 3ZVSA 1WNIA 3EDIA 2W15A 3LMCA 1JIZA 1D5JA 5CZMA 1RM8A 4JPAA 1I76A 2DW0A 3HDBA 1BKCI 3HDAP 2FV5A 3KRYA 3UVCA 5LABA 2E2DA 2TCLA 3I7IA 4JIJA 5D7WA 3ELMA 3MA2A 3TS4A 1XFUA 3WV3A 5BOYA 3VI1A 3DPEA 3EHXA 1OS2A 3V96B 4DF9A 4WKEA 1BIWA 3K7NA 2A8HA 1MMBA 4GUYA 4L6TA 3DTKA 1SRPA 3HBUP 1IABA 4IUWA 5I12A 1EB6A 4H84A 4PKWA 1EUBA 2CKIA 3DTIA 1G4KA 4H49A 2WOAA 4L19A 1GE7A 1QICA 2W12A 3HY7A 2OW0A 2N8RA 4H1QA 3LJGA 5I0LA 3KHIA 1YCMA 1SU3A 1BSWA 4A3WA 2OVXA 4HX3A 1HTDA 4QKZA 1SLMA 3K7LA 1O0QA 3LKAA 3RTTA 1JANA 4CTHA 3TSKA 1K7GA 1XFXA 1EAKA 4WZVA 2JSDA 3LIRA 4FVLA 2OI0A 4FXQA 3SHIA 5BOTA 5I2ZA 4L7AA 3DL1A 4H76A 1SLNA 3LK8A 3DSLA 1BM6A 1FM1A 1GO7P 1B3DA 1IACA 1HY7A 2W0DA 3LE9A 1XFZA 1QIBA 1MMPA 2X3AA 1JIWP 1AKLA 4XM8A 3KEKA 2ERPA 3F15A 2XS3A 1HFCA 1R54A 4XM6A 3N2VA 2J83A 1JK3A 3HYGA 4PKUA 1IAEA 1AYKA 1OM7A 1HFSA 2MZHA 1KBCA 3KEJA 1PWPA 2MZIA 3LEAA 5B5PA 3NX7A 4IJOA 3EDGA 3KECA 3N2UA 3O2XA 2D1NA 2O36A 1BQOA 3L0VA 2DW2A 4H2EA 2PJTA 1PWWA 2Y6CA 2CLTA 1PWUA 3EHYA 4JA1A 4GQLA 2W14A 5CUHA 1GKCA 1JKYA 4PKQA 3F1AA 5D1UA 2K9CA 4AXQA 2AIGP 2JT5A 3DPFA 3OHOA 1CAQA 3F18A 4ON1A 2AYKA 1KUIA 4GF1A 1CGLA 1CK7A 2OY2A 3KWVC 2QPJA 2YIGA 2POJA 1GE6A 3B8ZA 2RJPA 3AYKA 3E8RA 1ZVXA 5D3CA 1BUVM 1MMQA 4R3VA 4DV8A 2JNPA 1OMJA 3OHLA 1UEAA 1IAGA 2HU6A 3LQ0A 1ZTQA 2X7MA 4GR8A 4PKRA 3ZUKA 4XCTA 3USNA 4XM7A 1KUFA 1JAOA 1GE5A 1MNCA 2I47A 3LUNA 2D1OA 2MLSA 2OY4A 5L7FA 2KRJA 1D7XA 4EFSA 1MMRA 2J0TA 1PWQA 966CA 3LJTA 1BZSA 3Q2GA 4GWNA 1R1JA 1RMZA 1FBLA 2X3BA 1Y93A 4H82A 5L79A 2W13A 4JQGA 1K7QA 4FXYP 2YB9A 1JAQA 1OO9A 3HB2P 1K7IA 4WF6A 1Z3JA 5BPAA 3F17A 3AYUA 2OW2A 2WO9A 1ND1A 3P24A 1A85A 1ZXCA 4GWMA 1C8TA 2K2GA 2O3EA 4L63A 1XFWA 3F16A 2Z2DA 1YP1A 1ZS0A 1SMPA 4PKVA 1XFYA 1AF0A 3LUMA 3VTGA 1XFVA 4AUOA 5I43A 2SRTA 1Y8JA 2XS4A 1IADA 2JT6A 5JMYA 2RJQA 3LILA 1DTHA 4AYKA 3LQBA 1CQRA 2MZEA 2OW1A 2FV9A 4GR0A 2YUFA 1I1IP 1ZP5A 2Y6DA 5CXAA 2E3XA 3O64A 1BKCA 1S4BP 1G05A 4J4MA 1JAPA 3Q2HA 3G42A 1OM8A 5H8XA 1QJIA 4H3XA 1KAPP 1SATA 4H30A 3DNGA 3I7GA 2OXZA 2DW1A 1I73A 5D1TA 3EDZA 3AIGA 4DD8A 1HV5A 3TVCA 1O0TA 4I35A 3HBVP 4WK7A 3ZXHA 3EWJA 1CGEA 1CIZA 2DDFA 1G9KA 3HY9A 2OXWA 4HMAA 1PWVA 3B92A 1R1HA 1ATLA 5B5OA 4FU4A 1JJ9A 3LGPA 1OM6A 2USNA 4PKSA 1KUKA 3WV1A 1H71P 5I4OA 1GKDA 1UMSA 1A86A 4A7BA 5D1SA 2V4BA 2JIHA 1D8FA 1B8YA 3LIKA 1OS9A 1CGFA 5D2BA 1CXVA 2MLRA 1C7KA 3KMEA 4ZR5A 4WKIA 3TT4A 2OVZA 2ERQA 4AIGA 4G9LA 1R55A 1BKCE 1ROSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OW9 A;  1ZXV A;  2WO8 A;  1UTT A;  1DMT A;  1J7N A;  3KMC A;  1UTZ A;  456C A;  3F19 A;  3DWB A;  1R1I A;  3CKI A;  3GBO A;  1C3I A;  3BA0 A;  3RTS A;  830C A;  1YOU A;  1AST A;  4I03 A;  1BQQ M;  4JP4 A;  1L6J A;  1FLS A;  1GXD A;  2DDY A;  3P1V A;  3L0T A;  1XUR A;  3WV2 A;  4G0D A;  1USN A;  2ERO A;  4GR3 A;  1Y0V A;  1KUH A;  5I3M A;  4Q1L A;  3LJZ A;  1HOV A;  1UMT A;  1XUD A;  1YQY A;  3B2Z A;  3U1R A;  1Q3A A;  4IN9 A;  2OZR A;  2OXU A;  1D8M A;  4XBH A;  1JH1 A;  1GO8 P;  1G12 A;  4DPE A;  3G5C A;  1KUG A;  3EDH A;  1IAA A;  1QIA A;  2X3C A;  1BUD A;  1QUA A;  2L0R A;  1QJJ A;  1G49 A;  4ILW D;  1XUC A;  4PKT A;  3ZVS A;  1WNI A;  3EDI A;  2W15 A;  3LMC A;  1JIZ A;  1D5J A;  5CZM A;  1RM8 A;  4JPA A;  1I76 A;  2DW0 A;  3HDB A;  1BKC I;  3HDA P;  2FV5 A;  3KRY A;  3UVC A;  5LAB A;  2E2D A;  2TCL A;  3I7I A;  4JIJ A;  5D7W A;  3ELM A;  3MA2 A;  3TS4 A;  1XFU A;  3WV3 A;  5BOY A;  3VI1 A;  3DPE A;  3EHX A;  1OS2 A;  3V96 B;  4DF9 A;  4WKE A;  1BIW A;  3K7N A;  2A8H A;  1MMB A;  4GUY A;  4L6T A;  1SRP A;  3HBU P;  1IAB A;  4IUW A;  5I12 A;  1EB6 A;  4H84 A;  4PKW A;  1EUB A;  2CKI A;  1G4K A;  4H49 A;  2WOA A;  4L19 A;  1GE7 A;  1QIC A;  2W12 A;  3HY7 A;  2OW0 A;  2N8R A;  4H1Q A;  3LJG A;  5I0L A;  3KHI A;  1YCM A;  1SU3 A;  1BSW A;  4A3W A;  2OVX A;  4HX3 A;  1HTD A;  4QKZ A;  1SLM A;  3K7L A;  1O0Q A;  3LKA A;  3RTT A;  1JAN A;  4CTH A;  3TSK A;  1K7G A;  1XFX A;  1EAK A;  4WZV A;  2JSD A;  3LIR A;  4FVL A;  2OI0 A;  4FXQ A;  3SHI A;  5BOT A;  5I2Z A;  3DL1 A;  4H76 A;  1SLN A;  3LK8 A;  3DSL A;  1BM6 A;  1FM1 A;  1GO7 P;  1B3D A;  1IAC A;  1HY7 A;  2W0D A;  3LE9 A;  1XFZ A;  1QIB A;  1MMP A;  2X3A A;  1JIW P;  1AKL A;  4XM8 A;  3KEK A;  2ERP A;  3F15 A;  2XS3 A;  1HFC A;  1R54 A;  4XM6 A;  3N2V A;  2J83 A;  1JK3 A;  3HYG A;  4PKU A;  1IAE A;  1AYK A;  1OM7 A;  1HFS A;  2MZH A;  1KBC A;  3KEJ A;  1PWP A;  2MZI A;  3LEA A;  5B5P A;  3NX7 A;  4IJO A;  3EDG A;  3KEC A;  3N2U A;  3O2X A;  2D1N A;  2O36 A;  1BQO A;  3L0V A;  2DW2 A;  4H2E A;  2PJT A;  1PWW A;  2Y6C A;  2CLT A;  1PWU A;  3EHY A;  4JA1 A;  4GQL A;  2W14 A;  5CUH A;  1GKC A;  1JKY A;  4PKQ A;  3F1A A;  5D1U A;  2K9C A;  4AXQ A;  2AIG P;  2JT5 A;  3DPF A;  3OHO A;  1CAQ A;  3F18 A;  4ON1 A;  2AYK A;  1KUI A;  4GF1 A;  1CGL A;  1CK7 A;  2OY2 A;  3KWV C;  2QPJ A;  2YIG A;  2POJ A;  1GE6 A;  3B8Z A;  2RJP A;  3AYK A;  3E8R A;  1ZVX A;  5D3C A;  1BUV M;  1MMQ A;  4R3V A;  4DV8 A;  2JNP A;  1OMJ A;  3OHL A;  1UEA A;  1IAG A;  2HU6 A;  3LQ0 A;  1ZTQ A;  2X7M A;  4GR8 A;  4PKR A;  3ZUK A;  4XCT A;  3USN A;  4XM7 A;  1KUF A;  1JAO A;  1GE5 A;  1MNC A;  2I47 A;  3LUN A;  2D1O A;  2MLS A;  2OY4 A;  5L7F A;  2KRJ A;  1D7X A;  4EFS A;  1MMR A;  2J0T A;  1PWQ A;  966C A;  3LJT A;  1BZS A;  3Q2G A;  4GWN A;  1R1J A;  1RMZ A;  1FBL A;  2X3B A;  1Y93 A;  4H82 A;  5L79 A;  2W13 A;  4JQG A;  1K7Q A;  4FXY P;  2YB9 A;  1JAQ A;  1OO9 A;  3HB2 P;  1K7I A;  4WF6 A;  1Z3J A;  5BPA A;  3F17 A;  3AYU A;  2OW2 A;  2WO9 A;  1ND1 A;  3P24 A;  1A85 A;  1ZXC A;  4GWM A;  1C8T A;  2K2G A;  2O3E A;  4L63 A;  1XFW A;  3F16 A;  2Z2D A;  1YP1 A;  1ZS0 A;  1SMP A;  4PKV A;  1XFY A;  1AF0 A;  3LUM A;  3VTG A;  1XFV A;  4AUO A;  5I43 A;  2SRT A;  1Y8J A;  2XS4 A;  1IAD A;  2JT6 A;  5JMY A;  2RJQ A;  3LIL A;  1DTH A;  4AYK A;  3LQB A;  1CQR A;  2MZE A;  2OW1 A;  2FV9 A;  4GR0 A;  1I1I P;  1ZP5 A;  2Y6D A;  5CXA A;  2E3X A;  3O64 A;  1BKC A;  1S4B P;  1G05 A;  4J4M A;  1JAP A;  3Q2H A;  3G42 A;  1OM8 A;  5H8X A;  1QJI A;  4H3X A;  1KAP P;  1SAT A;  4H30 A;  3DNG A;  3I7G A;  2OXZ A;  2DW1 A;  1I73 A;  5D1T A;  3EDZ A;  3AIG A;  4DD8 A;  1HV5 A;  3TVC A;  1O0T A;  4I35 A;  3HBV P;  4WK7 A;  3ZXH A;  3EWJ A;  1CGE A;  1CIZ A;  2DDF A;  1G9K A;  3HY9 A;  2OXW A;  4HMA A;  1PWV A;  3B92 A;  1R1H A;  1ATL A;  5B5O A;  4FU4 A;  1JJ9 A;  3LGP A;  1OM6 A;  2USN A;  4PKS A;  1KUK A;  3WV1 A;  1H71 P;  5I4O A;  1GKD A;  1UMS A;  1A86 A;  4A7B A;  5D1S A;  2V4B A;  2JIH A;  1D8F A;  1B8Y A;  3LIK A;  1OS9 A;  1CGF A;  5D2B A;  1CXV A;  2MLR A;  1C7K A;  3KME A;  4ZR5 A;  4WKI A;  3TT4 A;  2OVZ A;  2ERQ A;  4AIG A;  4G9L A;  1R55 A;  1BKC E;  1ROS A; 
#chains in the Genus database with same CATH topology
 2OW9 A;  1ZXV A;  2WO8 A;  1UTT A;  1DMT A;  1J7N A;  3KMC A;  1UTZ A;  456C A;  3F19 A;  3DWB A;  1R1I A;  3CKI A;  3GBO A;  1C3I A;  3BA0 A;  3RTS A;  830C A;  1YOU A;  1AST A;  4I03 A;  1BQQ M;  4JP4 A;  1L6J A;  1FLS A;  1GXD A;  2DDY A;  3P1V A;  3L0T A;  1XUR A;  3WV2 A;  4G0D A;  1USN A;  2ERO A;  4GR3 A;  1Y0V A;  1KUH A;  5I3M A;  4Q1L A;  3LJZ A;  1HOV A;  1UMT A;  1XUD A;  1YQY A;  3B2Z A;  3U1R A;  1Q3A A;  4IN9 A;  2OZR A;  2OXU A;  1D8M A;  4XBH A;  1JH1 A;  1GO8 P;  1G12 A;  3DTE A;  4DPE A;  3G5C A;  1KUG A;  3EDH A;  1IAA A;  1QIA A;  2X3C A;  1BUD A;  1QUA A;  2L0R A;  1QJJ A;  1G49 A;  4ILW D;  1XUC A;  4PKT A;  3ZVS A;  1WNI A;  3EDI A;  2W15 A;  3LMC A;  1JIZ A;  1D5J A;  5CZM A;  1RM8 A;  4JPA A;  1I76 A;  2DW0 A;  3HDB A;  1BKC I;  3HDA P;  2FV5 A;  3KRY A;  3UVC A;  5LAB A;  2E2D A;  2TCL A;  3I7I A;  4JIJ A;  5D7W A;  3ELM A;  3MA2 A;  3TS4 A;  1XFU A;  3WV3 A;  5BOY A;  3VI1 A;  3DPE A;  3EHX A;  1OS2 A;  3V96 B;  4DF9 A;  4WKE A;  1BIW A;  3K7N A;  2A8H A;  1MMB A;  4GUY A;  4L6T A;  3DTK A;  1SRP A;  3HBU P;  1IAB A;  4IUW A;  5I12 A;  1EB6 A;  4H84 A;  4PKW A;  1EUB A;  2CKI A;  3DTI A;  1G4K A;  4H49 A;  2WOA A;  1XAX A;  4L19 A;  1GE7 A;  1QIC A;  2W12 A;  3HY7 A;  2OW0 A;  2N8R A;  4H1Q A;  3LJG A;  5I0L A;  3KHI A;  1YCM A;  1SU3 A;  1BSW A;  4A3W A;  2OVX A;  4HX3 A;  1HTD A;  4QKZ A;  1SLM A;  3K7L A;  1O0Q A;  3LKA A;  3RTT A;  1JAN A;  4CTH A;  3TSK A;  1K7G A;  1XFX A;  1EAK A;  4WZV A;  2JSD A;  3LIR A;  4FVL A;  2OI0 A;  4FXQ A;  3SHI A;  5BOT A;  5I2Z A;  4L7A A;  3DL1 A;  4H76 A;  1SLN A;  3LK8 A;  3DSL A;  1BM6 A;  1FM1 A;  1GO7 P;  1B3D A;  1IAC A;  1HY7 A;  2W0D A;  3LE9 A;  1XFZ A;  1QIB A;  1MMP A;  2X3A A;  1JIW P;  1XM5 A;  1AKL A;  4XM8 A;  3KEK A;  2ERP A;  3F15 A;  2XS3 A;  1HFC A;  1R54 A;  4XM6 A;  3N2V A;  2J83 A;  1JK3 A;  3HYG A;  4PKU A;  1IAE A;  1AYK A;  1OM7 A;  1HFS A;  2MZH A;  1KBC A;  3KEJ A;  1PWP A;  2MZI A;  3LEA A;  5B5P A;  3NX7 A;  4IJO A;  3EDG A;  3KEC A;  3N2U A;  3O2X A;  2D1N A;  2O36 A;  1BQO A;  3L0V A;  2DW2 A;  4H2E A;  2PJT A;  1PWW A;  2Y6C A;  2CLT A;  1PWU A;  3EHY A;  4JA1 A;  4GQL A;  2W14 A;  5CUH A;  1GKC A;  1JKY A;  4PKQ A;  3F1A A;  5D1U A;  2K9C A;  4AXQ A;  2AIG P;  2JT5 A;  3DPF A;  3OHO A;  1CAQ A;  3F18 A;  4ON1 A;  2AYK A;  1KUI A;  4GF1 A;  1CGL A;  1CK7 A;  2OY2 A;  3KWV C;  2QPJ A;  2YIG A;  2POJ A;  1GE6 A;  3B8Z A;  2RJP A;  3AYK A;  3E8R A;  1ZVX A;  5D3C A;  1BUV M;  1MMQ A;  4R3V A;  4DV8 A;  2JNP A;  1OMJ A;  3OHL A;  1UEA A;  1IAG A;  2HU6 A;  3LQ0 A;  1ZTQ A;  2X7M A;  4GR8 A;  4PKR A;  3ZUK A;  4XCT A;  3USN A;  4XM7 A;  1KUF A;  1JAO A;  1GE5 A;  1MNC A;  1TVI A;  2I47 A;  3LUN A;  2D1O A;  2MLS A;  2OY4 A;  5L7F A;  2KRJ A;  1D7X A;  4EFS A;  1MMR A;  2J0T A;  1PWQ A;  966C A;  3LJT A;  1BZS A;  3Q2G A;  4GWN A;  1R1J A;  1RMZ A;  1FBL A;  2X3B A;  1Y93 A;  4H82 A;  5L79 A;  2W13 A;  4JQG A;  1K7Q A;  4FXY P;  2YB9 A;  1JAQ A;  1OO9 A;  3HB2 P;  1K7I A;  4WF6 A;  1Z3J A;  5BPA A;  3F17 A;  3AYU A;  2OW2 A;  2WO9 A;  1ND1 A;  3P24 A;  1A85 A;  1ZXC A;  4GWM A;  1C8T A;  2K2G A;  2O3E A;  4L63 A;  1XFW A;  3F16 A;  2Z2D A;  1YP1 A;  1ZS0 A;  1SMP A;  4PKV A;  1XFY A;  1AF0 A;  3LUM A;  3VTG A;  1XFV A;  4AUO A;  5I43 A;  2SRT A;  1Y8J A;  2XS4 A;  1IAD A;  2JT6 A;  5JMY A;  2RJQ A;  3LIL A;  1DTH A;  4AYK A;  3LQB A;  1CQR A;  2MZE A;  2OW1 A;  2FV9 A;  1OZ9 A;  4GR0 A;  2YUF A;  1I1I P;  1ZP5 A;  2Y6D A;  5CXA A;  2E3X A;  3O64 A;  1BKC A;  1S4B P;  1G05 A;  4J4M A;  1JAP A;  3Q2H A;  3G42 A;  1OM8 A;  5H8X A;  1QJI A;  4H3X A;  1KAP P;  1SAT A;  4H30 A;  3DNG A;  3I7G A;  2OXZ A;  2DW1 A;  1I73 A;  5D1T A;  3EDZ A;  3AIG A;  4DD8 A;  1HV5 A;  3TVC A;  1O0T A;  4I35 A;  3HBV P;  4WK7 A;  3ZXH A;  3EWJ A;  1CGE A;  1CIZ A;  2DDF A;  1G9K A;  3HY9 A;  2OXW A;  4HMA A;  1PWV A;  3B92 A;  1R1H A;  1ATL A;  5B5O A;  4FU4 A;  1JJ9 A;  3LGP A;  1OM6 A;  2USN A;  4PKS A;  1KUK A;  3WV1 A;  1H71 P;  5I4O A;  1GKD A;  1UMS A;  1A86 A;  4A7B A;  5D1S A;  2V4B A;  2JIH A;  1D8F A;  1B8Y A;  3LIK A;  1OS9 A;  1CGF A;  5D2B A;  1CXV A;  2MLR A;  1C7K A;  3KME A;  4ZR5 A;  4WKI A;  3TT4 A;  2OVZ A;  2ERQ A;  4AIG A;  4G9L A;  1R55 A;  1BKC E;  1ROS A; 
#chains in the Genus database with same CATH homology
 2OW9 A;  1ZXV A;  2WO8 A;  1UTT A;  1DMT A;  1J7N A;  3KMC A;  1UTZ A;  456C A;  3F19 A;  3DWB A;  1R1I A;  3CKI A;  3GBO A;  1C3I A;  3BA0 A;  3RTS A;  830C A;  1YOU A;  1AST A;  4I03 A;  1BQQ M;  4JP4 A;  1L6J A;  1FLS A;  1GXD A;  2DDY A;  3P1V A;  3L0T A;  1XUR A;  3WV2 A;  4G0D A;  1USN A;  2ERO A;  4GR3 A;  1Y0V A;  1KUH A;  5I3M A;  4Q1L A;  3LJZ A;  1HOV A;  1UMT A;  1XUD A;  1YQY A;  3B2Z A;  3U1R A;  1Q3A A;  4IN9 A;  2OZR A;  2OXU A;  1D8M A;  4XBH A;  1JH1 A;  1GO8 P;  1G12 A;  3DTE A;  4DPE A;  3G5C A;  1KUG A;  3EDH A;  1IAA A;  1QIA A;  2X3C A;  1BUD A;  1QUA A;  2L0R A;  1QJJ A;  1G49 A;  4ILW D;  1XUC A;  4PKT A;  3ZVS A;  1WNI A;  3EDI A;  2W15 A;  3LMC A;  1JIZ A;  1D5J A;  5CZM A;  1RM8 A;  4JPA A;  1I76 A;  2DW0 A;  3HDB A;  1BKC I;  3HDA P;  2FV5 A;  3KRY A;  3UVC A;  5LAB A;  2E2D A;  2TCL A;  3I7I A;  4JIJ A;  5D7W A;  3ELM A;  3MA2 A;  3TS4 A;  1XFU A;  3WV3 A;  5BOY A;  3VI1 A;  3DPE A;  3EHX A;  1OS2 A;  3V96 B;  4DF9 A;  4WKE A;  1BIW A;  3K7N A;  2A8H A;  1MMB A;  4GUY A;  4L6T A;  3DTK A;  1SRP A;  3HBU P;  1IAB A;  4IUW A;  5I12 A;  1EB6 A;  4H84 A;  4PKW A;  1EUB A;  2CKI A;  3DTI A;  1G4K A;  4H49 A;  2WOA A;  4L19 A;  1GE7 A;  1QIC A;  2W12 A;  3HY7 A;  2OW0 A;  2N8R A;  4H1Q A;  3LJG A;  5I0L A;  3KHI A;  1YCM A;  1SU3 A;  1BSW A;  4A3W A;  2OVX A;  4HX3 A;  1HTD A;  4QKZ A;  1SLM A;  3K7L A;  1O0Q A;  3LKA A;  3RTT A;  1JAN A;  4CTH A;  3TSK A;  1K7G A;  1XFX A;  1EAK A;  4WZV A;  2JSD A;  3LIR A;  4FVL A;  2OI0 A;  4FXQ A;  3SHI A;  5BOT A;  5I2Z A;  4L7A A;  3DL1 A;  4H76 A;  1SLN A;  3LK8 A;  3DSL A;  1BM6 A;  1FM1 A;  1GO7 P;  1B3D A;  1IAC A;  1HY7 A;  2W0D A;  3LE9 A;  1XFZ A;  1QIB A;  1MMP A;  2X3A A;  1JIW P;  1AKL A;  4XM8 A;  3KEK A;  2ERP A;  3F15 A;  2XS3 A;  1HFC A;  1R54 A;  4XM6 A;  3N2V A;  2J83 A;  1JK3 A;  3HYG A;  4PKU A;  1IAE A;  1AYK A;  1OM7 A;  1HFS A;  2MZH A;  1KBC A;  3KEJ A;  1PWP A;  2MZI A;  3LEA A;  5B5P A;  3NX7 A;  4IJO A;  3EDG A;  3KEC A;  3N2U A;  3O2X A;  2D1N A;  2O36 A;  1BQO A;  3L0V A;  2DW2 A;  4H2E A;  2PJT A;  1PWW A;  2Y6C A;  2CLT A;  1PWU A;  3EHY A;  4JA1 A;  4GQL A;  2W14 A;  5CUH A;  1GKC A;  1JKY A;  4PKQ A;  3F1A A;  5D1U A;  2K9C A;  4AXQ A;  2AIG P;  2JT5 A;  3DPF A;  3OHO A;  1CAQ A;  3F18 A;  4ON1 A;  2AYK A;  1KUI A;  4GF1 A;  1CGL A;  1CK7 A;  2OY2 A;  3KWV C;  2QPJ A;  2YIG A;  2POJ A;  1GE6 A;  3B8Z A;  2RJP A;  3AYK A;  3E8R A;  1ZVX A;  5D3C A;  1BUV M;  1MMQ A;  4R3V A;  4DV8 A;  2JNP A;  1OMJ A;  3OHL A;  1UEA A;  1IAG A;  2HU6 A;  3LQ0 A;  1ZTQ A;  2X7M A;  4GR8 A;  4PKR A;  3ZUK A;  4XCT A;  3USN A;  4XM7 A;  1KUF A;  1JAO A;  1GE5 A;  1MNC A;  2I47 A;  3LUN A;  2D1O A;  2MLS A;  2OY4 A;  5L7F A;  2KRJ A;  1D7X A;  4EFS A;  1MMR A;  2J0T A;  1PWQ A;  966C A;  3LJT A;  1BZS A;  3Q2G A;  4GWN A;  1R1J A;  1RMZ A;  1FBL A;  2X3B A;  1Y93 A;  4H82 A;  5L79 A;  2W13 A;  4JQG A;  1K7Q A;  4FXY P;  2YB9 A;  1JAQ A;  1OO9 A;  3HB2 P;  1K7I A;  4WF6 A;  1Z3J A;  5BPA A;  3F17 A;  3AYU A;  2OW2 A;  2WO9 A;  1ND1 A;  3P24 A;  1A85 A;  1ZXC A;  4GWM A;  1C8T A;  2K2G A;  2O3E A;  4L63 A;  1XFW A;  3F16 A;  2Z2D A;  1YP1 A;  1ZS0 A;  1SMP A;  4PKV A;  1XFY A;  1AF0 A;  3LUM A;  3VTG A;  1XFV A;  4AUO A;  5I43 A;  2SRT A;  1Y8J A;  2XS4 A;  1IAD A;  2JT6 A;  5JMY A;  2RJQ A;  3LIL A;  1DTH A;  4AYK A;  3LQB A;  1CQR A;  2MZE A;  2OW1 A;  2FV9 A;  4GR0 A;  2YUF A;  1I1I P;  1ZP5 A;  2Y6D A;  5CXA A;  2E3X A;  3O64 A;  1BKC A;  1S4B P;  1G05 A;  4J4M A;  1JAP A;  3Q2H A;  3G42 A;  1OM8 A;  5H8X A;  1QJI A;  4H3X A;  1KAP P;  1SAT A;  4H30 A;  3DNG A;  3I7G A;  2OXZ A;  2DW1 A;  1I73 A;  5D1T A;  3EDZ A;  3AIG A;  4DD8 A;  1HV5 A;  3TVC A;  1O0T A;  4I35 A;  3HBV P;  4WK7 A;  3ZXH A;  3EWJ A;  1CGE A;  1CIZ A;  2DDF A;  1G9K A;  3HY9 A;  2OXW A;  4HMA A;  1PWV A;  3B92 A;  1R1H A;  1ATL A;  5B5O A;  4FU4 A;  1JJ9 A;  3LGP A;  1OM6 A;  2USN A;  4PKS A;  1KUK A;  3WV1 A;  1H71 P;  5I4O A;  1GKD A;  1UMS A;  1A86 A;  4A7B A;  5D1S A;  2V4B A;  2JIH A;  1D8F A;  1B8Y A;  3LIK A;  1OS9 A;  1CGF A;  5D2B A;  1CXV A;  2MLR A;  1C7K A;  3KME A;  4ZR5 A;  4WKI A;  3TT4 A;  2OVZ A;  2ERQ A;  4AIG A;  4G9L A;  1R55 A;  1BKC E;  1ROS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...