2RJPA

Crystal structure of adamts4 with inhibitor bound
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
295
structure length
291
Chain Sequence
b'ASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHQLGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAMTS-4
publication title Crystal structures of the two major aggrecan degrading enzymes, ADAMTS4 and ADAMTS5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 291
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.82: ADAMTS-4 endopeptidase.
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2rjpA01
4ZR5A 5I43A 5D3CA 1SRPA 3USNA 1Z3JA 3ZUKA 1XFWA 4AIGA 3DL1A 2OI0A 3LUNA 1IABA 2TCLA 1XFXA 2AYKA 1XURA 4JQGA 4JP4A 456CA 3EDIA 2POJA 1UEAA 1CGLA 2J83A 3RTTA 2DW0A 1OO9A 2JIHA 3Q2GA 3TS4A 1JH1A 4A3WA 3KMCA 1G9KA 3DWBA 4J4MA 1H71P 1SATA 4IN9A 3GBOA 2W14A 3G42A 3HB2P 1B3DA 4AXQA 4EFSA 1L6JA 3K7NA 2L0RA 5I2ZA 1D8FA 2W0DA 4PKQA 1AF0A 3LKAA 2USNA 4HX3A 3LQBA 1JK3A 2J0TA 1OM6A 1A85A 1RMZA 1SLNA 1BKCA 3DSLA 1FM1A 1R1IA 4QKZA 2OXWA 4XCTA 3EDGA 3P24A 4H2EA 4AYKA 2WO9A 4PKWA 2XS4A 1Y8JA 3E8RA 5CXAA 2SRTA 1K7IA 4WKEA 3TT4A 1OM8A 1JKYA 1IAGA 3UVCA 1BM6A 1ND1A 3LQ0A 1CXVA 4PKRA 1GO7P 1QIBA 4AUOA 1UTZA 4XM6A 5I0LA 2I47A 3KHIA 4GF1A 3HDAP 2YIGA 1K7QA 1XFVA 1Y93A 3KRYA 3MA2A 2X3AA 1YOUA 4H30A 2E2DA 1EAKA 1C3IA 3V96B 2FV9A 1CAQA 2OW9A 3HBUP 4ON1A 3EDHA 830CA 4DF9A 1WNIA 4FVLA 2PJTA 5B5PA 2OVZA 3LILA 3DPEA 1ATLA 1XUCA 3TVCA 2MZIA 3WV3A 2XS3A 1R1JA 2OY4A 4DPEA 1G12A 4R3VA 1OS2A 4PKVA 1IACA 1R1HA 1OMJA 2Z2DA 3U1RA 1CGFA 2QPJA 3B92A 3Q2HA 4XM8A 1PWWA 2DDFA 1MNCA 3HYGA 2X3CA 4H1QA 2ERQA 3AYKA 3LE9A 1KAPP 5I4OA 3B8ZA 1HOVA 1GXDA 3F18A 3CKIA 2DW2A 2FV5A 1BKCE 4PKSA 4I03A 1BQQM 1EUBA 1GKDA 1GO8P 3F1AA 3VI1A 1ASTA 4PKUA 1S4BP 4WF6A 4A7BA 4L63A 3O64A 2MZEA 1HFCA 3EDZA 1IAEA 1XUDA 1KUFA 2W15A 1UTTA 1Y0VA 3NX7A 4H76A 5CZMA 5B5OA 2JNPA 1RM8A 4FXQA 3L0VA 2WOAA 4JIJA 3KECA 2X7MA 1ZS0A 4WZVA 3N2VA 3KEKA 2OW2A 3WV2A 3AIGA 3RTSA 2Y6DA 1EB6A 2CKIA 1BZSA 4Q1LA 1BKCI 1I73A 4XBHA 1O0TA 4GUYA 4GQLA 3EHYA 1DTHA 4WKIA 3F15A 4CTHA 2OW1A 2K2GA 4FU4A 1QICA 4HMAA 3LK8A 2OZRA 1G49A 4FXYP 2N8RA 1YCMA 4DV8A 5LABA 5I12A 4GWMA 1A86A 1C7KA 3EWJA 5BPAA 2W12A 3F17A 1IADA 1Q3AA 1GE5A 2D1NA 3LIRA 3HDBA 3BA0A 2WO8A 1QJIA 1ZTQA 1DMTA 1BSWA 3LIKA 2KRJA 3F19A 4JPAA 3HY7A 2W13A 5D1UA 1BUVM 1BQOA 2MZHA 3AYUA 2OXZA 1I1IP 1HFSA 1QJJA 2O3EA 1SLMA 2JT5A 3LEAA 1UMSA 2OY2A 3F16A 1XFZA 1G4KA 1AYKA 2RJQA 4DD8A 3OHOA 5BOYA 1BUDA 2E3XA 3LJGA 1PWVA 4I35A 3LJZA 1JAPA 5I3MA 3KEJA 1ZXCA 4GR8A 1HTDA 1QIAA 3EHXA 4PKTA 3LGPA 1JAOA 2O36A 4L6TA 5L79A 2MLSA 5D1SA 1JIZA 3O2XA 3OHLA 3HBVP 1K7GA 1CQRA 1XFYA 3ZVSA 1D5JA 2HU6A 5D7WA 966CA 4IJOA 4L19A 2EROA 5CUHA 1J7NA 1O0QA 2MLRA 1FLSA 5JMYA 1JIWP 2DDYA 1R55A 4GR3A 2OXUA 4WK7A 1CK7A 1G05A 1D7XA 1YQYA 1GE6A 4G9LA 5H8XA 1KUIA 2X3BA 3KMEA 4H3XA 1KBCA 1B8YA 4H49A 1KUGA 1UMTA 1KUHA 3LUMA 3DNGA 3WV1A 1PWQA 2DW1A 1KUKA 3ZXHA 3I7IA 2RJPA 4H82A 1JAQA 1C8TA 3DPFA 1PWUA 3K7LA 2AIGP 2CLTA 1ZXVA 2D1OA 3VTGA 1CIZA 3KWVC 2ERPA 3I7GA 1GKCA 1YP1A 4IUWA 1D8MA 3ELMA 2YB9A 1USNA 1MMPA 1CGEA 1ZVXA 1ROSA 5D1TA 1JANA 1OS9A 3LJTA 4H84A 1MMRA 4GWNA 1R54A 1ZP5A 1HV5A 3SHIA 1FBLA 3L0TA 1I76A 1GE7A 3HY9A 1BIWA 1AKLA 1IAAA 2A8HA 2JSDA 1JJ9A 1XFUA 4G0DA 1OM7A 4ILWD 4JA1A 3TSKA 1QUAA 2V4BA 5D2BA 2Y6CA 1MMBA 1MMQA 3B2ZA 5L7FA 3N2UA 1PWPA 4GR0A 1SMPA 2K9CA 3P1VA 2JT6A 4XM7A 2OW0A 2OVXA 5BOTA 3G5CA 3LMCA 1SU3A 1HY7A
chains in the Genus database with same CATH superfamily
4ZR5A 5I43A 5D3CA 1SRPA 3USNA 1Z3JA 3ZUKA 1XFWA 4AIGA 3DL1A 2OI0A 3LUNA 1IABA 2TCLA 1XFXA 2AYKA 1XURA 4JQGA 4JP4A 456CA 3EDIA 2POJA 1UEAA 1CGLA 2J83A 3RTTA 2DW0A 1OO9A 2JIHA 3Q2GA 3TS4A 1JH1A 4A3WA 3KMCA 1G9KA 3DWBA 4J4MA 1H71P 1SATA 4IN9A 3GBOA 2W14A 3G42A 3HB2P 1B3DA 4AXQA 4EFSA 1L6JA 3K7NA 2L0RA 5I2ZA 1D8FA 2W0DA 4PKQA 1AF0A 3LKAA 2USNA 4HX3A 3LQBA 1JK3A 2J0TA 1OM6A 1A85A 1RMZA 1SLNA 1BKCA 3DSLA 1FM1A 1R1IA 4QKZA 2OXWA 4XCTA 3EDGA 3P24A 4H2EA 4AYKA 2WO9A 4PKWA 2XS4A 1Y8JA 3E8RA 5CXAA 2SRTA 1K7IA 4WKEA 3TT4A 1OM8A 1JKYA 1IAGA 3UVCA 1BM6A 1ND1A 3LQ0A 1CXVA 4PKRA 1GO7P 1QIBA 4AUOA 1UTZA 4XM6A 5I0LA 2I47A 3KHIA 4GF1A 3HDAP 2YIGA 1K7QA 1XFVA 1Y93A 3KRYA 3MA2A 2X3AA 1YOUA 4H30A 2E2DA 1EAKA 1TVIA 1C3IA 3V96B 2FV9A 1CAQA 2OW9A 3HBUP 4ON1A 3EDHA 830CA 4DF9A 1WNIA 4FVLA 2PJTA 5B5PA 2OVZA 3LILA 3DPEA 1ATLA 1XUCA 3TVCA 2MZIA 3WV3A 2XS3A 1R1JA 2OY4A 4DPEA 1G12A 4R3VA 1OS2A 4PKVA 1IACA 1R1HA 1OMJA 2Z2DA 1XM5A 3U1RA 1CGFA 2QPJA 3B92A 3Q2HA 4XM8A 1PWWA 2DDFA 1MNCA 3HYGA 2X3CA 4H1QA 2ERQA 3AYKA 3LE9A 1KAPP 5I4OA 3B8ZA 1HOVA 1GXDA 3F18A 3CKIA 2DW2A 2FV5A 1BKCE 4PKSA 4I03A 1BQQM 1EUBA 3DTKA 1GKDA 1GO8P 3F1AA 3VI1A 1ASTA 4PKUA 1S4BP 4WF6A 4A7BA 4L63A 3O64A 2MZEA 1HFCA 3EDZA 1IAEA 1XUDA 1KUFA 2W15A 1UTTA 1Y0VA 3NX7A 4H76A 5CZMA 5B5OA 2JNPA 1RM8A 4FXQA 3L0VA 2WOAA 4JIJA 3KECA 2X7MA 1ZS0A 4WZVA 3N2VA 3KEKA 2OW2A 3WV2A 3AIGA 3RTSA 2Y6DA 1EB6A 2CKIA 1BZSA 2YUFA 4Q1LA 1BKCI 1I73A 4XBHA 1O0TA 4GUYA 4GQLA 3EHYA 1DTHA 4WKIA 3F15A 4CTHA 2OW1A 2K2GA 4FU4A 1QICA 4HMAA 3LK8A 2OZRA 1G49A 4FXYP 2N8RA 1YCMA 4DV8A 5LABA 5I12A 1OZ9A 1A86A 4GWMA 1C7KA 3EWJA 5BPAA 2W12A 3F17A 1IADA 1Q3AA 1GE5A 2D1NA 3LIRA 3HDBA 3BA0A 2WO8A 1QJIA 1ZTQA 1DMTA 1BSWA 3LIKA 2KRJA 4L7AA 3F19A 4JPAA 3HY7A 2W13A 5D1UA 1BUVM 1BQOA 2MZHA 3AYUA 2OXZA 1I1IP 1HFSA 1QJJA 2O3EA 1SLMA 2JT5A 3LEAA 1UMSA 2OY2A 3F16A 1XFZA 1G4KA 1AYKA 2RJQA 4DD8A 3DTIA 3OHOA 5BOYA 1BUDA 2E3XA 3LJGA 1XAXA 1PWVA 4I35A 3LJZA 1JAPA 5I3MA 3KEJA 1ZXCA 4GR8A 1HTDA 1QIAA 3EHXA 4PKTA 3LGPA 1JAOA 2O36A 4L6TA 5L79A 2MLSA 5D1SA 1JIZA 3O2XA 3OHLA 3HBVP 1K7GA 1CQRA 1XFYA 3ZVSA 1D5JA 2HU6A 5D7WA 966CA 4IJOA 4L19A 2EROA 5CUHA 1J7NA 1O0QA 2MLRA 1FLSA 5JMYA 1JIWP 2DDYA 1R55A 4GR3A 2OXUA 4WK7A 1CK7A 1G05A 1D7XA 1YQYA 1GE6A 4G9LA 5H8XA 1KUIA 2X3BA 3KMEA 4H3XA 1KBCA 1B8YA 3DTEA 4H49A 1KUGA 1UMTA 1KUHA 3LUMA 3DNGA 3WV1A 1PWQA 2DW1A 1KUKA 3ZXHA 3I7IA 2RJPA 4H82A 1JAQA 1C8TA 3DPFA 1PWUA 3K7LA 2AIGP 2CLTA 1ZXVA 2D1OA 3VTGA 1CIZA 3KWVC 2ERPA 3I7GA 1GKCA 1YP1A 4IUWA 1D8MA 3ELMA 2YB9A 1USNA 1MMPA 1CGEA 1ZVXA 1ROSA 5D1TA 1JANA 1OS9A 3LJTA 4H84A 1MMRA 4GWNA 1R54A 1ZP5A 1HV5A 3SHIA 1FBLA 3L0TA 1I76A 1GE7A 3HY9A 1BIWA 1AKLA 1IAAA 2A8HA 2JSDA 1JJ9A 1XFUA 4G0DA 1OM7A 4ILWD 4JA1A 3TSKA 1QUAA 2V4BA 5D2BA 2Y6CA 1MMBA 1MMQA 3B2ZA 5L7FA 3N2UA 1PWPA 4GR0A 1SMPA 2K9CA 3P1VA 2JT6A 4XM7A 2OW0A 2OVXA 5BOTA 3G5CA 3LMCA 1SU3A 1HY7A
chains in the Genus database with same CATH topology
4ZR5A 5I43A 5D3CA 1SRPA 3USNA 1Z3JA 3ZUKA 1XFWA 4AIGA 3DL1A 2OI0A 3LUNA 1IABA 2TCLA 1XFXA 2AYKA 1XURA 4JQGA 4JP4A 456CA 3EDIA 2POJA 1UEAA 1CGLA 2J83A 3RTTA 2DW0A 1OO9A 2JIHA 3Q2GA 3TS4A 1JH1A 4A3WA 3KMCA 1G9KA 3DWBA 4J4MA 1H71P 1SATA 4IN9A 3GBOA 2W14A 3G42A 3HB2P 1B3DA 4AXQA 4EFSA 1L6JA 3K7NA 2L0RA 5I2ZA 1D8FA 2W0DA 4PKQA 1AF0A 3LKAA 2USNA 4HX3A 3LQBA 1JK3A 2J0TA 1OM6A 1A85A 1RMZA 1SLNA 1BKCA 3DSLA 1FM1A 1R1IA 4QKZA 2OXWA 4XCTA 3EDGA 3P24A 4H2EA 4AYKA 2WO9A 4PKWA 2XS4A 1Y8JA 3E8RA 5CXAA 2SRTA 1K7IA 4WKEA 3TT4A 1OM8A 1JKYA 1IAGA 3UVCA 1BM6A 1ND1A 3LQ0A 1CXVA 4PKRA 1GO7P 1QIBA 4AUOA 1UTZA 4XM6A 5I0LA 2I47A 3KHIA 4GF1A 3HDAP 2YIGA 1K7QA 1XFVA 1Y93A 3KRYA 3MA2A 2X3AA 1YOUA 4H30A 2E2DA 1EAKA 1C3IA 3V96B 2FV9A 1CAQA 2OW9A 3HBUP 4ON1A 3EDHA 830CA 4DF9A 1WNIA 4FVLA 2PJTA 5B5PA 2OVZA 3LILA 3DPEA 1ATLA 1XUCA 3TVCA 2MZIA 3WV3A 2XS3A 1R1JA 2OY4A 4DPEA 1G12A 4R3VA 1OS2A 4PKVA 1IACA 1R1HA 1OMJA 2Z2DA 3U1RA 1CGFA 2QPJA 3B92A 3Q2HA 4XM8A 1PWWA 2DDFA 1MNCA 3HYGA 2X3CA 4H1QA 2ERQA 3AYKA 3LE9A 1KAPP 5I4OA 3B8ZA 1HOVA 1GXDA 3F18A 3CKIA 2DW2A 2FV5A 1BKCE 4PKSA 4I03A 1BQQM 1EUBA 3DTKA 1GKDA 1GO8P 3F1AA 3VI1A 1ASTA 4PKUA 1S4BP 4WF6A 4A7BA 4L63A 3O64A 2MZEA 1HFCA 3EDZA 1IAEA 1XUDA 1KUFA 2W15A 1UTTA 1Y0VA 3NX7A 4H76A 5CZMA 5B5OA 2JNPA 1RM8A 4FXQA 3L0VA 2WOAA 4JIJA 3KECA 2X7MA 1ZS0A 4WZVA 3N2VA 3KEKA 2OW2A 3WV2A 3AIGA 3RTSA 2Y6DA 1EB6A 2CKIA 1BZSA 2YUFA 4Q1LA 1BKCI 1I73A 4XBHA 1O0TA 4GUYA 4GQLA 3EHYA 1DTHA 4WKIA 3F15A 4CTHA 2OW1A 2K2GA 4FU4A 1QICA 4HMAA 3LK8A 2OZRA 1G49A 4FXYP 2N8RA 1YCMA 4DV8A 5LABA 5I12A 4GWMA 1A86A 1C7KA 3EWJA 5BPAA 2W12A 3F17A 1IADA 1Q3AA 1GE5A 2D1NA 3LIRA 3HDBA 3BA0A 2WO8A 1QJIA 1ZTQA 1DMTA 1BSWA 3LIKA 2KRJA 4L7AA 3F19A 4JPAA 3HY7A 2W13A 5D1UA 1BUVM 1BQOA 2MZHA 3AYUA 2OXZA 1I1IP 1HFSA 1QJJA 2O3EA 1SLMA 2JT5A 3LEAA 1UMSA 2OY2A 3F16A 1XFZA 1G4KA 1AYKA 2RJQA 4DD8A 3DTIA 3OHOA 5BOYA 1BUDA 2E3XA 3LJGA 1PWVA 4I35A 3LJZA 1JAPA 5I3MA 3KEJA 1ZXCA 4GR8A 1HTDA 1QIAA 3EHXA 4PKTA 3LGPA 1JAOA 2O36A 4L6TA 5L79A 2MLSA 5D1SA 1JIZA 3O2XA 3OHLA 3HBVP 1K7GA 1CQRA 1XFYA 3ZVSA 1D5JA 2HU6A 5D7WA 966CA 4IJOA 4L19A 2EROA 5CUHA 1J7NA 1O0QA 2MLRA 1FLSA 5JMYA 1JIWP 2DDYA 1R55A 4GR3A 2OXUA 4WK7A 1CK7A 1G05A 1D7XA 1YQYA 1GE6A 4G9LA 5H8XA 1KUIA 2X3BA 3KMEA 4H3XA 1KBCA 1B8YA 3DTEA 4H49A 1KUGA 1UMTA 1KUHA 3LUMA 3DNGA 3WV1A 1PWQA 2DW1A 1KUKA 3ZXHA 3I7IA 2RJPA 4H82A 1JAQA 1C8TA 3DPFA 1PWUA 3K7LA 2AIGP 2CLTA 1ZXVA 2D1OA 3VTGA 1CIZA 3KWVC 2ERPA 3I7GA 1GKCA 1YP1A 4IUWA 1D8MA 3ELMA 2YB9A 1USNA 1MMPA 1CGEA 1ZVXA 1ROSA 5D1TA 1JANA 1OS9A 3LJTA 4H84A 1MMRA 4GWNA 1R54A 1ZP5A 1HV5A 3SHIA 1FBLA 3L0TA 1I76A 1GE7A 3HY9A 1BIWA 1AKLA 1IAAA 2A8HA 2JSDA 1JJ9A 1XFUA 4G0DA 1OM7A 4ILWD 4JA1A 3TSKA 1QUAA 2V4BA 5D2BA 2Y6CA 1MMBA 1MMQA 3B2ZA 5L7FA 3N2UA 1PWPA 4GR0A 1SMPA 2K9CA 3P1VA 2JT6A 4XM7A 2OW0A 2OVXA 5BOTA 3G5CA 3LMCA 1SU3A 1HY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZR5 A;  5I43 A;  5D3C A;  1SRP A;  3USN A;  1Z3J A;  3ZUK A;  1XFW A;  4AIG A;  3DL1 A;  2OI0 A;  3LUN A;  1IAB A;  2TCL A;  1XFX A;  2AYK A;  1XUR A;  4JQG A;  4JP4 A;  456C A;  3EDI A;  2POJ A;  1UEA A;  1CGL A;  2J83 A;  3RTT A;  2DW0 A;  1OO9 A;  2JIH A;  3Q2G A;  3TS4 A;  1JH1 A;  4A3W A;  3KMC A;  1G9K A;  3DWB A;  4J4M A;  1H71 P;  1SAT A;  4IN9 A;  3GBO A;  2W14 A;  3G42 A;  3HB2 P;  1B3D A;  4AXQ A;  4EFS A;  1L6J A;  3K7N A;  2L0R A;  5I2Z A;  1D8F A;  2W0D A;  4PKQ A;  1AF0 A;  3LKA A;  2USN A;  4HX3 A;  3LQB A;  1JK3 A;  2J0T A;  1OM6 A;  1A85 A;  1RMZ A;  1SLN A;  1BKC A;  3DSL A;  1FM1 A;  1R1I A;  4QKZ A;  2OXW A;  4XCT A;  3EDG A;  3P24 A;  4H2E A;  4AYK A;  2WO9 A;  4PKW A;  2XS4 A;  1Y8J A;  3E8R A;  5CXA A;  2SRT A;  1K7I A;  4WKE A;  3TT4 A;  1OM8 A;  1JKY A;  1IAG A;  3UVC A;  1BM6 A;  1ND1 A;  3LQ0 A;  1CXV A;  4PKR A;  1GO7 P;  1QIB A;  4AUO A;  1UTZ A;  4XM6 A;  5I0L A;  2I47 A;  3KHI A;  4GF1 A;  3HDA P;  2YIG A;  1K7Q A;  1XFV A;  1Y93 A;  3KRY A;  3MA2 A;  2X3A A;  1YOU A;  4H30 A;  2E2D A;  1EAK A;  1C3I A;  3V96 B;  2FV9 A;  1CAQ A;  2OW9 A;  3HBU P;  4ON1 A;  3EDH A;  830C A;  4DF9 A;  1WNI A;  4FVL A;  2PJT A;  5B5P A;  2OVZ A;  3LIL A;  3DPE A;  1ATL A;  1XUC A;  3TVC A;  2MZI A;  3WV3 A;  2XS3 A;  1R1J A;  2OY4 A;  4DPE A;  1G12 A;  4R3V A;  1OS2 A;  4PKV A;  1IAC A;  1R1H A;  1OMJ A;  2Z2D A;  3U1R A;  1CGF A;  2QPJ A;  3B92 A;  3Q2H A;  4XM8 A;  1PWW A;  2DDF A;  1MNC A;  3HYG A;  2X3C A;  4H1Q A;  2ERQ A;  3AYK A;  3LE9 A;  1KAP P;  5I4O A;  3B8Z A;  1HOV A;  1GXD A;  3F18 A;  3CKI A;  2DW2 A;  2FV5 A;  1BKC E;  4PKS A;  4I03 A;  1BQQ M;  1EUB A;  1GKD A;  1GO8 P;  3F1A A;  3VI1 A;  1AST A;  4PKU A;  1S4B P;  4WF6 A;  4A7B A;  4L63 A;  3O64 A;  2MZE A;  1HFC A;  3EDZ A;  1IAE A;  1XUD A;  1KUF A;  2W15 A;  1UTT A;  1Y0V A;  3NX7 A;  4H76 A;  5CZM A;  5B5O A;  2JNP A;  1RM8 A;  4FXQ A;  3L0V A;  2WOA A;  4JIJ A;  3KEC A;  2X7M A;  1ZS0 A;  4WZV A;  3N2V A;  3KEK A;  2OW2 A;  3WV2 A;  3AIG A;  3RTS A;  2Y6D A;  1EB6 A;  2CKI A;  1BZS A;  4Q1L A;  1BKC I;  1I73 A;  4XBH A;  1O0T A;  4GUY A;  4GQL A;  3EHY A;  1DTH A;  4WKI A;  3F15 A;  4CTH A;  2OW1 A;  2K2G A;  4FU4 A;  1QIC A;  4HMA A;  3LK8 A;  2OZR A;  1G49 A;  4FXY P;  2N8R A;  1YCM A;  4DV8 A;  5LAB A;  5I12 A;  4GWM A;  1A86 A;  1C7K A;  3EWJ A;  5BPA A;  2W12 A;  3F17 A;  1IAD A;  1Q3A A;  1GE5 A;  2D1N A;  3LIR A;  3HDB A;  3BA0 A;  2WO8 A;  1QJI A;  1ZTQ A;  1DMT A;  1BSW A;  3LIK A;  2KRJ A;  3F19 A;  4JPA A;  3HY7 A;  2W13 A;  5D1U A;  1BUV M;  1BQO A;  2MZH A;  3AYU A;  2OXZ A;  1I1I P;  1HFS A;  1QJJ A;  2O3E A;  1SLM A;  2JT5 A;  3LEA A;  1UMS A;  2OY2 A;  3F16 A;  1XFZ A;  1G4K A;  1AYK A;  2RJQ A;  4DD8 A;  3OHO A;  5BOY A;  1BUD A;  2E3X A;  3LJG A;  1PWV A;  4I35 A;  3LJZ A;  1JAP A;  5I3M A;  3KEJ A;  1ZXC A;  4GR8 A;  1HTD A;  1QIA A;  3EHX A;  4PKT A;  3LGP A;  1JAO A;  2O36 A;  4L6T A;  5L79 A;  2MLS A;  5D1S A;  1JIZ A;  3O2X A;  3OHL A;  3HBV P;  1K7G A;  1CQR A;  1XFY A;  3ZVS A;  1D5J A;  2HU6 A;  5D7W A;  966C A;  4IJO A;  4L19 A;  2ERO A;  5CUH A;  1J7N A;  1O0Q A;  2MLR A;  1FLS A;  5JMY A;  1JIW P;  2DDY A;  1R55 A;  4GR3 A;  2OXU A;  4WK7 A;  1CK7 A;  1G05 A;  1D7X A;  1YQY A;  1GE6 A;  4G9L A;  5H8X A;  1KUI A;  2X3B A;  3KME A;  4H3X A;  1KBC A;  1B8Y A;  4H49 A;  1KUG A;  1UMT A;  1KUH A;  3LUM A;  3DNG A;  3WV1 A;  1PWQ A;  2DW1 A;  1KUK A;  3ZXH A;  3I7I A;  2RJP A;  4H82 A;  1JAQ A;  1C8T A;  3DPF A;  1PWU A;  3K7L A;  2AIG P;  2CLT A;  1ZXV A;  2D1O A;  3VTG A;  1CIZ A;  3KWV C;  2ERP A;  3I7G A;  1GKC A;  1YP1 A;  4IUW A;  1D8M A;  3ELM A;  2YB9 A;  1USN A;  1MMP A;  1CGE A;  1ZVX A;  1ROS A;  5D1T A;  1JAN A;  1OS9 A;  3LJT A;  4H84 A;  1MMR A;  4GWN A;  1R54 A;  1ZP5 A;  1HV5 A;  3SHI A;  1FBL A;  3L0T A;  1I76 A;  1GE7 A;  3HY9 A;  1BIW A;  1AKL A;  1IAA A;  2A8H A;  2JSD A;  1JJ9 A;  1XFU A;  4G0D A;  1OM7 A;  4ILW D;  4JA1 A;  3TSK A;  1QUA A;  2V4B A;  5D2B A;  2Y6C A;  1MMB A;  1MMQ A;  3B2Z A;  5L7F A;  3N2U A;  1PWP A;  4GR0 A;  1SMP A;  2K9C A;  3P1V A;  2JT6 A;  4XM7 A;  2OW0 A;  2OVX A;  5BOT A;  3G5C A;  3LMC A;  1SU3 A;  1HY7 A; 
#chains in the Genus database with same CATH topology
 4ZR5 A;  5I43 A;  5D3C A;  1SRP A;  3USN A;  1Z3J A;  3ZUK A;  1XFW A;  4AIG A;  3DL1 A;  2OI0 A;  3LUN A;  1IAB A;  2TCL A;  1XFX A;  2AYK A;  1XUR A;  4JQG A;  4JP4 A;  456C A;  3EDI A;  2POJ A;  1UEA A;  1CGL A;  2J83 A;  3RTT A;  2DW0 A;  1OO9 A;  2JIH A;  3Q2G A;  3TS4 A;  1JH1 A;  4A3W A;  3KMC A;  1G9K A;  3DWB A;  4J4M A;  1H71 P;  1SAT A;  4IN9 A;  3GBO A;  2W14 A;  3G42 A;  3HB2 P;  1B3D A;  4AXQ A;  4EFS A;  1L6J A;  3K7N A;  2L0R A;  5I2Z A;  1D8F A;  2W0D A;  4PKQ A;  1AF0 A;  3LKA A;  2USN A;  4HX3 A;  3LQB A;  1JK3 A;  2J0T A;  1OM6 A;  1A85 A;  1RMZ A;  1SLN A;  1BKC A;  3DSL A;  1FM1 A;  1R1I A;  4QKZ A;  2OXW A;  4XCT A;  3EDG A;  3P24 A;  4H2E A;  4AYK A;  2WO9 A;  4PKW A;  2XS4 A;  1Y8J A;  3E8R A;  5CXA A;  2SRT A;  1K7I A;  4WKE A;  3TT4 A;  1OM8 A;  1JKY A;  1IAG A;  3UVC A;  1BM6 A;  1ND1 A;  3LQ0 A;  1CXV A;  4PKR A;  1GO7 P;  1QIB A;  4AUO A;  1UTZ A;  4XM6 A;  5I0L A;  2I47 A;  3KHI A;  4GF1 A;  3HDA P;  2YIG A;  1K7Q A;  1XFV A;  1Y93 A;  3KRY A;  3MA2 A;  2X3A A;  1YOU A;  4H30 A;  2E2D A;  1EAK A;  1TVI A;  1C3I A;  3V96 B;  2FV9 A;  1CAQ A;  2OW9 A;  3HBU P;  4ON1 A;  3EDH A;  830C A;  4DF9 A;  1WNI A;  4FVL A;  2PJT A;  5B5P A;  2OVZ A;  3LIL A;  3DPE A;  1ATL A;  1XUC A;  3TVC A;  2MZI A;  3WV3 A;  2XS3 A;  1R1J A;  2OY4 A;  4DPE A;  1G12 A;  4R3V A;  1OS2 A;  4PKV A;  1IAC A;  1R1H A;  1OMJ A;  2Z2D A;  1XM5 A;  3U1R A;  1CGF A;  2QPJ A;  3B92 A;  3Q2H A;  4XM8 A;  1PWW A;  2DDF A;  1MNC A;  3HYG A;  2X3C A;  4H1Q A;  2ERQ A;  3AYK A;  3LE9 A;  1KAP P;  5I4O A;  3B8Z A;  1HOV A;  1GXD A;  3F18 A;  3CKI A;  2DW2 A;  2FV5 A;  1BKC E;  4PKS A;  4I03 A;  1BQQ M;  1EUB A;  3DTK A;  1GKD A;  1GO8 P;  3F1A A;  3VI1 A;  1AST A;  4PKU A;  1S4B P;  4WF6 A;  4A7B A;  4L63 A;  3O64 A;  2MZE A;  1HFC A;  3EDZ A;  1IAE A;  1XUD A;  1KUF A;  2W15 A;  1UTT A;  1Y0V A;  3NX7 A;  4H76 A;  5CZM A;  5B5O A;  2JNP A;  1RM8 A;  4FXQ A;  3L0V A;  2WOA A;  4JIJ A;  3KEC A;  2X7M A;  1ZS0 A;  4WZV A;  3N2V A;  3KEK A;  2OW2 A;  3WV2 A;  3AIG A;  3RTS A;  2Y6D A;  1EB6 A;  2CKI A;  1BZS A;  2YUF A;  4Q1L A;  1BKC I;  1I73 A;  4XBH A;  1O0T A;  4GUY A;  4GQL A;  3EHY A;  1DTH A;  4WKI A;  3F15 A;  4CTH A;  2OW1 A;  2K2G A;  4FU4 A;  1QIC A;  4HMA A;  3LK8 A;  2OZR A;  1G49 A;  4FXY P;  2N8R A;  1YCM A;  4DV8 A;  5LAB A;  5I12 A;  1OZ9 A;  1A86 A;  4GWM A;  1C7K A;  3EWJ A;  5BPA A;  2W12 A;  3F17 A;  1IAD A;  1Q3A A;  1GE5 A;  2D1N A;  3LIR A;  3HDB A;  3BA0 A;  2WO8 A;  1QJI A;  1ZTQ A;  1DMT A;  1BSW A;  3LIK A;  2KRJ A;  4L7A A;  3F19 A;  4JPA A;  3HY7 A;  2W13 A;  5D1U A;  1BUV M;  1BQO A;  2MZH A;  3AYU A;  2OXZ A;  1I1I P;  1HFS A;  1QJJ A;  2O3E A;  1SLM A;  2JT5 A;  3LEA A;  1UMS A;  2OY2 A;  3F16 A;  1XFZ A;  1G4K A;  1AYK A;  2RJQ A;  4DD8 A;  3DTI A;  3OHO A;  5BOY A;  1BUD A;  2E3X A;  3LJG A;  1XAX A;  1PWV A;  4I35 A;  3LJZ A;  1JAP A;  5I3M A;  3KEJ A;  1ZXC A;  4GR8 A;  1HTD A;  1QIA A;  3EHX A;  4PKT A;  3LGP A;  1JAO A;  2O36 A;  4L6T A;  5L79 A;  2MLS A;  5D1S A;  1JIZ A;  3O2X A;  3OHL A;  3HBV P;  1K7G A;  1CQR A;  1XFY A;  3ZVS A;  1D5J A;  2HU6 A;  5D7W A;  966C A;  4IJO A;  4L19 A;  2ERO A;  5CUH A;  1J7N A;  1O0Q A;  2MLR A;  1FLS A;  5JMY A;  1JIW P;  2DDY A;  1R55 A;  4GR3 A;  2OXU A;  4WK7 A;  1CK7 A;  1G05 A;  1D7X A;  1YQY A;  1GE6 A;  4G9L A;  5H8X A;  1KUI A;  2X3B A;  3KME A;  4H3X A;  1KBC A;  1B8Y A;  3DTE A;  4H49 A;  1KUG A;  1UMT A;  1KUH A;  3LUM A;  3DNG A;  3WV1 A;  1PWQ A;  2DW1 A;  1KUK A;  3ZXH A;  3I7I A;  2RJP A;  4H82 A;  1JAQ A;  1C8T A;  3DPF A;  1PWU A;  3K7L A;  2AIG P;  2CLT A;  1ZXV A;  2D1O A;  3VTG A;  1CIZ A;  3KWV C;  2ERP A;  3I7G A;  1GKC A;  1YP1 A;  4IUW A;  1D8M A;  3ELM A;  2YB9 A;  1USN A;  1MMP A;  1CGE A;  1ZVX A;  1ROS A;  5D1T A;  1JAN A;  1OS9 A;  3LJT A;  4H84 A;  1MMR A;  4GWN A;  1R54 A;  1ZP5 A;  1HV5 A;  3SHI A;  1FBL A;  3L0T A;  1I76 A;  1GE7 A;  3HY9 A;  1BIW A;  1AKL A;  1IAA A;  2A8H A;  2JSD A;  1JJ9 A;  1XFU A;  4G0D A;  1OM7 A;  4ILW D;  4JA1 A;  3TSK A;  1QUA A;  2V4B A;  5D2B A;  2Y6C A;  1MMB A;  1MMQ A;  3B2Z A;  5L7F A;  3N2U A;  1PWP A;  4GR0 A;  1SMP A;  2K9C A;  3P1V A;  2JT6 A;  4XM7 A;  2OW0 A;  2OVX A;  5BOT A;  3G5C A;  3LMC A;  1SU3 A;  1HY7 A; 
#chains in the Genus database with same CATH homology
 4ZR5 A;  5I43 A;  5D3C A;  1SRP A;  3USN A;  1Z3J A;  3ZUK A;  1XFW A;  4AIG A;  3DL1 A;  2OI0 A;  3LUN A;  1IAB A;  2TCL A;  1XFX A;  2AYK A;  1XUR A;  4JQG A;  4JP4 A;  456C A;  3EDI A;  2POJ A;  1UEA A;  1CGL A;  2J83 A;  3RTT A;  2DW0 A;  1OO9 A;  2JIH A;  3Q2G A;  3TS4 A;  1JH1 A;  4A3W A;  3KMC A;  1G9K A;  3DWB A;  4J4M A;  1H71 P;  1SAT A;  4IN9 A;  3GBO A;  2W14 A;  3G42 A;  3HB2 P;  1B3D A;  4AXQ A;  4EFS A;  1L6J A;  3K7N A;  2L0R A;  5I2Z A;  1D8F A;  2W0D A;  4PKQ A;  1AF0 A;  3LKA A;  2USN A;  4HX3 A;  3LQB A;  1JK3 A;  2J0T A;  1OM6 A;  1A85 A;  1RMZ A;  1SLN A;  1BKC A;  3DSL A;  1FM1 A;  1R1I A;  4QKZ A;  2OXW A;  4XCT A;  3EDG A;  3P24 A;  4H2E A;  4AYK A;  2WO9 A;  4PKW A;  2XS4 A;  1Y8J A;  3E8R A;  5CXA A;  2SRT A;  1K7I A;  4WKE A;  3TT4 A;  1OM8 A;  1JKY A;  1IAG A;  3UVC A;  1BM6 A;  1ND1 A;  3LQ0 A;  1CXV A;  4PKR A;  1GO7 P;  1QIB A;  4AUO A;  1UTZ A;  4XM6 A;  5I0L A;  2I47 A;  3KHI A;  4GF1 A;  3HDA P;  2YIG A;  1K7Q A;  1XFV A;  1Y93 A;  3KRY A;  3MA2 A;  2X3A A;  1YOU A;  4H30 A;  2E2D A;  1EAK A;  1C3I A;  3V96 B;  2FV9 A;  1CAQ A;  2OW9 A;  3HBU P;  4ON1 A;  3EDH A;  830C A;  4DF9 A;  1WNI A;  4FVL A;  2PJT A;  5B5P A;  2OVZ A;  3LIL A;  3DPE A;  1ATL A;  1XUC A;  3TVC A;  2MZI A;  3WV3 A;  2XS3 A;  1R1J A;  2OY4 A;  4DPE A;  1G12 A;  4R3V A;  1OS2 A;  4PKV A;  1IAC A;  1R1H A;  1OMJ A;  2Z2D A;  3U1R A;  1CGF A;  2QPJ A;  3B92 A;  3Q2H A;  4XM8 A;  1PWW A;  2DDF A;  1MNC A;  3HYG A;  2X3C A;  4H1Q A;  2ERQ A;  3AYK A;  3LE9 A;  1KAP P;  5I4O A;  3B8Z A;  1HOV A;  1GXD A;  3F18 A;  3CKI A;  2DW2 A;  2FV5 A;  1BKC E;  4PKS A;  4I03 A;  1BQQ M;  1EUB A;  3DTK A;  1GKD A;  1GO8 P;  3F1A A;  3VI1 A;  1AST A;  4PKU A;  1S4B P;  4WF6 A;  4A7B A;  4L63 A;  3O64 A;  2MZE A;  1HFC A;  3EDZ A;  1IAE A;  1XUD A;  1KUF A;  2W15 A;  1UTT A;  1Y0V A;  3NX7 A;  4H76 A;  5CZM A;  5B5O A;  2JNP A;  1RM8 A;  4FXQ A;  3L0V A;  2WOA A;  4JIJ A;  3KEC A;  2X7M A;  1ZS0 A;  4WZV A;  3N2V A;  3KEK A;  2OW2 A;  3WV2 A;  3AIG A;  3RTS A;  2Y6D A;  1EB6 A;  2CKI A;  1BZS A;  2YUF A;  4Q1L A;  1BKC I;  1I73 A;  4XBH A;  1O0T A;  4GUY A;  4GQL A;  3EHY A;  1DTH A;  4WKI A;  3F15 A;  4CTH A;  2OW1 A;  2K2G A;  4FU4 A;  1QIC A;  4HMA A;  3LK8 A;  2OZR A;  1G49 A;  4FXY P;  2N8R A;  1YCM A;  4DV8 A;  5LAB A;  5I12 A;  4GWM A;  1A86 A;  1C7K A;  3EWJ A;  5BPA A;  2W12 A;  3F17 A;  1IAD A;  1Q3A A;  1GE5 A;  2D1N A;  3LIR A;  3HDB A;  3BA0 A;  2WO8 A;  1QJI A;  1ZTQ A;  1DMT A;  1BSW A;  3LIK A;  2KRJ A;  4L7A A;  3F19 A;  4JPA A;  3HY7 A;  2W13 A;  5D1U A;  1BUV M;  1BQO A;  2MZH A;  3AYU A;  2OXZ A;  1I1I P;  1HFS A;  1QJJ A;  2O3E A;  1SLM A;  2JT5 A;  3LEA A;  1UMS A;  2OY2 A;  3F16 A;  1XFZ A;  1G4K A;  1AYK A;  2RJQ A;  4DD8 A;  3DTI A;  3OHO A;  5BOY A;  1BUD A;  2E3X A;  3LJG A;  1PWV A;  4I35 A;  3LJZ A;  1JAP A;  5I3M A;  3KEJ A;  1ZXC A;  4GR8 A;  1HTD A;  1QIA A;  3EHX A;  4PKT A;  3LGP A;  1JAO A;  2O36 A;  4L6T A;  5L79 A;  2MLS A;  5D1S A;  1JIZ A;  3O2X A;  3OHL A;  3HBV P;  1K7G A;  1CQR A;  1XFY A;  3ZVS A;  1D5J A;  2HU6 A;  5D7W A;  966C A;  4IJO A;  4L19 A;  2ERO A;  5CUH A;  1J7N A;  1O0Q A;  2MLR A;  1FLS A;  5JMY A;  1JIW P;  2DDY A;  1R55 A;  4GR3 A;  2OXU A;  4WK7 A;  1CK7 A;  1G05 A;  1D7X A;  1YQY A;  1GE6 A;  4G9L A;  5H8X A;  1KUI A;  2X3B A;  3KME A;  4H3X A;  1KBC A;  1B8Y A;  3DTE A;  4H49 A;  1KUG A;  1UMT A;  1KUH A;  3LUM A;  3DNG A;  3WV1 A;  1PWQ A;  2DW1 A;  1KUK A;  3ZXH A;  3I7I A;  2RJP A;  4H82 A;  1JAQ A;  1C8T A;  3DPF A;  1PWU A;  3K7L A;  2AIG P;  2CLT A;  1ZXV A;  2D1O A;  3VTG A;  1CIZ A;  3KWV C;  2ERP A;  3I7G A;  1GKC A;  1YP1 A;  4IUW A;  1D8M A;  3ELM A;  2YB9 A;  1USN A;  1MMP A;  1CGE A;  1ZVX A;  1ROS A;  5D1T A;  1JAN A;  1OS9 A;  3LJT A;  4H84 A;  1MMR A;  4GWN A;  1R54 A;  1ZP5 A;  1HV5 A;  3SHI A;  1FBL A;  3L0T A;  1I76 A;  1GE7 A;  3HY9 A;  1BIW A;  1AKL A;  1IAA A;  2A8H A;  2JSD A;  1JJ9 A;  1XFU A;  4G0D A;  1OM7 A;  4ILW D;  4JA1 A;  3TSK A;  1QUA A;  2V4B A;  5D2B A;  2Y6C A;  1MMB A;  1MMQ A;  3B2Z A;  5L7F A;  3N2U A;  1PWP A;  4GR0 A;  1SMP A;  2K9C A;  3P1V A;  2JT6 A;  4XM7 A;  2OW0 A;  2OVX A;  5BOT A;  3G5C A;  3LMC A;  1SU3 A;  1HY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...