2RJPA

Crystal structure of adamts4 with inhibitor bound
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
295
structure length
291
Chain Sequence
ASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHQLGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the two major aggrecan degrading enzymes, ADAMTS4 and ADAMTS5.
pubmed doi rcsb
molecule keywords ADAMTS-4
molecule tags Hydrolase
source organism Homo sapiens
total genus 84
structure length 291
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.82: ADAMTS-4 endopeptidase.
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2rjpA01
4Q1LA 1GKDA 4G0DA 3TS4A 1G49A 3G5CA 1OM8A 1R1HA 1OM6A 1OO9A 2AYKA 2V4BA 1KUFA 1GO7P 1MMRA 2HU6A 3F17A 3LE9A 1ZXCA 1GE6A 5CUHA 4DPEA 1HV5A 2OI0A 4PKWA 4JP4A 2Y6CA 1QIAA 4J4MA 2MLRA 4DF9A 4WK7A 1XFWA 3I7GA 5D1SA 3AYUA 1G05A 1K7IA 2QPJA 4PKSA 2EROA 2W15A 3DWBA 3DPEA 3HYGA 3EDIA 1MMQA 3K7LA 3F1AA 3ZVSA 2RJQA 1AF0A 2X3BA 1JIZA 1G12A 1BQQM 1SLMA 2DDFA 5BPAA 1IAGA 3ELMA 2L0RA 3ZXHA 1JJ9A 4H1QA 4G9LA 3TSKA 4AYKA 1L6JA 3LGPA 3E8RA 2Y6DA 2OW0A 2ERQA 5D2BA 1JAQA 1FBLA 3VI1A 1C7KA 4GWNA 1Z3JA 3BA0A 3UVCA 3WV1A 1RM8A 3HDAP 2E2DA 2W14A 3P1VA 1XFVA 1SMPA 1XFXA 2N8RA 3B8ZA 3P24A 2O3EA 1B3DA 2DDYA 3LUMA 5LABA 2RJPA 5CZMA 1XFZA 1KBCA 2YIGA 4I35A 1BSWA 1HOVA 2D1NA 2AIGP 1O0QA 5I12A 3F19A 1DTHA 1IADA 1SATA 4WKIA 4H3XA 1ZTQA 1D7XA 4H49A 3N2VA 5B5PA 3SHIA 1FLSA 3O64A 4L63A 4XBHA 4WF6A 2YB9A 1YCMA 1ZVXA 2DW2A 2W13A 3LIRA 3N2UA 2FV9A 3KWVC 1PWWA 3L0TA 2J0TA 1YQYA 5D1UA 1PWUA 2XS3A 1JKYA 1OS2A 1R55A 1BM6A 1ZXVA 5JMYA 3B92A 2X7MA 2CKIA 3LEAA 4FXQA 3DNGA 2MLSA 1BKCA 3HDBA 4PKQA 3VTGA 1J7NA 1RMZA 4A7BA 1S4BP 1YOUA 1JAOA 4GWMA 4IUWA 1D8MA 3MA2A 3LK8A 3DPFA 1PWVA 4H30A 1SU3A 3KEKA 2W12A 3RTSA 5I2ZA 1ROSA 4HMAA 1Y93A 1PWQA 3LJZA 1GXDA 4XM7A 1QICA 3OHLA 3B2ZA 1GE5A 1K7GA 1PWPA 2WOAA 3LMCA 3LQBA 1GE7A 1KUIA 1MMBA 2TCLA 1JANA 1QJJA 2MZIA 1XFYA 3I7IA 5I43A 1BZSA 1OMJA 1BIWA 3HY7A 1UTZA 3F16A 2X3CA 3DL1A 2JNPA 3WV3A 1JK3A 1I76A 1D5JA 2PJTA 3KECA 4L6TA 3EHYA 1IACA 1C8TA 4DV8A 1GKCA 2CLTA 5B5OA 4FVLA 4FXYP 2FV5A 1I73A 3KEJA 3LQ0A 1BUDA 1AKLA 3RTTA 1FM1A 1EAKA 3AYKA 2DW0A 2JSDA 1HFCA 3DSLA 3EDHA 5D3CA 2A8HA 4XCTA 1KUHA 2WO9A 3KMEA 5CXAA 2SRTA 3OHOA 1HTDA 1IAAA 1UMTA 2ERPA 1A85A 5BOTA 2OZRA 2JIHA 4H76A 1CK7A 1CIZA 2OY2A 3L0VA 4JIJA 2DW1A 4GF1A 4GR0A 2X3AA 4CTHA 4A3WA 1KUGA 3Q2HA 3NX7A 5H8XA 3V96B 3F15A 4WZVA 3AIGA 1OM7A 1UMSA 4AUOA 3G42A 4XM8A 1YP1A 4DD8A 2OVXA 4H84A 1R1IA 2KRJA 2J83A 4JPAA 1MNCA 1Y8JA 1HFSA 1K7QA 1XUDA 1CGFA 4XM6A 966CA 4JQGA 2O36A 1ZS0A 1BKCI 3KHIA 1XURA 3TT4A 4ZR5A 1C3IA 3KMCA 3LJTA 2Z2DA 4PKRA 3LJGA 4EFSA 5BOYA 3USNA 2OW2A 3Q2GA 1OS9A 1JAPA 1A86A 1XFUA 1Q3AA 1ZP5A 3CKIA 4L19A 3LILA 4WKEA 1CQRA 3K7NA 1H71P 2POJA 3EWJA 2MZHA 5I0LA 1CAQA 1UTTA 3LUNA 1SLNA 830CA 2JT6A 1QUAA 1USNA 3LKAA 3F18A 2K9CA 1XUCA 2OY4A 1QIBA 2OXUA 4GR8A 3U1RA 4IJOA 1CGEA 3EDGA 2OXWA 1AYKA 5L79A 3WV2A 4I03A 2MZEA 2XS4A 5D1TA 2USNA 4GQLA 4ILWD 3HB2P 1MMPA 4GUYA 1I1IP 2OXZA 4ON1A 4AXQA 1IAEA 2JT5A 4GR3A 1O0TA 2K2GA 2E3XA 3HY9A 1KUKA 4H82A 1JH1A 2D1OA 4HX3A 4PKTA 1DMTA 2I47A 1SRPA 2OW1A 3KRYA 1G4KA 3EDZA 1EB6A 1EUBA 4PKUA 5I3MA 1BQOA 4R3VA 1WNIA 1JIWP 5I4OA 1QJIA 1CXVA 3LIKA 1HY7A 4IN9A 456CA 3O2XA 3ZUKA 3HBUP 4JA1A 4PKVA 1ASTA 1BUVM 1CGLA 1IABA 1ND1A 2OVZA 2OW9A 1ATLA 1UEAA 3EHXA 4FU4A 1Y0VA 1KAPP 4H2EA 2WO8A 4AIGA 1BKCE 3HBVP 5D7WA 1G9KA 1R1JA 2W0DA 1B8YA 3TVCA 1R54A 1GO8P 4QKZA 1D8FA 5L7FA 3GBOA
chains in the Genus database with same CATH superfamily
4Q1LA 1GKDA 4G0DA 3TS4A 1G49A 3G5CA 1OM8A 1R1HA 1OM6A 3DTKA 1OO9A 2AYKA 2V4BA 1KUFA 1GO7P 1MMRA 2HU6A 3F17A 3LE9A 1ZXCA 1GE6A 5CUHA 4DPEA 1HV5A 2OI0A 4PKWA 4JP4A 2Y6CA 1QIAA 4J4MA 2MLRA 4DF9A 4WK7A 1XFWA 3I7GA 5D1SA 3AYUA 1G05A 1K7IA 2QPJA 4PKSA 2EROA 2W15A 3DWBA 3DPEA 3HYGA 3EDIA 1MMQA 3K7LA 3F1AA 3ZVSA 2RJQA 1AF0A 2X3BA 1JIZA 1G12A 1BQQM 1SLMA 2DDFA 5BPAA 1IAGA 3ELMA 2L0RA 3ZXHA 1JJ9A 4H1QA 4G9LA 3TSKA 4AYKA 1L6JA 3LGPA 3E8RA 2Y6DA 2OW0A 2ERQA 5D2BA 1JAQA 1FBLA 3VI1A 1C7KA 4GWNA 1Z3JA 3BA0A 3UVCA 3WV1A 1RM8A 3HDAP 2E2DA 2W14A 3P1VA 1XFVA 1SMPA 1XFXA 2N8RA 3B8ZA 3P24A 2O3EA 1B3DA 2DDYA 3LUMA 5LABA 2RJPA 5CZMA 1XFZA 1KBCA 2YIGA 4I35A 1BSWA 1HOVA 2D1NA 2AIGP 1O0QA 5I12A 3F19A 1DTHA 1IADA 3DTIA 1SATA 4WKIA 4H3XA 1ZTQA 1D7XA 4H49A 3N2VA 5B5PA 3SHIA 1FLSA 3O64A 4L63A 4XBHA 4WF6A 2YB9A 1YCMA 2YUFA 1ZVXA 1XM5A 2DW2A 2W13A 3LIRA 3N2UA 2FV9A 3KWVC 1PWWA 3L0TA 2J0TA 1YQYA 5D1UA 1PWUA 2XS3A 1JKYA 1OS2A 1R55A 1BM6A 1ZXVA 5JMYA 3B92A 2X7MA 2CKIA 3LEAA 4FXQA 3DNGA 2MLSA 1BKCA 3HDBA 4PKQA 3VTGA 1J7NA 1RMZA 4A7BA 1S4BP 1YOUA 1JAOA 4GWMA 4IUWA 1D8MA 3MA2A 3LK8A 1TVIA 3DPFA 1PWVA 4H30A 1SU3A 3KEKA 2W12A 3RTSA 5I2ZA 1ROSA 4HMAA 1Y93A 1PWQA 3LJZA 1GXDA 4XM7A 1QICA 3OHLA 3B2ZA 1GE5A 1K7GA 1PWPA 2WOAA 3LMCA 3LQBA 1GE7A 1KUIA 1MMBA 2TCLA 1JANA 1QJJA 2MZIA 1XFYA 3I7IA 5I43A 1BZSA 1OMJA 1BIWA 3HY7A 1UTZA 3F16A 2X3CA 3DL1A 2JNPA 3WV3A 1JK3A 1I76A 1D5JA 2PJTA 3KECA 4L6TA 3EHYA 1IACA 1C8TA 4DV8A 1GKCA 2CLTA 5B5OA 4FVLA 4FXYP 2FV5A 1I73A 3KEJA 3LQ0A 1BUDA 1AKLA 3RTTA 1FM1A 1EAKA 3AYKA 2DW0A 2JSDA 1HFCA 3DSLA 3EDHA 5D3CA 2A8HA 4XCTA 1KUHA 2WO9A 3KMEA 5CXAA 2SRTA 3OHOA 1HTDA 1IAAA 1UMTA 2ERPA 1A85A 5BOTA 2OZRA 2JIHA 4H76A 1CK7A 1CIZA 2OY2A 3L0VA 4JIJA 2DW1A 4GF1A 4GR0A 2X3AA 4CTHA 4A3WA 1KUGA 3Q2HA 3NX7A 5H8XA 3V96B 3F15A 4WZVA 3AIGA 1OM7A 1UMSA 4AUOA 3G42A 4XM8A 3DTEA 1YP1A 4DD8A 2OVXA 4H84A 1R1IA 2KRJA 2J83A 4JPAA 1MNCA 1Y8JA 1HFSA 1K7QA 1XUDA 1CGFA 1OZ9A 4XM6A 966CA 4JQGA 2O36A 1ZS0A 1BKCI 3KHIA 1XURA 3TT4A 4ZR5A 1C3IA 3KMCA 3LJTA 2Z2DA 4PKRA 3LJGA 4EFSA 5BOYA 3USNA 2OW2A 3Q2GA 1OS9A 1JAPA 1A86A 1XFUA 1Q3AA 1ZP5A 3CKIA 4L19A 1XAXA 3LILA 4WKEA 1CQRA 3K7NA 1H71P 2POJA 3EWJA 2MZHA 5I0LA 1CAQA 1UTTA 3LUNA 1SLNA 830CA 2JT6A 1QUAA 1USNA 3LKAA 3F18A 2K9CA 1XUCA 2OY4A 1QIBA 2OXUA 4GR8A 3U1RA 4IJOA 1CGEA 3EDGA 2OXWA 1AYKA 5L79A 3WV2A 4I03A 2MZEA 2XS4A 5D1TA 2USNA 4GQLA 4ILWD 4L7AA 3HB2P 1MMPA 4GUYA 1I1IP 2OXZA 4ON1A 4AXQA 1IAEA 2JT5A 4GR3A 1O0TA 2K2GA 2E3XA 3HY9A 1KUKA 4H82A 1JH1A 2D1OA 4HX3A 4PKTA 1DMTA 2I47A 1SRPA 2OW1A 3KRYA 1G4KA 3EDZA 1EB6A 1EUBA 4PKUA 5I3MA 1BQOA 4R3VA 1WNIA 1JIWP 5I4OA 1QJIA 1CXVA 3LIKA 1HY7A 4IN9A 456CA 3O2XA 3ZUKA 3HBUP 4JA1A 4PKVA 1ASTA 1BUVM 1CGLA 1IABA 1ND1A 2OVZA 2OW9A 1ATLA 1UEAA 3EHXA 4FU4A 1Y0VA 1KAPP 4H2EA 2WO8A 4AIGA 1BKCE 3HBVP 5D7WA 1G9KA 1R1JA 2W0DA 1B8YA 3TVCA 1R54A 1GO8P 4QKZA 1D8FA 5L7FA 3GBOA
chains in the Genus database with same CATH topology
4Q1LA 1GKDA 4G0DA 3TS4A 1G49A 3G5CA 1OM8A 1R1HA 1OM6A 3DTKA 1OO9A 2AYKA 2V4BA 1KUFA 1GO7P 1MMRA 2HU6A 3F17A 3LE9A 1ZXCA 1GE6A 5CUHA 4DPEA 1HV5A 2OI0A 4PKWA 4JP4A 2Y6CA 1QIAA 4J4MA 2MLRA 4DF9A 4WK7A 1XFWA 3I7GA 5D1SA 3AYUA 1G05A 1K7IA 2QPJA 4PKSA 2EROA 2W15A 3DWBA 3DPEA 3HYGA 3EDIA 1MMQA 3K7LA 3F1AA 3ZVSA 2RJQA 1AF0A 2X3BA 1JIZA 1G12A 1BQQM 1SLMA 2DDFA 5BPAA 1IAGA 3ELMA 2L0RA 3ZXHA 1JJ9A 4H1QA 4G9LA 3TSKA 4AYKA 1L6JA 3LGPA 3E8RA 2Y6DA 2OW0A 2ERQA 5D2BA 1JAQA 1FBLA 3VI1A 1C7KA 4GWNA 1Z3JA 3BA0A 3UVCA 3WV1A 1RM8A 3HDAP 2E2DA 2W14A 3P1VA 1XFVA 1SMPA 1XFXA 2N8RA 3B8ZA 3P24A 2O3EA 1B3DA 2DDYA 3LUMA 5LABA 2RJPA 5CZMA 1XFZA 1KBCA 2YIGA 4I35A 1BSWA 1HOVA 2D1NA 2AIGP 1O0QA 5I12A 3F19A 1DTHA 1IADA 3DTIA 1SATA 4WKIA 4H3XA 1ZTQA 1D7XA 4H49A 3N2VA 5B5PA 3SHIA 1FLSA 3O64A 4L63A 4XBHA 4WF6A 2YB9A 1YCMA 2YUFA 1ZVXA 2DW2A 2W13A 3LIRA 3N2UA 2FV9A 3KWVC 1PWWA 3L0TA 2J0TA 1YQYA 5D1UA 1PWUA 2XS3A 1JKYA 1OS2A 1R55A 1BM6A 1ZXVA 5JMYA 3B92A 2X7MA 2CKIA 3LEAA 4FXQA 3DNGA 2MLSA 1BKCA 3HDBA 4PKQA 3VTGA 1J7NA 1RMZA 4A7BA 1S4BP 1YOUA 1JAOA 4GWMA 4IUWA 1D8MA 3MA2A 3LK8A 3DPFA 1PWVA 4H30A 1SU3A 3KEKA 2W12A 3RTSA 5I2ZA 1ROSA 4HMAA 1Y93A 1PWQA 3LJZA 1GXDA 4XM7A 1QICA 3OHLA 3B2ZA 1GE5A 1K7GA 1PWPA 2WOAA 3LMCA 3LQBA 1GE7A 1KUIA 1MMBA 2TCLA 1JANA 1QJJA 2MZIA 1XFYA 3I7IA 5I43A 1BZSA 1OMJA 1BIWA 3HY7A 1UTZA 3F16A 2X3CA 3DL1A 2JNPA 3WV3A 1JK3A 1I76A 1D5JA 2PJTA 3KECA 4L6TA 3EHYA 1IACA 1C8TA 4DV8A 1GKCA 2CLTA 5B5OA 4FVLA 4FXYP 2FV5A 1I73A 3KEJA 3LQ0A 1BUDA 1AKLA 3RTTA 1FM1A 1EAKA 3AYKA 2DW0A 2JSDA 1HFCA 3DSLA 3EDHA 5D3CA 2A8HA 4XCTA 1KUHA 2WO9A 3KMEA 5CXAA 2SRTA 3OHOA 1HTDA 1IAAA 1UMTA 2ERPA 1A85A 5BOTA 2OZRA 2JIHA 4H76A 1CK7A 1CIZA 2OY2A 3L0VA 4JIJA 2DW1A 4GF1A 4GR0A 2X3AA 4CTHA 4A3WA 1KUGA 3Q2HA 3NX7A 5H8XA 3V96B 3F15A 4WZVA 3AIGA 1OM7A 1UMSA 4AUOA 3G42A 4XM8A 3DTEA 1YP1A 4DD8A 2OVXA 4H84A 1R1IA 2KRJA 2J83A 4JPAA 1MNCA 1Y8JA 1HFSA 1K7QA 1XUDA 1CGFA 4XM6A 966CA 4JQGA 2O36A 1ZS0A 1BKCI 3KHIA 1XURA 3TT4A 4ZR5A 1C3IA 3KMCA 3LJTA 2Z2DA 4PKRA 3LJGA 4EFSA 5BOYA 3USNA 2OW2A 3Q2GA 1OS9A 1JAPA 1A86A 1XFUA 1Q3AA 1ZP5A 3CKIA 4L19A 3LILA 4WKEA 1CQRA 3K7NA 1H71P 2POJA 3EWJA 2MZHA 5I0LA 1CAQA 1UTTA 3LUNA 1SLNA 830CA 2JT6A 1QUAA 1USNA 3LKAA 3F18A 2K9CA 1XUCA 2OY4A 1QIBA 2OXUA 4GR8A 3U1RA 4IJOA 1CGEA 3EDGA 2OXWA 1AYKA 5L79A 3WV2A 4I03A 2MZEA 2XS4A 5D1TA 2USNA 4GQLA 4ILWD 4L7AA 3HB2P 1MMPA 4GUYA 1I1IP 2OXZA 4ON1A 4AXQA 1IAEA 2JT5A 4GR3A 1O0TA 2K2GA 2E3XA 3HY9A 1KUKA 4H82A 1JH1A 2D1OA 4HX3A 4PKTA 1DMTA 2I47A 1SRPA 2OW1A 3KRYA 1G4KA 3EDZA 1EB6A 1EUBA 4PKUA 5I3MA 1BQOA 4R3VA 1WNIA 1JIWP 5I4OA 1QJIA 1CXVA 3LIKA 1HY7A 4IN9A 456CA 3O2XA 3ZUKA 3HBUP 4JA1A 4PKVA 1ASTA 1BUVM 1CGLA 1IABA 1ND1A 2OVZA 2OW9A 1ATLA 1UEAA 3EHXA 4FU4A 1Y0VA 1KAPP 4H2EA 2WO8A 4AIGA 1BKCE 3HBVP 5D7WA 1G9KA 1R1JA 2W0DA 1B8YA 3TVCA 1R54A 1GO8P 4QKZA 1D8FA 5L7FA 3GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1L A;  1GKD A;  4G0D A;  3TS4 A;  1G49 A;  3G5C A;  1OM8 A;  1R1H A;  1OM6 A;  1OO9 A;  2AYK A;  2V4B A;  1KUF A;  1GO7 P;  1MMR A;  2HU6 A;  3F17 A;  3LE9 A;  1ZXC A;  1GE6 A;  5CUH A;  4DPE A;  1HV5 A;  2OI0 A;  4PKW A;  4JP4 A;  2Y6C A;  1QIA A;  4J4M A;  2MLR A;  4DF9 A;  4WK7 A;  1XFW A;  3I7G A;  5D1S A;  3AYU A;  1G05 A;  1K7I A;  2QPJ A;  4PKS A;  2ERO A;  2W15 A;  3DWB A;  3DPE A;  3HYG A;  3EDI A;  1MMQ A;  3K7L A;  3F1A A;  3ZVS A;  2RJQ A;  1AF0 A;  2X3B A;  1JIZ A;  1G12 A;  1BQQ M;  1SLM A;  2DDF A;  5BPA A;  1IAG A;  3ELM A;  2L0R A;  3ZXH A;  1JJ9 A;  4H1Q A;  4G9L A;  3TSK A;  4AYK A;  1L6J A;  3LGP A;  3E8R A;  2Y6D A;  2OW0 A;  2ERQ A;  5D2B A;  1JAQ A;  1FBL A;  3VI1 A;  1C7K A;  4GWN A;  1Z3J A;  3BA0 A;  3UVC A;  3WV1 A;  1RM8 A;  3HDA P;  2E2D A;  2W14 A;  3P1V A;  1XFV A;  1SMP A;  1XFX A;  2N8R A;  3B8Z A;  3P24 A;  2O3E A;  1B3D A;  2DDY A;  3LUM A;  5LAB A;  2RJP A;  5CZM A;  1XFZ A;  1KBC A;  2YIG A;  4I35 A;  1BSW A;  1HOV A;  2D1N A;  2AIG P;  1O0Q A;  5I12 A;  3F19 A;  1DTH A;  1IAD A;  1SAT A;  4WKI A;  4H3X A;  1ZTQ A;  1D7X A;  4H49 A;  3N2V A;  5B5P A;  3SHI A;  1FLS A;  3O64 A;  4L63 A;  4XBH A;  4WF6 A;  2YB9 A;  1YCM A;  1ZVX A;  2DW2 A;  2W13 A;  3LIR A;  3N2U A;  2FV9 A;  3KWV C;  1PWW A;  3L0T A;  2J0T A;  1YQY A;  5D1U A;  1PWU A;  2XS3 A;  1JKY A;  1OS2 A;  1R55 A;  1BM6 A;  1ZXV A;  5JMY A;  3B92 A;  2X7M A;  2CKI A;  3LEA A;  4FXQ A;  3DNG A;  2MLS A;  1BKC A;  3HDB A;  4PKQ A;  3VTG A;  1J7N A;  1RMZ A;  4A7B A;  1S4B P;  1YOU A;  1JAO A;  4GWM A;  4IUW A;  1D8M A;  3MA2 A;  3LK8 A;  3DPF A;  1PWV A;  4H30 A;  1SU3 A;  3KEK A;  2W12 A;  3RTS A;  5I2Z A;  1ROS A;  4HMA A;  1Y93 A;  1PWQ A;  3LJZ A;  1GXD A;  4XM7 A;  1QIC A;  3OHL A;  3B2Z A;  1GE5 A;  1K7G A;  1PWP A;  2WOA A;  3LMC A;  3LQB A;  1GE7 A;  1KUI A;  1MMB A;  2TCL A;  1JAN A;  1QJJ A;  2MZI A;  1XFY A;  3I7I A;  5I43 A;  1BZS A;  1OMJ A;  1BIW A;  3HY7 A;  1UTZ A;  3F16 A;  2X3C A;  3DL1 A;  2JNP A;  3WV3 A;  1JK3 A;  1I76 A;  1D5J A;  2PJT A;  3KEC A;  4L6T A;  3EHY A;  1IAC A;  1C8T A;  4DV8 A;  1GKC A;  2CLT A;  5B5O A;  4FVL A;  4FXY P;  2FV5 A;  1I73 A;  3KEJ A;  3LQ0 A;  1BUD A;  1AKL A;  3RTT A;  1FM1 A;  1EAK A;  3AYK A;  2DW0 A;  2JSD A;  1HFC A;  3DSL A;  3EDH A;  5D3C A;  2A8H A;  4XCT A;  1KUH A;  2WO9 A;  3KME A;  5CXA A;  2SRT A;  3OHO A;  1HTD A;  1IAA A;  1UMT A;  2ERP A;  1A85 A;  5BOT A;  2OZR A;  2JIH A;  4H76 A;  1CK7 A;  1CIZ A;  2OY2 A;  3L0V A;  4JIJ A;  2DW1 A;  4GF1 A;  4GR0 A;  2X3A A;  4CTH A;  4A3W A;  1KUG A;  3Q2H A;  3NX7 A;  5H8X A;  3V96 B;  3F15 A;  4WZV A;  3AIG A;  1OM7 A;  1UMS A;  4AUO A;  3G42 A;  4XM8 A;  1YP1 A;  4DD8 A;  2OVX A;  4H84 A;  1R1I A;  2KRJ A;  2J83 A;  4JPA A;  1MNC A;  1Y8J A;  1HFS A;  1K7Q A;  1XUD A;  1CGF A;  4XM6 A;  966C A;  4JQG A;  2O36 A;  1ZS0 A;  1BKC I;  3KHI A;  1XUR A;  3TT4 A;  4ZR5 A;  1C3I A;  3KMC A;  3LJT A;  2Z2D A;  4PKR A;  3LJG A;  4EFS A;  5BOY A;  3USN A;  2OW2 A;  3Q2G A;  1OS9 A;  1JAP A;  1A86 A;  1XFU A;  1Q3A A;  1ZP5 A;  3CKI A;  4L19 A;  3LIL A;  4WKE A;  1CQR A;  3K7N A;  1H71 P;  2POJ A;  3EWJ A;  2MZH A;  5I0L A;  1CAQ A;  1UTT A;  3LUN A;  1SLN A;  830C A;  2JT6 A;  1QUA A;  1USN A;  3LKA A;  3F18 A;  2K9C A;  1XUC A;  2OY4 A;  1QIB A;  2OXU A;  4GR8 A;  3U1R A;  4IJO A;  1CGE A;  3EDG A;  2OXW A;  1AYK A;  5L79 A;  3WV2 A;  4I03 A;  2MZE A;  2XS4 A;  5D1T A;  2USN A;  4GQL A;  4ILW D;  3HB2 P;  1MMP A;  4GUY A;  1I1I P;  2OXZ A;  4ON1 A;  4AXQ A;  1IAE A;  2JT5 A;  4GR3 A;  1O0T A;  2K2G A;  2E3X A;  3HY9 A;  1KUK A;  4H82 A;  1JH1 A;  2D1O A;  4HX3 A;  4PKT A;  1DMT A;  2I47 A;  1SRP A;  2OW1 A;  3KRY A;  1G4K A;  3EDZ A;  1EB6 A;  1EUB A;  4PKU A;  5I3M A;  1BQO A;  4R3V A;  1WNI A;  1JIW P;  5I4O A;  1QJI A;  1CXV A;  3LIK A;  1HY7 A;  4IN9 A;  456C A;  3O2X A;  3ZUK A;  3HBU P;  4JA1 A;  4PKV A;  1AST A;  1BUV M;  1CGL A;  1IAB A;  1ND1 A;  2OVZ A;  2OW9 A;  1ATL A;  1UEA A;  3EHX A;  4FU4 A;  1Y0V A;  1KAP P;  4H2E A;  2WO8 A;  4AIG A;  1BKC E;  3HBV P;  5D7W A;  1G9K A;  1R1J A;  2W0D A;  1B8Y A;  3TVC A;  1R54 A;  1GO8 P;  4QKZ A;  1D8F A;  5L7F A;  3GBO A; 
#chains in the Genus database with same CATH topology
 4Q1L A;  1GKD A;  4G0D A;  3TS4 A;  1G49 A;  3G5C A;  1OM8 A;  1R1H A;  1OM6 A;  3DTK A;  1OO9 A;  2AYK A;  2V4B A;  1KUF A;  1GO7 P;  1MMR A;  2HU6 A;  3F17 A;  3LE9 A;  1ZXC A;  1GE6 A;  5CUH A;  4DPE A;  1HV5 A;  2OI0 A;  4PKW A;  4JP4 A;  2Y6C A;  1QIA A;  4J4M A;  2MLR A;  4DF9 A;  4WK7 A;  1XFW A;  3I7G A;  5D1S A;  3AYU A;  1G05 A;  1K7I A;  2QPJ A;  4PKS A;  2ERO A;  2W15 A;  3DWB A;  3DPE A;  3HYG A;  3EDI A;  1MMQ A;  3K7L A;  3F1A A;  3ZVS A;  2RJQ A;  1AF0 A;  2X3B A;  1JIZ A;  1G12 A;  1BQQ M;  1SLM A;  2DDF A;  5BPA A;  1IAG A;  3ELM A;  2L0R A;  3ZXH A;  1JJ9 A;  4H1Q A;  4G9L A;  3TSK A;  4AYK A;  1L6J A;  3LGP A;  3E8R A;  2Y6D A;  2OW0 A;  2ERQ A;  5D2B A;  1JAQ A;  1FBL A;  3VI1 A;  1C7K A;  4GWN A;  1Z3J A;  3BA0 A;  3UVC A;  3WV1 A;  1RM8 A;  3HDA P;  2E2D A;  2W14 A;  3P1V A;  1XFV A;  1SMP A;  1XFX A;  2N8R A;  3B8Z A;  3P24 A;  2O3E A;  1B3D A;  2DDY A;  3LUM A;  5LAB A;  2RJP A;  5CZM A;  1XFZ A;  1KBC A;  2YIG A;  4I35 A;  1BSW A;  1HOV A;  2D1N A;  2AIG P;  1O0Q A;  5I12 A;  3F19 A;  1DTH A;  1IAD A;  3DTI A;  1SAT A;  4WKI A;  4H3X A;  1ZTQ A;  1D7X A;  4H49 A;  3N2V A;  5B5P A;  3SHI A;  1FLS A;  3O64 A;  4L63 A;  4XBH A;  4WF6 A;  2YB9 A;  1YCM A;  2YUF A;  1ZVX A;  1XM5 A;  2DW2 A;  2W13 A;  3LIR A;  3N2U A;  2FV9 A;  3KWV C;  1PWW A;  3L0T A;  2J0T A;  1YQY A;  5D1U A;  1PWU A;  2XS3 A;  1JKY A;  1OS2 A;  1R55 A;  1BM6 A;  1ZXV A;  5JMY A;  3B92 A;  2X7M A;  2CKI A;  3LEA A;  4FXQ A;  3DNG A;  2MLS A;  1BKC A;  3HDB A;  4PKQ A;  3VTG A;  1J7N A;  1RMZ A;  4A7B A;  1S4B P;  1YOU A;  1JAO A;  4GWM A;  4IUW A;  1D8M A;  3MA2 A;  3LK8 A;  1TVI A;  3DPF A;  1PWV A;  4H30 A;  1SU3 A;  3KEK A;  2W12 A;  3RTS A;  5I2Z A;  1ROS A;  4HMA A;  1Y93 A;  1PWQ A;  3LJZ A;  1GXD A;  4XM7 A;  1QIC A;  3OHL A;  3B2Z A;  1GE5 A;  1K7G A;  1PWP A;  2WOA A;  3LMC A;  3LQB A;  1GE7 A;  1KUI A;  1MMB A;  2TCL A;  1JAN A;  1QJJ A;  2MZI A;  1XFY A;  3I7I A;  5I43 A;  1BZS A;  1OMJ A;  1BIW A;  3HY7 A;  1UTZ A;  3F16 A;  2X3C A;  3DL1 A;  2JNP A;  3WV3 A;  1JK3 A;  1I76 A;  1D5J A;  2PJT A;  3KEC A;  4L6T A;  3EHY A;  1IAC A;  1C8T A;  4DV8 A;  1GKC A;  2CLT A;  5B5O A;  4FVL A;  4FXY P;  2FV5 A;  1I73 A;  3KEJ A;  3LQ0 A;  1BUD A;  1AKL A;  3RTT A;  1FM1 A;  1EAK A;  3AYK A;  2DW0 A;  2JSD A;  1HFC A;  3DSL A;  3EDH A;  5D3C A;  2A8H A;  4XCT A;  1KUH A;  2WO9 A;  3KME A;  5CXA A;  2SRT A;  3OHO A;  1HTD A;  1IAA A;  1UMT A;  2ERP A;  1A85 A;  5BOT A;  2OZR A;  2JIH A;  4H76 A;  1CK7 A;  1CIZ A;  2OY2 A;  3L0V A;  4JIJ A;  2DW1 A;  4GF1 A;  4GR0 A;  2X3A A;  4CTH A;  4A3W A;  1KUG A;  3Q2H A;  3NX7 A;  5H8X A;  3V96 B;  3F15 A;  4WZV A;  3AIG A;  1OM7 A;  1UMS A;  4AUO A;  3G42 A;  4XM8 A;  3DTE A;  1YP1 A;  4DD8 A;  2OVX A;  4H84 A;  1R1I A;  2KRJ A;  2J83 A;  4JPA A;  1MNC A;  1Y8J A;  1HFS A;  1K7Q A;  1XUD A;  1CGF A;  1OZ9 A;  4XM6 A;  966C A;  4JQG A;  2O36 A;  1ZS0 A;  1BKC I;  3KHI A;  1XUR A;  3TT4 A;  4ZR5 A;  1C3I A;  3KMC A;  3LJT A;  2Z2D A;  4PKR A;  3LJG A;  4EFS A;  5BOY A;  3USN A;  2OW2 A;  3Q2G A;  1OS9 A;  1JAP A;  1A86 A;  1XFU A;  1Q3A A;  1ZP5 A;  3CKI A;  4L19 A;  1XAX A;  3LIL A;  4WKE A;  1CQR A;  3K7N A;  1H71 P;  2POJ A;  3EWJ A;  2MZH A;  5I0L A;  1CAQ A;  1UTT A;  3LUN A;  1SLN A;  830C A;  2JT6 A;  1QUA A;  1USN A;  3LKA A;  3F18 A;  2K9C A;  1XUC A;  2OY4 A;  1QIB A;  2OXU A;  4GR8 A;  3U1R A;  4IJO A;  1CGE A;  3EDG A;  2OXW A;  1AYK A;  5L79 A;  3WV2 A;  4I03 A;  2MZE A;  2XS4 A;  5D1T A;  2USN A;  4GQL A;  4ILW D;  4L7A A;  3HB2 P;  1MMP A;  4GUY A;  1I1I P;  2OXZ A;  4ON1 A;  4AXQ A;  1IAE A;  2JT5 A;  4GR3 A;  1O0T A;  2K2G A;  2E3X A;  3HY9 A;  1KUK A;  4H82 A;  1JH1 A;  2D1O A;  4HX3 A;  4PKT A;  1DMT A;  2I47 A;  1SRP A;  2OW1 A;  3KRY A;  1G4K A;  3EDZ A;  1EB6 A;  1EUB A;  4PKU A;  5I3M A;  1BQO A;  4R3V A;  1WNI A;  1JIW P;  5I4O A;  1QJI A;  1CXV A;  3LIK A;  1HY7 A;  4IN9 A;  456C A;  3O2X A;  3ZUK A;  3HBU P;  4JA1 A;  4PKV A;  1AST A;  1BUV M;  1CGL A;  1IAB A;  1ND1 A;  2OVZ A;  2OW9 A;  1ATL A;  1UEA A;  3EHX A;  4FU4 A;  1Y0V A;  1KAP P;  4H2E A;  2WO8 A;  4AIG A;  1BKC E;  3HBV P;  5D7W A;  1G9K A;  1R1J A;  2W0D A;  1B8Y A;  3TVC A;  1R54 A;  1GO8 P;  4QKZ A;  1D8F A;  5L7F A;  3GBO A; 
#chains in the Genus database with same CATH homology
 4Q1L A;  1GKD A;  4G0D A;  3TS4 A;  1G49 A;  3G5C A;  1OM8 A;  1R1H A;  1OM6 A;  3DTK A;  1OO9 A;  2AYK A;  2V4B A;  1KUF A;  1GO7 P;  1MMR A;  2HU6 A;  3F17 A;  3LE9 A;  1ZXC A;  1GE6 A;  5CUH A;  4DPE A;  1HV5 A;  2OI0 A;  4PKW A;  4JP4 A;  2Y6C A;  1QIA A;  4J4M A;  2MLR A;  4DF9 A;  4WK7 A;  1XFW A;  3I7G A;  5D1S A;  3AYU A;  1G05 A;  1K7I A;  2QPJ A;  4PKS A;  2ERO A;  2W15 A;  3DWB A;  3DPE A;  3HYG A;  3EDI A;  1MMQ A;  3K7L A;  3F1A A;  3ZVS A;  2RJQ A;  1AF0 A;  2X3B A;  1JIZ A;  1G12 A;  1BQQ M;  1SLM A;  2DDF A;  5BPA A;  1IAG A;  3ELM A;  2L0R A;  3ZXH A;  1JJ9 A;  4H1Q A;  4G9L A;  3TSK A;  4AYK A;  1L6J A;  3LGP A;  3E8R A;  2Y6D A;  2OW0 A;  2ERQ A;  5D2B A;  1JAQ A;  1FBL A;  3VI1 A;  1C7K A;  4GWN A;  1Z3J A;  3BA0 A;  3UVC A;  3WV1 A;  1RM8 A;  3HDA P;  2E2D A;  2W14 A;  3P1V A;  1XFV A;  1SMP A;  1XFX A;  2N8R A;  3B8Z A;  3P24 A;  2O3E A;  1B3D A;  2DDY A;  3LUM A;  5LAB A;  2RJP A;  5CZM A;  1XFZ A;  1KBC A;  2YIG A;  4I35 A;  1BSW A;  1HOV A;  2D1N A;  2AIG P;  1O0Q A;  5I12 A;  3F19 A;  1DTH A;  1IAD A;  3DTI A;  1SAT A;  4WKI A;  4H3X A;  1ZTQ A;  1D7X A;  4H49 A;  3N2V A;  5B5P A;  3SHI A;  1FLS A;  3O64 A;  4L63 A;  4XBH A;  4WF6 A;  2YB9 A;  1YCM A;  2YUF A;  1ZVX A;  2DW2 A;  2W13 A;  3LIR A;  3N2U A;  2FV9 A;  3KWV C;  1PWW A;  3L0T A;  2J0T A;  1YQY A;  5D1U A;  1PWU A;  2XS3 A;  1JKY A;  1OS2 A;  1R55 A;  1BM6 A;  1ZXV A;  5JMY A;  3B92 A;  2X7M A;  2CKI A;  3LEA A;  4FXQ A;  3DNG A;  2MLS A;  1BKC A;  3HDB A;  4PKQ A;  3VTG A;  1J7N A;  1RMZ A;  4A7B A;  1S4B P;  1YOU A;  1JAO A;  4GWM A;  4IUW A;  1D8M A;  3MA2 A;  3LK8 A;  3DPF A;  1PWV A;  4H30 A;  1SU3 A;  3KEK A;  2W12 A;  3RTS A;  5I2Z A;  1ROS A;  4HMA A;  1Y93 A;  1PWQ A;  3LJZ A;  1GXD A;  4XM7 A;  1QIC A;  3OHL A;  3B2Z A;  1GE5 A;  1K7G A;  1PWP A;  2WOA A;  3LMC A;  3LQB A;  1GE7 A;  1KUI A;  1MMB A;  2TCL A;  1JAN A;  1QJJ A;  2MZI A;  1XFY A;  3I7I A;  5I43 A;  1BZS A;  1OMJ A;  1BIW A;  3HY7 A;  1UTZ A;  3F16 A;  2X3C A;  3DL1 A;  2JNP A;  3WV3 A;  1JK3 A;  1I76 A;  1D5J A;  2PJT A;  3KEC A;  4L6T A;  3EHY A;  1IAC A;  1C8T A;  4DV8 A;  1GKC A;  2CLT A;  5B5O A;  4FVL A;  4FXY P;  2FV5 A;  1I73 A;  3KEJ A;  3LQ0 A;  1BUD A;  1AKL A;  3RTT A;  1FM1 A;  1EAK A;  3AYK A;  2DW0 A;  2JSD A;  1HFC A;  3DSL A;  3EDH A;  5D3C A;  2A8H A;  4XCT A;  1KUH A;  2WO9 A;  3KME A;  5CXA A;  2SRT A;  3OHO A;  1HTD A;  1IAA A;  1UMT A;  2ERP A;  1A85 A;  5BOT A;  2OZR A;  2JIH A;  4H76 A;  1CK7 A;  1CIZ A;  2OY2 A;  3L0V A;  4JIJ A;  2DW1 A;  4GF1 A;  4GR0 A;  2X3A A;  4CTH A;  4A3W A;  1KUG A;  3Q2H A;  3NX7 A;  5H8X A;  3V96 B;  3F15 A;  4WZV A;  3AIG A;  1OM7 A;  1UMS A;  4AUO A;  3G42 A;  4XM8 A;  3DTE A;  1YP1 A;  4DD8 A;  2OVX A;  4H84 A;  1R1I A;  2KRJ A;  2J83 A;  4JPA A;  1MNC A;  1Y8J A;  1HFS A;  1K7Q A;  1XUD A;  1CGF A;  4XM6 A;  966C A;  4JQG A;  2O36 A;  1ZS0 A;  1BKC I;  3KHI A;  1XUR A;  3TT4 A;  4ZR5 A;  1C3I A;  3KMC A;  3LJT A;  2Z2D A;  4PKR A;  3LJG A;  4EFS A;  5BOY A;  3USN A;  2OW2 A;  3Q2G A;  1OS9 A;  1JAP A;  1A86 A;  1XFU A;  1Q3A A;  1ZP5 A;  3CKI A;  4L19 A;  3LIL A;  4WKE A;  1CQR A;  3K7N A;  1H71 P;  2POJ A;  3EWJ A;  2MZH A;  5I0L A;  1CAQ A;  1UTT A;  3LUN A;  1SLN A;  830C A;  2JT6 A;  1QUA A;  1USN A;  3LKA A;  3F18 A;  2K9C A;  1XUC A;  2OY4 A;  1QIB A;  2OXU A;  4GR8 A;  3U1R A;  4IJO A;  1CGE A;  3EDG A;  2OXW A;  1AYK A;  5L79 A;  3WV2 A;  4I03 A;  2MZE A;  2XS4 A;  5D1T A;  2USN A;  4GQL A;  4ILW D;  4L7A A;  3HB2 P;  1MMP A;  4GUY A;  1I1I P;  2OXZ A;  4ON1 A;  4AXQ A;  1IAE A;  2JT5 A;  4GR3 A;  1O0T A;  2K2G A;  2E3X A;  3HY9 A;  1KUK A;  4H82 A;  1JH1 A;  2D1O A;  4HX3 A;  4PKT A;  1DMT A;  2I47 A;  1SRP A;  2OW1 A;  3KRY A;  1G4K A;  3EDZ A;  1EB6 A;  1EUB A;  4PKU A;  5I3M A;  1BQO A;  4R3V A;  1WNI A;  1JIW P;  5I4O A;  1QJI A;  1CXV A;  3LIK A;  1HY7 A;  4IN9 A;  456C A;  3O2X A;  3ZUK A;  3HBU P;  4JA1 A;  4PKV A;  1AST A;  1BUV M;  1CGL A;  1IAB A;  1ND1 A;  2OVZ A;  2OW9 A;  1ATL A;  1UEA A;  3EHX A;  4FU4 A;  1Y0V A;  1KAP P;  4H2E A;  2WO8 A;  4AIG A;  1BKC E;  3HBV P;  5D7W A;  1G9K A;  1R1J A;  2W0D A;  1B8Y A;  3TVC A;  1R54 A;  1GO8 P;  4QKZ A;  1D8F A;  5L7F A;  3GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...