2RJPA

Crystal structure of adamts4 with inhibitor bound
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
295
structure length
291
Chain Sequence
ASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHQLGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAMTS-4
publication title Crystal structures of the two major aggrecan degrading enzymes, ADAMTS4 and ADAMTS5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 291
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.82: ADAMTS-4 endopeptidase.
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF17771 ADAM_CR_2 ADAM cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2rjpA01
2DW1A 2O3EA 2J0TA 3KECA 4H82A 5BOYA 1BKCE 2FV5A 1ASTA 3HY7A 3LIRA 2I47A 2POJA 1CQRA 3VI1A 4H30A 2X7MA 1GE7A 5L7FA 2V4BA 4QKZA 2MZEA 3L0TA 2W15A 4R3VA 3K7NA 1QJIA 1Y8JA 3DPFA 2WO9A 3OHOA 2OVXA 4I35A 1XFWA 4FVLA 2OVZA 3ELMA 1BSWA 1R1HA 3LEAA 5I2ZA 2TCLA 3Q2HA 1BQQM 2A8HA 3KMCA 1GKCA 4WZVA 2O36A 1SLNA 3HYGA 3HBUP 1USNA 1C7KA 1SLMA 2HU6A 1I76A 3RTTA 2W0DA 4WKEA 3NX7A 2WO8A 3TSKA 3HBVP 1B8YA 3WV3A 1ND1A 1OS2A 3P24A 4H3XA 1XFYA 1HTDA 2DW0A 1D5JA 5CZMA 4GWNA 1KUFA 2OY2A 1XFZA 2DDYA 1YP1A 1KBCA 1EUBA 1A85A 1JAOA 4DD8A 3CKIA 1ZP5A 4AUOA 2USNA 3EWJA 3MA2A 1QUAA 3EDHA 4JIJA 1L6JA 5CUHA 2OI0A 5D2BA 3DNGA 1HV5A 1IAEA 1R1IA 4J4MA 4EFSA 3F17A 1JJ9A 1BUVM 2MLRA 3I7IA 2X3BA 4ON1A 4Q1LA 1BQOA 1KUGA 3AYKA 4PKRA 3ZXHA 3LJZA 4JA1A 4XCTA 3ZUKA 1J7NA 3DL1A 1YCMA 5B5PA 3AIGA 3KEJA 1XFUA 4HMAA 2CLTA 2XS4A 4WK7A 5BPAA 1XURA 1BKCA 1QIBA 1ZTQA 1JKYA 1EAKA 2N8RA 1OMJA 5H8XA 5I43A 1I73A 1MMBA 1UEAA 2K2GA 1BKCI 1HFCA 1MMRA 1KAPP 3GBOA 3LUNA 4H49A 1A86A 3L0VA 4G0DA 2W13A 4FU4A 2ERPA 1YOUA 1JIZA 3HY9A 5B5OA 830CA 2AYKA 1HFSA 3F18A 3G5CA 3G42A 3O64A 3TS4A 3EDIA 3BA0A 1B3DA 966CA 1PWWA 3LGPA 2JT6A 3USNA 4PKTA 2SRTA 2MLSA 3LMCA 3B2ZA 3AYUA 5D3CA 1FM1A 4IN9A 4IJOA 1AKLA 1OO9A 1YQYA 3TVCA 3B8ZA 1PWPA 2Y6CA 1SMPA 1MMQA 4GUYA 1Y0VA 1KUKA 1O0QA 1BZSA 1KUIA 4GR8A 1BM6A 1R54A 2OW2A 1HOVA 4H84A 1G4KA 2RJQA 2Y6DA 2OW0A 1S4BP 3LQBA 1QJJA 1UMTA 3DPEA 3LUMA 2EROA 1R1JA 2L0RA 4XBHA 3WV1A 3P1VA 1XUCA 3N2VA 1JANA 3B92A 1PWVA 1BUDA 4H1QA 1SU3A 2K9CA 1D8FA 5I0LA 1DTHA 3Q2GA 4JP4A 3VTGA 2W12A 4PKSA 1FLSA 1IAAA 1FBLA 4AXQA 1D8MA 5L79A 1Z3JA 1ZXVA 4HX3A 5I4OA 1G12A 2OW9A 1Y93A 1AF0A 1ATLA 4PKVA 2XS3A 456CA 2DDFA 3SHIA 2X3CA 3LE9A 3F1AA 4H76A 4WKIA 1PWQA 2E3XA 1CGLA 3DSLA 2MZHA 2OXUA 2X3AA 2D1NA 1RMZA 4XM6A 1WNIA 1D7XA 4WF6A 1K7QA 3OHLA 2JT5A 2J83A 1PWUA 3F16A 4H2EA 4I03A 3LKAA 4IUWA 3KWVC 1UMSA 3KRYA 4A7BA 4A3WA 2OZRA 1I1IP 1XFXA 1R55A 5I12A 2Z2DA 1GE6A 1UTZA 1CGEA 5BOTA 2DW2A 1IAGA 3KHIA 1CK7A 1G05A 3KEKA 5I3MA 1IACA 3O2XA 1GKDA 2W14A 3EDGA 2ERQA 1ZVXA 1AYKA 4DV8A 4XM8A 2PJTA 4DF9A 1EB6A 3RTSA 3WV2A 1IADA 5LABA 4GWMA 3F15A 1UTTA 1CXVA 3HDBA 3ZVSA 1G49A 5CXAA 2MZIA 1OM8A 1JIWP 3V96B 3LILA 1MMPA 2YB9A 1GXDA 5D1UA 1OS9A 3EHXA 4FXYP 3LJTA 1KUHA 1K7GA 1QIAA 2OXWA 2E2DA 3EHYA 1CGFA 2OW1A 4G9LA 4XM7A 1GO8P 1ZXCA 1RM8A 2CKIA 3KMEA 1GO7P 4GR0A 1MNCA 4JPAA 1HY7A 3F19A 4GQLA 3U1RA 4FXQA 1CIZA 1OM6A 4JQGA 1OM7A 3UVCA 2RJPA 2JNPA 1SRPA 4L19A 3DWBA 2YIGA 5D1TA 1GE5A 2JIHA 4L6TA 2AIGP 3LK8A 3LQ0A 5D7WA 1JH1A 1K7IA 1JAQA 3LJGA 4GR3A 1Q3AA 2WOAA 5JMYA 4ZR5A 4PKWA 2KRJA 1IABA 2FV9A 2JSDA 2OY4A 4AIGA 4AYKA 4L63A 3I7GA 3N2UA 1CAQA 1C3IA 3HB2P 1XFVA 1DMTA 3E8RA 1O0TA 4GF1A 4PKUA 1JK3A 3EDZA 1H71P 1QICA 4CTHA 1G9KA 4DPEA 5D1SA 1ZS0A 3TT4A 1BIWA 4PKQA 1ROSA 2QPJA 3K7LA 3HDAP 2OXZA 1C8TA 1JAPA 1SATA 2D1OA 4ILWD 1XUDA 3LIKA
chains in the Genus database with same CATH superfamily
2DW1A 2O3EA 2J0TA 3KECA 4H82A 5BOYA 1BKCE 2FV5A 1ASTA 3HY7A 3LIRA 3DTKA 2I47A 2POJA 1CQRA 3VI1A 4H30A 2X7MA 1GE7A 5L7FA 2V4BA 4QKZA 2MZEA 3L0TA 2W15A 4R3VA 3K7NA 1QJIA 1Y8JA 3DPFA 2WO9A 3OHOA 2OVXA 4I35A 1XFWA 4FVLA 2OVZA 3ELMA 1BSWA 1R1HA 3LEAA 5I2ZA 2TCLA 3Q2HA 1BQQM 2A8HA 3KMCA 1GKCA 4WZVA 2O36A 1SLNA 3HYGA 3HBUP 1USNA 1C7KA 1SLMA 2HU6A 1I76A 3RTTA 2W0DA 4WKEA 3NX7A 2WO8A 3TSKA 3HBVP 1B8YA 3WV3A 1ND1A 1OS2A 3P24A 4H3XA 1XFYA 1HTDA 2DW0A 1D5JA 5CZMA 4GWNA 1KUFA 2OY2A 1XFZA 2DDYA 1YP1A 1KBCA 1EUBA 1A85A 1JAOA 4DD8A 3CKIA 1ZP5A 4AUOA 2USNA 3EWJA 3MA2A 1QUAA 3EDHA 4JIJA 1L6JA 5CUHA 2YUFA 2OI0A 5D2BA 3DNGA 1HV5A 1IAEA 1R1IA 4J4MA 4EFSA 3F17A 1JJ9A 1BUVM 2MLRA 3I7IA 2X3BA 1TVIA 4ON1A 4Q1LA 1BQOA 1KUGA 3AYKA 4PKRA 3ZXHA 3LJZA 4JA1A 4XCTA 3ZUKA 1J7NA 3DL1A 1YCMA 5B5PA 3AIGA 3KEJA 1XFUA 4HMAA 1XAXA 2CLTA 2XS4A 4WK7A 5BPAA 1XURA 1BKCA 1QIBA 1ZTQA 1JKYA 1EAKA 2N8RA 1OMJA 5H8XA 5I43A 1I73A 1MMBA 1UEAA 2K2GA 1BKCI 1HFCA 1MMRA 1KAPP 3GBOA 3LUNA 4H49A 1A86A 3L0VA 4G0DA 2W13A 4FU4A 2ERPA 1YOUA 1JIZA 3HY9A 1XM5A 5B5OA 830CA 2AYKA 1HFSA 3F18A 3G5CA 3G42A 3O64A 3TS4A 3EDIA 3BA0A 1B3DA 966CA 1PWWA 3LGPA 2JT6A 3USNA 4PKTA 2SRTA 2MLSA 3LMCA 3B2ZA 3AYUA 5D3CA 1FM1A 4IN9A 4IJOA 1AKLA 1OO9A 1YQYA 3TVCA 3B8ZA 1PWPA 2Y6CA 1SMPA 1MMQA 4GUYA 1Y0VA 1KUKA 1O0QA 1BZSA 1KUIA 4GR8A 1BM6A 1R54A 2OW2A 1HOVA 4H84A 1G4KA 2RJQA 2Y6DA 2OW0A 1S4BP 3LQBA 1QJJA 1UMTA 3DPEA 3LUMA 2EROA 1R1JA 2L0RA 4XBHA 3WV1A 3P1VA 1XUCA 3N2VA 1JANA 3B92A 1PWVA 1BUDA 4H1QA 1SU3A 2K9CA 3DTEA 1D8FA 5I0LA 1DTHA 3Q2GA 4JP4A 3VTGA 2W12A 4L7AA 4PKSA 1FLSA 1IAAA 1FBLA 4AXQA 1D8MA 5L79A 1Z3JA 1ZXVA 4HX3A 5I4OA 1G12A 2OW9A 1Y93A 1AF0A 1ATLA 4PKVA 2XS3A 456CA 2DDFA 3SHIA 2X3CA 3LE9A 3F1AA 4H76A 4WKIA 1PWQA 2E3XA 1CGLA 3DSLA 2MZHA 2OXUA 2X3AA 2D1NA 1RMZA 4XM6A 1WNIA 1D7XA 4WF6A 1K7QA 3OHLA 2JT5A 2J83A 1PWUA 3F16A 4H2EA 4I03A 3LKAA 4IUWA 3KWVC 1UMSA 3KRYA 4A7BA 4A3WA 2OZRA 1I1IP 1XFXA 1R55A 5I12A 2Z2DA 1GE6A 1UTZA 1CGEA 5BOTA 2DW2A 1IAGA 3KHIA 1CK7A 1G05A 3KEKA 5I3MA 1IACA 3O2XA 1GKDA 2W14A 3EDGA 2ERQA 1ZVXA 1AYKA 4DV8A 4XM8A 2PJTA 4DF9A 1EB6A 3RTSA 3WV2A 1IADA 5LABA 4GWMA 3F15A 1UTTA 1CXVA 3HDBA 3ZVSA 1G49A 5CXAA 2MZIA 1OM8A 1JIWP 3V96B 3LILA 1MMPA 2YB9A 1GXDA 5D1UA 1OS9A 3EHXA 4FXYP 3LJTA 1KUHA 1K7GA 1QIAA 2OXWA 2E2DA 3EHYA 1CGFA 2OW1A 4G9LA 4XM7A 1GO8P 1ZXCA 1RM8A 2CKIA 3KMEA 1OZ9A 1GO7P 4GR0A 1MNCA 4JPAA 1HY7A 3F19A 4GQLA 3U1RA 4FXQA 1CIZA 1OM6A 4JQGA 1OM7A 3UVCA 2RJPA 2JNPA 1SRPA 4L19A 3DWBA 2YIGA 5D1TA 1GE5A 2JIHA 4L6TA 2AIGP 3LK8A 3LQ0A 5D7WA 1JH1A 1K7IA 1JAQA 3LJGA 4GR3A 1Q3AA 2WOAA 5JMYA 4ZR5A 4PKWA 2KRJA 1IABA 2FV9A 2JSDA 2OY4A 4AIGA 4AYKA 4L63A 3I7GA 3N2UA 1CAQA 1C3IA 3HB2P 1XFVA 1DMTA 3E8RA 1O0TA 3DTIA 4GF1A 4PKUA 1JK3A 3EDZA 1H71P 1QICA 4CTHA 1G9KA 4DPEA 5D1SA 1ZS0A 3TT4A 1BIWA 4PKQA 1ROSA 2QPJA 3K7LA 3HDAP 2OXZA 1C8TA 1JAPA 1SATA 2D1OA 4ILWD 1XUDA 3LIKA
chains in the Genus database with same CATH topology
2DW1A 2O3EA 2J0TA 3KECA 4H82A 5BOYA 1BKCE 2FV5A 1ASTA 3HY7A 3LIRA 3DTKA 2I47A 2POJA 1CQRA 3VI1A 4H30A 2X7MA 1GE7A 5L7FA 2V4BA 4QKZA 2MZEA 3L0TA 2W15A 4R3VA 3K7NA 1QJIA 1Y8JA 3DPFA 2WO9A 3OHOA 2OVXA 4I35A 1XFWA 4FVLA 2OVZA 3ELMA 1BSWA 1R1HA 3LEAA 5I2ZA 2TCLA 3Q2HA 1BQQM 2A8HA 3KMCA 1GKCA 4WZVA 2O36A 1SLNA 3HYGA 3HBUP 1USNA 1C7KA 1SLMA 2HU6A 1I76A 3RTTA 2W0DA 4WKEA 3NX7A 2WO8A 3TSKA 3HBVP 1B8YA 3WV3A 1ND1A 1OS2A 3P24A 4H3XA 1XFYA 1HTDA 2DW0A 1D5JA 5CZMA 4GWNA 1KUFA 2OY2A 1XFZA 2DDYA 1YP1A 1KBCA 1EUBA 1A85A 1JAOA 4DD8A 3CKIA 1ZP5A 4AUOA 2USNA 3EWJA 3MA2A 1QUAA 3EDHA 4JIJA 1L6JA 5CUHA 2YUFA 2OI0A 5D2BA 3DNGA 1HV5A 1IAEA 1R1IA 4J4MA 4EFSA 3F17A 1JJ9A 1BUVM 2MLRA 3I7IA 2X3BA 4ON1A 4Q1LA 1BQOA 1KUGA 3AYKA 4PKRA 3ZXHA 3LJZA 4JA1A 4XCTA 3ZUKA 1J7NA 3DL1A 1YCMA 5B5PA 3AIGA 3KEJA 1XFUA 4HMAA 2CLTA 2XS4A 4WK7A 5BPAA 1XURA 1BKCA 1QIBA 1ZTQA 1JKYA 1EAKA 2N8RA 1OMJA 5H8XA 5I43A 1I73A 1MMBA 1UEAA 2K2GA 1BKCI 1HFCA 1MMRA 1KAPP 3GBOA 3LUNA 4H49A 1A86A 3L0VA 4G0DA 2W13A 4FU4A 2ERPA 1YOUA 1JIZA 3HY9A 5B5OA 830CA 2AYKA 1HFSA 3F18A 3G5CA 3G42A 3O64A 3TS4A 3EDIA 3BA0A 1B3DA 966CA 1PWWA 3LGPA 2JT6A 3USNA 4PKTA 2SRTA 2MLSA 3LMCA 3B2ZA 3AYUA 5D3CA 1FM1A 4IN9A 4IJOA 1AKLA 1OO9A 1YQYA 3TVCA 3B8ZA 1PWPA 2Y6CA 1SMPA 1MMQA 4GUYA 1Y0VA 1KUKA 1O0QA 1BZSA 1KUIA 4GR8A 1BM6A 1R54A 2OW2A 1HOVA 4H84A 1G4KA 2RJQA 2Y6DA 2OW0A 1S4BP 3LQBA 1QJJA 1UMTA 3DPEA 3LUMA 2EROA 1R1JA 2L0RA 4XBHA 3WV1A 3P1VA 1XUCA 3N2VA 1JANA 3B92A 1PWVA 1BUDA 4H1QA 1SU3A 2K9CA 3DTEA 1D8FA 5I0LA 1DTHA 3Q2GA 4JP4A 3VTGA 2W12A 4L7AA 4PKSA 1FLSA 1IAAA 1FBLA 4AXQA 1D8MA 5L79A 1Z3JA 1ZXVA 4HX3A 5I4OA 1G12A 2OW9A 1Y93A 1AF0A 1ATLA 4PKVA 2XS3A 456CA 2DDFA 3SHIA 2X3CA 3LE9A 3F1AA 4H76A 4WKIA 1PWQA 2E3XA 1CGLA 3DSLA 2MZHA 2OXUA 2X3AA 2D1NA 1RMZA 4XM6A 1WNIA 1D7XA 4WF6A 1K7QA 3OHLA 2JT5A 2J83A 1PWUA 3F16A 4H2EA 4I03A 3LKAA 4IUWA 3KWVC 1UMSA 3KRYA 4A7BA 4A3WA 2OZRA 1I1IP 1XFXA 1R55A 5I12A 2Z2DA 1GE6A 1UTZA 1CGEA 5BOTA 2DW2A 1IAGA 3KHIA 1CK7A 1G05A 3KEKA 5I3MA 1IACA 3O2XA 1GKDA 2W14A 3EDGA 2ERQA 1ZVXA 1AYKA 4DV8A 4XM8A 2PJTA 4DF9A 1EB6A 3RTSA 3WV2A 1IADA 5LABA 4GWMA 3F15A 1UTTA 1CXVA 3HDBA 3ZVSA 1G49A 5CXAA 2MZIA 1OM8A 1JIWP 3V96B 3LILA 1MMPA 2YB9A 1GXDA 5D1UA 1OS9A 3EHXA 4FXYP 3LJTA 1KUHA 1K7GA 1QIAA 2OXWA 2E2DA 3EHYA 1CGFA 2OW1A 4G9LA 4XM7A 1GO8P 1ZXCA 1RM8A 2CKIA 3KMEA 1GO7P 4GR0A 1MNCA 4JPAA 1HY7A 3F19A 4GQLA 3U1RA 4FXQA 1CIZA 1OM6A 4JQGA 1OM7A 3UVCA 2RJPA 2JNPA 1SRPA 4L19A 3DWBA 2YIGA 5D1TA 1GE5A 2JIHA 4L6TA 2AIGP 3LK8A 3LQ0A 5D7WA 1JH1A 1K7IA 1JAQA 3LJGA 4GR3A 1Q3AA 2WOAA 5JMYA 4ZR5A 4PKWA 2KRJA 1IABA 2FV9A 2JSDA 2OY4A 4AIGA 4AYKA 4L63A 3I7GA 3N2UA 1CAQA 1C3IA 3HB2P 1XFVA 1DMTA 3E8RA 1O0TA 3DTIA 4GF1A 4PKUA 1JK3A 3EDZA 1H71P 1QICA 4CTHA 1G9KA 4DPEA 5D1SA 1ZS0A 3TT4A 1BIWA 4PKQA 1ROSA 2QPJA 3K7LA 3HDAP 2OXZA 1C8TA 1JAPA 1SATA 2D1OA 4ILWD 1XUDA 3LIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW1 A;  2O3E A;  2J0T A;  3KEC A;  4H82 A;  5BOY A;  1BKC E;  2FV5 A;  1AST A;  3HY7 A;  3LIR A;  2I47 A;  2POJ A;  1CQR A;  3VI1 A;  4H30 A;  2X7M A;  1GE7 A;  5L7F A;  2V4B A;  4QKZ A;  2MZE A;  3L0T A;  2W15 A;  4R3V A;  3K7N A;  1QJI A;  1Y8J A;  3DPF A;  2WO9 A;  3OHO A;  2OVX A;  4I35 A;  1XFW A;  4FVL A;  2OVZ A;  3ELM A;  1BSW A;  1R1H A;  3LEA A;  5I2Z A;  2TCL A;  3Q2H A;  1BQQ M;  2A8H A;  3KMC A;  1GKC A;  4WZV A;  2O36 A;  1SLN A;  3HYG A;  3HBU P;  1USN A;  1C7K A;  1SLM A;  2HU6 A;  1I76 A;  3RTT A;  2W0D A;  4WKE A;  3NX7 A;  2WO8 A;  3TSK A;  3HBV P;  1B8Y A;  3WV3 A;  1ND1 A;  1OS2 A;  3P24 A;  4H3X A;  1XFY A;  1HTD A;  2DW0 A;  1D5J A;  5CZM A;  4GWN A;  1KUF A;  2OY2 A;  1XFZ A;  2DDY A;  1YP1 A;  1KBC A;  1EUB A;  1A85 A;  1JAO A;  4DD8 A;  3CKI A;  1ZP5 A;  4AUO A;  2USN A;  3EWJ A;  3MA2 A;  1QUA A;  3EDH A;  4JIJ A;  1L6J A;  5CUH A;  2OI0 A;  5D2B A;  3DNG A;  1HV5 A;  1IAE A;  1R1I A;  4J4M A;  4EFS A;  3F17 A;  1JJ9 A;  1BUV M;  2MLR A;  3I7I A;  2X3B A;  4ON1 A;  4Q1L A;  1BQO A;  1KUG A;  3AYK A;  4PKR A;  3ZXH A;  3LJZ A;  4JA1 A;  4XCT A;  3ZUK A;  1J7N A;  3DL1 A;  1YCM A;  5B5P A;  3AIG A;  3KEJ A;  1XFU A;  4HMA A;  2CLT A;  2XS4 A;  4WK7 A;  5BPA A;  1XUR A;  1BKC A;  1QIB A;  1ZTQ A;  1JKY A;  1EAK A;  2N8R A;  1OMJ A;  5H8X A;  5I43 A;  1I73 A;  1MMB A;  1UEA A;  2K2G A;  1BKC I;  1HFC A;  1MMR A;  1KAP P;  3GBO A;  3LUN A;  4H49 A;  1A86 A;  3L0V A;  4G0D A;  2W13 A;  4FU4 A;  2ERP A;  1YOU A;  1JIZ A;  3HY9 A;  5B5O A;  830C A;  2AYK A;  1HFS A;  3F18 A;  3G5C A;  3G42 A;  3O64 A;  3TS4 A;  3EDI A;  3BA0 A;  1B3D A;  966C A;  1PWW A;  3LGP A;  2JT6 A;  3USN A;  4PKT A;  2SRT A;  2MLS A;  3LMC A;  3B2Z A;  3AYU A;  5D3C A;  1FM1 A;  4IN9 A;  4IJO A;  1AKL A;  1OO9 A;  1YQY A;  3TVC A;  3B8Z A;  1PWP A;  2Y6C A;  1SMP A;  1MMQ A;  4GUY A;  1Y0V A;  1KUK A;  1O0Q A;  1BZS A;  1KUI A;  4GR8 A;  1BM6 A;  1R54 A;  2OW2 A;  1HOV A;  4H84 A;  1G4K A;  2RJQ A;  2Y6D A;  2OW0 A;  1S4B P;  3LQB A;  1QJJ A;  1UMT A;  3DPE A;  3LUM A;  2ERO A;  1R1J A;  2L0R A;  4XBH A;  3WV1 A;  3P1V A;  1XUC A;  3N2V A;  1JAN A;  3B92 A;  1PWV A;  1BUD A;  4H1Q A;  1SU3 A;  2K9C A;  1D8F A;  5I0L A;  1DTH A;  3Q2G A;  4JP4 A;  3VTG A;  2W12 A;  4PKS A;  1FLS A;  1IAA A;  1FBL A;  4AXQ A;  1D8M A;  5L79 A;  1Z3J A;  1ZXV A;  4HX3 A;  5I4O A;  1G12 A;  2OW9 A;  1Y93 A;  1AF0 A;  1ATL A;  4PKV A;  2XS3 A;  456C A;  2DDF A;  3SHI A;  2X3C A;  3LE9 A;  3F1A A;  4H76 A;  4WKI A;  1PWQ A;  2E3X A;  1CGL A;  3DSL A;  2MZH A;  2OXU A;  2X3A A;  2D1N A;  1RMZ A;  4XM6 A;  1WNI A;  1D7X A;  4WF6 A;  1K7Q A;  3OHL A;  2JT5 A;  2J83 A;  1PWU A;  3F16 A;  4H2E A;  4I03 A;  3LKA A;  4IUW A;  3KWV C;  1UMS A;  3KRY A;  4A7B A;  4A3W A;  2OZR A;  1I1I P;  1XFX A;  1R55 A;  5I12 A;  2Z2D A;  1GE6 A;  1UTZ A;  1CGE A;  5BOT A;  2DW2 A;  1IAG A;  3KHI A;  1CK7 A;  1G05 A;  3KEK A;  5I3M A;  1IAC A;  3O2X A;  1GKD A;  2W14 A;  3EDG A;  2ERQ A;  1ZVX A;  1AYK A;  4DV8 A;  4XM8 A;  2PJT A;  4DF9 A;  1EB6 A;  3RTS A;  3WV2 A;  1IAD A;  5LAB A;  4GWM A;  3F15 A;  1UTT A;  1CXV A;  3HDB A;  3ZVS A;  1G49 A;  5CXA A;  2MZI A;  1OM8 A;  1JIW P;  3V96 B;  3LIL A;  1MMP A;  2YB9 A;  1GXD A;  5D1U A;  1OS9 A;  3EHX A;  4FXY P;  3LJT A;  1KUH A;  1K7G A;  1QIA A;  2OXW A;  2E2D A;  3EHY A;  1CGF A;  2OW1 A;  4G9L A;  4XM7 A;  1GO8 P;  1ZXC A;  1RM8 A;  2CKI A;  3KME A;  1GO7 P;  4GR0 A;  1MNC A;  4JPA A;  1HY7 A;  3F19 A;  4GQL A;  3U1R A;  4FXQ A;  1CIZ A;  1OM6 A;  4JQG A;  1OM7 A;  3UVC A;  2RJP A;  2JNP A;  1SRP A;  4L19 A;  3DWB A;  2YIG A;  5D1T A;  1GE5 A;  2JIH A;  4L6T A;  2AIG P;  3LK8 A;  3LQ0 A;  5D7W A;  1JH1 A;  1K7I A;  1JAQ A;  3LJG A;  4GR3 A;  1Q3A A;  2WOA A;  5JMY A;  4ZR5 A;  4PKW A;  2KRJ A;  1IAB A;  2FV9 A;  2JSD A;  2OY4 A;  4AIG A;  4AYK A;  4L63 A;  3I7G A;  3N2U A;  1CAQ A;  1C3I A;  3HB2 P;  1XFV A;  1DMT A;  3E8R A;  1O0T A;  4GF1 A;  4PKU A;  1JK3 A;  3EDZ A;  1H71 P;  1QIC A;  4CTH A;  1G9K A;  4DPE A;  5D1S A;  1ZS0 A;  3TT4 A;  1BIW A;  4PKQ A;  1ROS A;  2QPJ A;  3K7L A;  3HDA P;  2OXZ A;  1C8T A;  1JAP A;  1SAT A;  2D1O A;  4ILW D;  1XUD A;  3LIK A; 
#chains in the Genus database with same CATH topology
 2DW1 A;  2O3E A;  2J0T A;  3KEC A;  4H82 A;  5BOY A;  1BKC E;  2FV5 A;  1AST A;  3HY7 A;  3LIR A;  3DTK A;  2I47 A;  2POJ A;  1CQR A;  3VI1 A;  4H30 A;  2X7M A;  1GE7 A;  5L7F A;  2V4B A;  4QKZ A;  2MZE A;  3L0T A;  2W15 A;  4R3V A;  3K7N A;  1QJI A;  1Y8J A;  3DPF A;  2WO9 A;  3OHO A;  2OVX A;  4I35 A;  1XFW A;  4FVL A;  2OVZ A;  3ELM A;  1BSW A;  1R1H A;  3LEA A;  5I2Z A;  2TCL A;  3Q2H A;  1BQQ M;  2A8H A;  3KMC A;  1GKC A;  4WZV A;  2O36 A;  1SLN A;  3HYG A;  3HBU P;  1USN A;  1C7K A;  1SLM A;  2HU6 A;  1I76 A;  3RTT A;  2W0D A;  4WKE A;  3NX7 A;  2WO8 A;  3TSK A;  3HBV P;  1B8Y A;  3WV3 A;  1ND1 A;  1OS2 A;  3P24 A;  4H3X A;  1XFY A;  1HTD A;  2DW0 A;  1D5J A;  5CZM A;  4GWN A;  1KUF A;  2OY2 A;  1XFZ A;  2DDY A;  1YP1 A;  1KBC A;  1EUB A;  1A85 A;  1JAO A;  4DD8 A;  3CKI A;  1ZP5 A;  4AUO A;  2USN A;  3EWJ A;  3MA2 A;  1QUA A;  3EDH A;  4JIJ A;  1L6J A;  5CUH A;  2YUF A;  2OI0 A;  5D2B A;  3DNG A;  1HV5 A;  1IAE A;  1R1I A;  4J4M A;  4EFS A;  3F17 A;  1JJ9 A;  1BUV M;  2MLR A;  3I7I A;  2X3B A;  1TVI A;  4ON1 A;  4Q1L A;  1BQO A;  1KUG A;  3AYK A;  4PKR A;  3ZXH A;  3LJZ A;  4JA1 A;  4XCT A;  3ZUK A;  1J7N A;  3DL1 A;  1YCM A;  5B5P A;  3AIG A;  3KEJ A;  1XFU A;  4HMA A;  1XAX A;  2CLT A;  2XS4 A;  4WK7 A;  5BPA A;  1XUR A;  1BKC A;  1QIB A;  1ZTQ A;  1JKY A;  1EAK A;  2N8R A;  1OMJ A;  5H8X A;  5I43 A;  1I73 A;  1MMB A;  1UEA A;  2K2G A;  1BKC I;  1HFC A;  1MMR A;  1KAP P;  3GBO A;  3LUN A;  4H49 A;  1A86 A;  3L0V A;  4G0D A;  2W13 A;  4FU4 A;  2ERP A;  1YOU A;  1JIZ A;  3HY9 A;  1XM5 A;  5B5O A;  830C A;  2AYK A;  1HFS A;  3F18 A;  3G5C A;  3G42 A;  3O64 A;  3TS4 A;  3EDI A;  3BA0 A;  1B3D A;  966C A;  1PWW A;  3LGP A;  2JT6 A;  3USN A;  4PKT A;  2SRT A;  2MLS A;  3LMC A;  3B2Z A;  3AYU A;  5D3C A;  1FM1 A;  4IN9 A;  4IJO A;  1AKL A;  1OO9 A;  1YQY A;  3TVC A;  3B8Z A;  1PWP A;  2Y6C A;  1SMP A;  1MMQ A;  4GUY A;  1Y0V A;  1KUK A;  1O0Q A;  1BZS A;  1KUI A;  4GR8 A;  1BM6 A;  1R54 A;  2OW2 A;  1HOV A;  4H84 A;  1G4K A;  2RJQ A;  2Y6D A;  2OW0 A;  1S4B P;  3LQB A;  1QJJ A;  1UMT A;  3DPE A;  3LUM A;  2ERO A;  1R1J A;  2L0R A;  4XBH A;  3WV1 A;  3P1V A;  1XUC A;  3N2V A;  1JAN A;  3B92 A;  1PWV A;  1BUD A;  4H1Q A;  1SU3 A;  2K9C A;  3DTE A;  1D8F A;  5I0L A;  1DTH A;  3Q2G A;  4JP4 A;  3VTG A;  2W12 A;  4L7A A;  4PKS A;  1FLS A;  1IAA A;  1FBL A;  4AXQ A;  1D8M A;  5L79 A;  1Z3J A;  1ZXV A;  4HX3 A;  5I4O A;  1G12 A;  2OW9 A;  1Y93 A;  1AF0 A;  1ATL A;  4PKV A;  2XS3 A;  456C A;  2DDF A;  3SHI A;  2X3C A;  3LE9 A;  3F1A A;  4H76 A;  4WKI A;  1PWQ A;  2E3X A;  1CGL A;  3DSL A;  2MZH A;  2OXU A;  2X3A A;  2D1N A;  1RMZ A;  4XM6 A;  1WNI A;  1D7X A;  4WF6 A;  1K7Q A;  3OHL A;  2JT5 A;  2J83 A;  1PWU A;  3F16 A;  4H2E A;  4I03 A;  3LKA A;  4IUW A;  3KWV C;  1UMS A;  3KRY A;  4A7B A;  4A3W A;  2OZR A;  1I1I P;  1XFX A;  1R55 A;  5I12 A;  2Z2D A;  1GE6 A;  1UTZ A;  1CGE A;  5BOT A;  2DW2 A;  1IAG A;  3KHI A;  1CK7 A;  1G05 A;  3KEK A;  5I3M A;  1IAC A;  3O2X A;  1GKD A;  2W14 A;  3EDG A;  2ERQ A;  1ZVX A;  1AYK A;  4DV8 A;  4XM8 A;  2PJT A;  4DF9 A;  1EB6 A;  3RTS A;  3WV2 A;  1IAD A;  5LAB A;  4GWM A;  3F15 A;  1UTT A;  1CXV A;  3HDB A;  3ZVS A;  1G49 A;  5CXA A;  2MZI A;  1OM8 A;  1JIW P;  3V96 B;  3LIL A;  1MMP A;  2YB9 A;  1GXD A;  5D1U A;  1OS9 A;  3EHX A;  4FXY P;  3LJT A;  1KUH A;  1K7G A;  1QIA A;  2OXW A;  2E2D A;  3EHY A;  1CGF A;  2OW1 A;  4G9L A;  4XM7 A;  1GO8 P;  1ZXC A;  1RM8 A;  2CKI A;  3KME A;  1OZ9 A;  1GO7 P;  4GR0 A;  1MNC A;  4JPA A;  1HY7 A;  3F19 A;  4GQL A;  3U1R A;  4FXQ A;  1CIZ A;  1OM6 A;  4JQG A;  1OM7 A;  3UVC A;  2RJP A;  2JNP A;  1SRP A;  4L19 A;  3DWB A;  2YIG A;  5D1T A;  1GE5 A;  2JIH A;  4L6T A;  2AIG P;  3LK8 A;  3LQ0 A;  5D7W A;  1JH1 A;  1K7I A;  1JAQ A;  3LJG A;  4GR3 A;  1Q3A A;  2WOA A;  5JMY A;  4ZR5 A;  4PKW A;  2KRJ A;  1IAB A;  2FV9 A;  2JSD A;  2OY4 A;  4AIG A;  4AYK A;  4L63 A;  3I7G A;  3N2U A;  1CAQ A;  1C3I A;  3HB2 P;  1XFV A;  1DMT A;  3E8R A;  1O0T A;  3DTI A;  4GF1 A;  4PKU A;  1JK3 A;  3EDZ A;  1H71 P;  1QIC A;  4CTH A;  1G9K A;  4DPE A;  5D1S A;  1ZS0 A;  3TT4 A;  1BIW A;  4PKQ A;  1ROS A;  2QPJ A;  3K7L A;  3HDA P;  2OXZ A;  1C8T A;  1JAP A;  1SAT A;  2D1O A;  4ILW D;  1XUD A;  3LIK A; 
#chains in the Genus database with same CATH homology
 2DW1 A;  2O3E A;  2J0T A;  3KEC A;  4H82 A;  5BOY A;  1BKC E;  2FV5 A;  1AST A;  3HY7 A;  3LIR A;  3DTK A;  2I47 A;  2POJ A;  1CQR A;  3VI1 A;  4H30 A;  2X7M A;  1GE7 A;  5L7F A;  2V4B A;  4QKZ A;  2MZE A;  3L0T A;  2W15 A;  4R3V A;  3K7N A;  1QJI A;  1Y8J A;  3DPF A;  2WO9 A;  3OHO A;  2OVX A;  4I35 A;  1XFW A;  4FVL A;  2OVZ A;  3ELM A;  1BSW A;  1R1H A;  3LEA A;  5I2Z A;  2TCL A;  3Q2H A;  1BQQ M;  2A8H A;  3KMC A;  1GKC A;  4WZV A;  2O36 A;  1SLN A;  3HYG A;  3HBU P;  1USN A;  1C7K A;  1SLM A;  2HU6 A;  1I76 A;  3RTT A;  2W0D A;  4WKE A;  3NX7 A;  2WO8 A;  3TSK A;  3HBV P;  1B8Y A;  3WV3 A;  1ND1 A;  1OS2 A;  3P24 A;  4H3X A;  1XFY A;  1HTD A;  2DW0 A;  1D5J A;  5CZM A;  4GWN A;  1KUF A;  2OY2 A;  1XFZ A;  2DDY A;  1YP1 A;  1KBC A;  1EUB A;  1A85 A;  1JAO A;  4DD8 A;  3CKI A;  1ZP5 A;  4AUO A;  2USN A;  3EWJ A;  3MA2 A;  1QUA A;  3EDH A;  4JIJ A;  1L6J A;  5CUH A;  2YUF A;  2OI0 A;  5D2B A;  3DNG A;  1HV5 A;  1IAE A;  1R1I A;  4J4M A;  4EFS A;  3F17 A;  1JJ9 A;  1BUV M;  2MLR A;  3I7I A;  2X3B A;  4ON1 A;  4Q1L A;  1BQO A;  1KUG A;  3AYK A;  4PKR A;  3ZXH A;  3LJZ A;  4JA1 A;  4XCT A;  3ZUK A;  1J7N A;  3DL1 A;  1YCM A;  5B5P A;  3AIG A;  3KEJ A;  1XFU A;  4HMA A;  2CLT A;  2XS4 A;  4WK7 A;  5BPA A;  1XUR A;  1BKC A;  1QIB A;  1ZTQ A;  1JKY A;  1EAK A;  2N8R A;  1OMJ A;  5H8X A;  5I43 A;  1I73 A;  1MMB A;  1UEA A;  2K2G A;  1BKC I;  1HFC A;  1MMR A;  1KAP P;  3GBO A;  3LUN A;  4H49 A;  1A86 A;  3L0V A;  4G0D A;  2W13 A;  4FU4 A;  2ERP A;  1YOU A;  1JIZ A;  3HY9 A;  5B5O A;  830C A;  2AYK A;  1HFS A;  3F18 A;  3G5C A;  3G42 A;  3O64 A;  3TS4 A;  3EDI A;  3BA0 A;  1B3D A;  966C A;  1PWW A;  3LGP A;  2JT6 A;  3USN A;  4PKT A;  2SRT A;  2MLS A;  3LMC A;  3B2Z A;  3AYU A;  5D3C A;  1FM1 A;  4IN9 A;  4IJO A;  1AKL A;  1OO9 A;  1YQY A;  3TVC A;  3B8Z A;  1PWP A;  2Y6C A;  1SMP A;  1MMQ A;  4GUY A;  1Y0V A;  1KUK A;  1O0Q A;  1BZS A;  1KUI A;  4GR8 A;  1BM6 A;  1R54 A;  2OW2 A;  1HOV A;  4H84 A;  1G4K A;  2RJQ A;  2Y6D A;  2OW0 A;  1S4B P;  3LQB A;  1QJJ A;  1UMT A;  3DPE A;  3LUM A;  2ERO A;  1R1J A;  2L0R A;  4XBH A;  3WV1 A;  3P1V A;  1XUC A;  3N2V A;  1JAN A;  3B92 A;  1PWV A;  1BUD A;  4H1Q A;  1SU3 A;  2K9C A;  3DTE A;  1D8F A;  5I0L A;  1DTH A;  3Q2G A;  4JP4 A;  3VTG A;  2W12 A;  4L7A A;  4PKS A;  1FLS A;  1IAA A;  1FBL A;  4AXQ A;  1D8M A;  5L79 A;  1Z3J A;  1ZXV A;  4HX3 A;  5I4O A;  1G12 A;  2OW9 A;  1Y93 A;  1AF0 A;  1ATL A;  4PKV A;  2XS3 A;  456C A;  2DDF A;  3SHI A;  2X3C A;  3LE9 A;  3F1A A;  4H76 A;  4WKI A;  1PWQ A;  2E3X A;  1CGL A;  3DSL A;  2MZH A;  2OXU A;  2X3A A;  2D1N A;  1RMZ A;  4XM6 A;  1WNI A;  1D7X A;  4WF6 A;  1K7Q A;  3OHL A;  2JT5 A;  2J83 A;  1PWU A;  3F16 A;  4H2E A;  4I03 A;  3LKA A;  4IUW A;  3KWV C;  1UMS A;  3KRY A;  4A7B A;  4A3W A;  2OZR A;  1I1I P;  1XFX A;  1R55 A;  5I12 A;  2Z2D A;  1GE6 A;  1UTZ A;  1CGE A;  5BOT A;  2DW2 A;  1IAG A;  3KHI A;  1CK7 A;  1G05 A;  3KEK A;  5I3M A;  1IAC A;  3O2X A;  1GKD A;  2W14 A;  3EDG A;  2ERQ A;  1ZVX A;  1AYK A;  4DV8 A;  4XM8 A;  2PJT A;  4DF9 A;  1EB6 A;  3RTS A;  3WV2 A;  1IAD A;  5LAB A;  4GWM A;  3F15 A;  1UTT A;  1CXV A;  3HDB A;  3ZVS A;  1G49 A;  5CXA A;  2MZI A;  1OM8 A;  1JIW P;  3V96 B;  3LIL A;  1MMP A;  2YB9 A;  1GXD A;  5D1U A;  1OS9 A;  3EHX A;  4FXY P;  3LJT A;  1KUH A;  1K7G A;  1QIA A;  2OXW A;  2E2D A;  3EHY A;  1CGF A;  2OW1 A;  4G9L A;  4XM7 A;  1GO8 P;  1ZXC A;  1RM8 A;  2CKI A;  3KME A;  1GO7 P;  4GR0 A;  1MNC A;  4JPA A;  1HY7 A;  3F19 A;  4GQL A;  3U1R A;  4FXQ A;  1CIZ A;  1OM6 A;  4JQG A;  1OM7 A;  3UVC A;  2RJP A;  2JNP A;  1SRP A;  4L19 A;  3DWB A;  2YIG A;  5D1T A;  1GE5 A;  2JIH A;  4L6T A;  2AIG P;  3LK8 A;  3LQ0 A;  5D7W A;  1JH1 A;  1K7I A;  1JAQ A;  3LJG A;  4GR3 A;  1Q3A A;  2WOA A;  5JMY A;  4ZR5 A;  4PKW A;  2KRJ A;  1IAB A;  2FV9 A;  2JSD A;  2OY4 A;  4AIG A;  4AYK A;  4L63 A;  3I7G A;  3N2U A;  1CAQ A;  1C3I A;  3HB2 P;  1XFV A;  1DMT A;  3E8R A;  1O0T A;  3DTI A;  4GF1 A;  4PKU A;  1JK3 A;  3EDZ A;  1H71 P;  1QIC A;  4CTH A;  1G9K A;  4DPE A;  5D1S A;  1ZS0 A;  3TT4 A;  1BIW A;  4PKQ A;  1ROS A;  2QPJ A;  3K7L A;  3HDA P;  2OXZ A;  1C8T A;  1JAP A;  1SAT A;  2D1O A;  4ILW D;  1XUD A;  3LIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...