3DTEA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IrrE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 70
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dteA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dteA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dteA01
3DTKA 3DTEA 3DTIA
chains in the Genus database with same CATH superfamily
1OO9A 4ID4A 3HOZJ 2WKQA 1A86A 2AXTC 2DLLA 2TRTA 2G2WA 1Z6RA 4H84A 2KT0A 4DYQA 2LR8A 5DYMA 3GQZA 2O7OA 2KJCA 1MMQA 4G3WA 2W13A 3K0LA 1QHGA 2K9QA 3FXUA 3VSLA 1FMWA 1IKGA 4HSTA 1K56A 5CUHA 4LIUA 5EEGA 2ZOHA 3DKXA 4AVZA 4MGRA 2KRJA 1O3TA 2J8YA 3V7RA 3G73A 4DE3A 2ECBA 4UEYA 2NNYA 1VETA 3VP3A 2MJ6A 3VV4A 4KIGA 4X55A 1KQ9A 3P9CA 4B44A 3FWEA 2VOPA 5FDSA 1KVMA 1IUYA 3NI9A 4QY5A 2E35A 2L9RA 3L2VA 4CXFA 5LABA 2IP2A 2P4WA 5F04A 1NG6A 3PFYA 4AWXB 3CAXA 3LOCA 1YLWA 3IAS2 1G05A 1K83J 3CC2I 3QPHA 4IVIA 3TOBA 1U9OA 3LSKA 1N9LA 1O3SA 2AVXA 4D60A 4EGZA 1UJ8A 3M1CA 3Q1FA 2EIJH 2WAQA 1SDNA 2LKSA 4HEA2 3L7HA 3LAJA 2CW8A 1G3YA 2BG1A 3IXDA 2H28A 5AVEA 1T33A 5F64A 4CUGA 1MY8A 1FOFA 2RC4A 4GD8A 1ATLA 1JTDA 1QJJA 2MBFA 4WWCA 3N4IA 3DKYA 1CQTA 2KLIA 4GR3A 1V4RA 1GV5A 1KA8A 5KNLA 4KN7X 4MFDA 1S1YA 2YS9A 3H0GJ 4S2PA 1PP7U 4XLHA 3P24A 4DNCA 2LOOA 5CQGA 2DT5A 3SJMA 3TMOA 3NAUA 1VETB 5GAEJ 2CG4A 2E1CA 4UVCA 3A0VA 1SD6A 5AIPA 4OONA 3ECOA 1O7FA 2GXGA 4OAYA 5CTNA 4I3AA 4V19K 4OLDA 3AG3H 3BTCA 1FSYA 2BASA 3MKYB 4WL9A 2VKVA 5TRDA 5DEQA 3IT9A 1BN5A 2FBKA 4GNUA 4PMAA 3KPHA 1HF0A 5FQJA 1HXDA 3DQVC 4A0XA 1E3OC 5J47A 1IGNA 3NOTC 1ALQA 3J7ZI 3IF5A 1PI4A 2HKOA 3IWQA 3A4CA 4RA7A 1JGGA 3ZG0A 2X48A 5FA7A 1YM1A 2RJQA 5CXAA 1IJWC 3PFIA 1FBUA 2HDSA 3CP8A 5EG0A 3B3XA 3ABLH 2PLYA 1FR1A 1DDNA 2L0KA 1ETWA 3TSGA 2PDRA 1OTEA 1HW1A 4E3KA 1IN4A 2CH0A 4LENA 3LI8A 1IXRC 1P9WA 3C38A 2GQQA 1USTA 1ZELA 3Q2GA 4DDYA 4NKPA 4WKIA 1Y0NA 3LUNA 1GXQA 5GAHJ 2RNGA 3AG2H 1XFVA 4KQDA 3CCYA 1BOAA 2A69F 3H82A 3GFJA 2OY4A 2PMZN 2I9VA 2MD5A 3TW7A 3GBGA 5AJGA 3K3DA 3OYGA 1W4MA 2V9VA 1FNNA 3FG8A 2D1NA 2X3AA 4YG2F 2OY2A 3LJGA 2B63J 1LUJB 3S1RJ 4LRZE 1G6NA 4GCZA 4GDBA 4I01A 3LMCA 3M8EA 2UV0E 5FD6A 1HKTA 1K6RA 2GNXA 4AYBN 5EVIB 2FXAA 3K1NA 4CYCA 2E34A 4A93J 5JR3A 3IBRA 1IELA 1W36C 4I3IA 4N4OB 4BGDA 2F5EA 2JRMA 2QKLB 4HYEA 3FISA 3OS1A 3MF0A 1HY7A 4F3LA 5BPIA 3V3RA 3ZQQA 3KEYA 3MFDA 2WKHA 4CLCC 4D5FA 3F18A 5EG0B 1I2SA 4Q0IA 5AONA 1X3ZB 3UE3A 1HV5A 1MD0A 3E5QA 2H5SA 3NBLA 2G7HA 2P6SA 2ZQDA 2BYVE 2F6CA 4II3A 1MH3A 3F9KA 4KZ8A 2JSDA 3B02A 3H82B 3AG1H 3B6AA 4IJGA 2ZC6B 2A05A 3PJRA 2VQLA 3LK8A 3C3WA 5F1JA 2WKPA 3TQNA 5KSCA 4UUSA 4AM3A 4U7DA 4I38A 3T4LA 3QU3A 1XFQA 2W3GA 1AYKA 4OP8A 5GLBA 4B09A 5BOYA 2K9NA 1RUOA 2FRHA 3GWZA 3CUEC 1D0ZA 3HOSA 1ZN2A 2QVOA 2UUZA 2K4BA 4HDVA 4FX4A 2IBDA 4CYCB 3CQZJ 1EWZA 1LT0A 3GTGJ 1Q1VA 1TVFA 4QWQA 3O5YA 1KUIA 3K2NA 3UMEA 2W84A 4HPQA 4HEFA 3T1XA 1L2SA 3ELMA 1SZVA 2XKOA 2OTLI 1M40A 3PSFA 5ICFA 4JOMA 4F3LB 2X85A 4JXVA 2DA7A 2VASA 2R7QA 3MXSA 3G4SI 3MZEA 2ZO4A 3D5RC 1X19A 5DV5A 1W0UA 1FIKA 3SFIA 1SFUA 2VN2A 2SRTA 1Y39A 3ZNTA 5K7FA 2H09A 3ZOBA 4DE1A 1R36A 3O86A 4NHJA 3GV9A 1T1BA 4BUPA 4IUHA 4HOBA 4IJOA 5IYBJ 3T1RA 2J3TC 1MMGA 5EJCA 1SMPA 5HDSA 2XV4S 2HDQA 1XGIA 1VFCA 4UUSB 1KZHA 2JTVA 4RAGA 2JN6A 5IOYA 1K57C 5EM1A 4C3QA 3VTGA 3BECA 2K02A 4PPRA 5E3NA 4I2OA 3S7QA 4ZDLA 3CMYA 1D7EA 2K2GA 3KYDB 3SXYA 1O4XA 1RGZA 1FP2A 4U7BA 3UB6A 3GFLA 2ZJ2A 1JH1A 3PBRA 1LSVA 1X1BA 4L9TA 1UG2A 3BZKA 3C8CA 1GA0A 1OJGA 5DUIA 4EQQA 1KDWA 1CGLA 3OIOA 1RM8A 4LITA 3KZZA 1GVJA 3NY4A 4QLCU 4C3JJ 2QSFX 4MLLA 4UA7A 4LRYC 2DA4A 3G3ZA 5FROA 2RN7A 5IOZA 2DXIA 1MWTA 2Z16A 2PRFA 3A3EA 2X1CA 3Q0UA 5H6RA 3ERED 5IHVA 2O36A 2XF6A 3OHLA 4WZ5C 3A1YA 3WS2A 3KECA 1XJ6A 4FT8A 4EV4A 1P6RA 3LILA 4IF4A 1RC9A 1SC7A 1OS9A 3CUQA 1CI8A 4HBLA 3NARA 1BKCA 3A02A 2BVMA 1R58A 1ZTQA 1WQ2A 3EDGA 5HDKA 4XLNF 3TO9A 2ZC5B 3QP4A 4YELA 3NULA 3M3YJ 1CGFA 4XLAA 5HDDA 1TZLA 3Q0WA 1T08B 4BU2A 2O9BA 2O5RA 1KBCA 1I1GA 2YPRA 5HVQC 4OP5A 1DU0A 4PKWA 1I73A 1SDEA 3QHYA 2LSOA 4Y3OA 2HP9A 2ZJRF 4HX7A 1OPXA 2Y4AA 5F0FA 5FO5A 2ZBKA 2WBMA 4OOLA 2WADA 3BR2A 5FKMA 1D5VA 3ZR8X 3QQAA 3QYEA 3S7OA 3EWKA 3C7UA 4HY8A 4N1XA 3MJQA 4EU0A 3VP0A 4P1WA 3EYIA 4MCWA 1YO5C 3HSEA 3JVVA 1SAXA 5I12A 5LGUA 1FJLA 2DFIA 1UELB 4ABZA 2YUFA 4KENB 4M72A 1YT4A 3F3XA 1XGMA 1WJEA 3FIWA 1SANA 2ECCA 1L6JA 5LEJA 4I7HA 2FFFB 2EA9A 4RYEA 4BBUA 4P96A 2Y2JA 4JBFA 3HRMA 5J6XA 2ETHA 4HQEA 3EWJA 3FXJA 2XKPA 1FCMA 5JLWA 3CCVI 1DPUA 3S2HJ 5KAIC 2K27A 2ZQCA 5K5RA 2KLOA 3LSMA 3PQJA 1G6AA 4DBRA 1MNMC 4M9ZA 3K7LA 1BL0A 2XDVA 2QHKA 3S3NA 4BL0B 2V1AA 2HZDA 3OLOA 2VE8A 4EMSA 1LNWA 3FXRA 1GSXA 5D2BA 4MMNA 3LJZA 3C2WA 1S72I 4L9GA 4GF1A 3H5RA 4JGOA 3LCEA 2PMZA 3RXWA 2R93J 1NZUA 1IRXA 5B5OA 2WAEA 4JP0A 3GFIA 4S2IA 1IOUA 3IXGA 2OWJA 2MYSA 3NDGA 4YFMA 1PWQA 1IDYA 4HA8A 2E2IJ 4BHBA 2IS6A 4ZR5A 3U2AA 1TWCJ 5DCFA 4Y7PA 3UB7A 2FQ3A 1YJNI 1JWZA 1ES5A 3K2ZA 2Q8KA 4UNOA 1IYSA 1OZ9A 3W8KA 2A5YB 1KE0A 3LAPA 2YX4A 1HA8A 3FXKA 2PBIA 2ZC3B 3QPLA 1R5ID 2FBIA 5D4RA 2F5CA 3U1KA 3DU6A 5CGXA 1TWGJ 4PKYA 4I0BA 4ESPA 2DOFA 2JZYA 1YYVA 1P4XA 4DV8A 4G9LA 2QSGX 1RESA 5CVRA 4FH2A 2IWBA 3I7GA 2I5UA 1NK2P 1W7PA 4JGQA 2P7VB 4HHDA 4ZTFA 3F1PA 5JMYA 1J09A 4LV2A 5E3MA 1EKEA 2O8XA 2MW8A 4DQ2A 1RIOH 3DXJF 3K70D 5EEHA 3HOWJ 3EYYA 1L0DA 1BIAA 5C4XJ 1ETKA 4B8XA 2EX9A 2HV1A 3VFFA 4KJZA 1ZARA 3EGXC 4IHQA 4P9UA 3CO7C 2H6BA 1ASTA 6PAXA 3WTXC 3QPTA 5JI6A 1T56A 2ZQAA 2HXIA 3IH3A 1YRNA 2HPBA 1PWWA 2HP6A 3CCEI 2ACJA 4IHYA 5I5LA 1YLPA 1QQIA 4E7SA 1J7KA 2QUFA 4YEJA 2XHKA 3TDZC 3M8JA 3ZDJA 4O6JA 1K4FA 3BA0A 3QODA 4L0ZB 2L01A 2DTRA 4PM9A 3BR0A 1MJBA 2VQHA 1X4PA 4DE2A 4KUKA 1V54H 1SVOA 3B73A 2ZD8A 3BCAA 1K54A 3MA2A 2A49A 2V1ZA 3S3MA 5F0CA 1W7PB 1MMNA 4BQMA 1QZEA 3F1PB 4D7NA 2H8WA 3VMAA 2XA7S 2H0TA 1G28A 2Y2OA 4GD6A 4ZJ2A 4JXGA 1S66L 4RGSA 2A6EF 4JIJA 3HBVP 2OCCH 3VYSB 2VJWA 2VKDA 1Y1VJ 3HHHA 2VJ4A 4E3JA 1R55A 3K4CA 1Y0UA 3NDEA 1PWCA 2JWTA 3IRQA 3LEAA 5LBRA 1MBHA 1JAQA 5CPRB 3TP3A 3HLFA 3G32A 3PYPA 5M5WJ 1YRNB 1E25A 3H3VK 3HLCA 2JMWA 2JE5A 2YUSA 5DM7F 4NC8A 4KZ7A 5K5QA 2PU2A 5IP7J 4L9NA 3PBQA 1HKSA 1YP1A 4YIFA 2QJ7A 3B92A 4FXQA 3D9YA 1TNTA 4PZJA 1A6QA 3Q9VA 2INWA 4R4RA 2VEAA 4XLEA 2J9PA 2Y0SN 2QCOA 2ZMEB 1JKQC 1DJBA 2STTA 5L79A 1UMSA 5DD8A 2MGQA 3FBIB 1DP9A 1BIBA 2UWMA 1TL8A 2M3AA 5F1RA 2ME0A 2EXBA 3MFXA 5CYVA 2K9CA 2CGPA 2VI6A 3FBNB 2CQ7A 2JSPA 3EEHA 4A3WA 3J7AO 2W0NA 2Y9YA 3HLEA 1VQ5I 2IW5A 1J3WA 2ZNZA 1VM1A 2M4KA 4MEYF 2MSYA 1USNA 3N7WA 2V1BA 2Z2MB 2OVZA 3FK6A 4LCLA 3OSFA 2MZEA 1K55C 2JCHA 2NYXA 4PSWA 4JX4A 3KZYA 2RL3A 2CWEA 2DTZA 2MA3A 4A3EJ 2D02A 1WGXA 3FKJA 3CC7I 4A0ZA 1XUCA 2H10A 1APLC 3MEXA 1I2WA 2DMPA 2L9VA 2Z33A 2Q9MA 3GLLA 4PAUA 3TO7A 2KDZA 4LIVA 3HSRA 1SFXA 2Y2NA 3VFZA 2XFTA 4ARZA 2VPRA 4ESJA 3SYTA 4K91A 1L0EA 2EJRA 4GQLA 4RGUA 3JRCA 1JHHA 5FKOA 3HOYJ 4F91B 3KETA 2IWCA 3SS3A 2RREA 1S4BP 4XUXA 3RYRA 2YX7A 2G2UA 1DP6A 1T0FA 1RP5A 1ZG3A 3H3ZA 3FF5A 1QNTA 2ZJ9A 3HM5A 5IP9J 1K61A 2BTFP 5EECA 1N25A 3KP6A 1V9ZA 3M07A 3FXLA 1HW5A 2XIGA 3CMAI 1IYOA 1PW8A 2HPMA 1IC8A 4L0LA 3HUOA 1ERDA 4OQGA 3BDDA 1FQGA 4BY1J 1F43A 4HX3A 1SD4A 3RKQA 1UZCA 2CW7A 1BKCE 3ELKA 3O2XA 4QWOA 2OSUA 2PAVP 4P87A 1H9TA 4E7IA 4B3XA 2V9KA 4L63A 3KRYA 1MZBA 1BUDA 4MN6A 3KSGA 2HKXA 4A5RA 1HQCA 3WS0A 4XQFA 5CXWA 2DPDA 2GA2A 4BE1A 2RGVA 1BUEA 2LKPA 3TW6A 3T12B 2QMIA 3N05A 4X56A 2W25A 4N1HA 4ARZB 1BLHA 1Z7UA 4BS9A 3ZXHA 1QO0D 2XASA 1USSA 5LHGA 5FI2A 2M30A 3MKFA 2E5NA 1TEMA 1Z05A 3CDHA 2HWVA 1KONA 5TISC 3PBNA 3ZQGA 3BFDA 3WG9A 9ANTA 2CMNA 1ON2A 3GW2A 4A3FJ 3OYHA 3HC7A 2XVCA 2VLGA 3KMEA 4IEJA 1T8IA 1D8FA 1BBYA 5CKTA 4GR0A 3UE1A 2DFEA 4ZYDA 5ICCA 1WE4A 3K4NA 1NYMA 4P6BA 3ZMUA 2L0WA 4FVLA 2RAEA 3I5UA 3AL0B 4Y52J 5LGTA 5E1ZB 3JYIA 2M1CA 4B4CA 2FFYA 1DJAA 5FL3A 3CJTB 4F92B 4LG0A 3C5AA 4E7JA 2K3FA 3KP4A 5TGFA 3LSTA 5DFYA 4MQ9F 2YB9A 4R0QA 1FX7A 3SQNA 4E6WA 2X6OA 5ED4A 5F1FA 4HP4A 3BP8A 1LVKA 3LSHA 3HPHA 3V7SA 2VBYA 1FOYA 3V7CA 3L2UA 2M7BA 4LMYA 2DN0A 5J7EA 1XFYA 2DCEA 3ZHHA 1XPXA 2E36A 4KZ4A 5HAIA 1W8YA 4EFSA 2D1OA 5EEAA 2X6XA 2JUGA 1Q3AA 2ZC2A 3ZPLA 4DOZA 2X9DA 1P7IA 5CHUA 4C2MJ 4C75A 4P85A 4R38A 3G35A 3LIRA 1WFXA 1DGWY 4EJOA 3AFHA 1W1WE 4R4SA 4NXEA 4H1QA 2UXNA 2DCFA 1VZ0A 1BT5A 2UZKA 2A5WA 3P01A 3WTUC 4JF4A 5EVID 1XMXA 3U4LP 2WKRA 2F5FA 2OJED 2WTEA 2EV5A 2NXNB 3ROUA 2KPMA 3BG9A 4XRMA 1XURA 2LBFA 2XAHA 2A8HA 2D1VA 3SDGA 3K2AA 5GLAA 3S2WA 1YG2A 1S7EA 1JAOA 1YCMA 3W2ZA 4LG0B 1ZKJA 3B2ZA 3S16J 4FXYP 4I02A 2IWDA 4S0HB 1N9OA 2HOAA 3S1NJ 2VT2A 5KAFC 2VJJA 1MWRA 3VDXA 3OHOA 1VQKI 1ONHA 3L2WA 5HS7A 4C3HJ 2JUCA 5CLSA 4PKRA 5F27A 3KO6A 1QZYA 2KHMA 3JPUA 4M6VA 4XRSG 2Y2ZA 5JVGF 3F72A 3IH2A 4KZ3A 1O0TA 3BFCA 1CK3A 2ZM2A 5ERIA 1B59A 4UHUA 1YW8A 3OOUA 4HSRA 4ZDPA 5HAQA 3U2RA 3M2JA 4FASD 5E8IA 4ZDXA 5HDGA 5E1XA 2OVXA 1YOVB 2P0WA 2VPLA 2LNBA 3DKWA 1I6XA 1KU7A 2LMDA 1PWGA 4KG6A 5LFAA 3IH8A 4EV0A 5A90A 2LF7A 1OCOH 4IL6C 2F5DA 4KT5C 4IUKA 3QP8A 5F82A 4EEPA 3CUQC 1MPLA 2W3FA 2LBFB 3HY7A 2I47A 3ZQIA 4JQFA 2EA2A 1W36D 2LB9A 3DW0A 1TW3A 2ZXWH 4I76A 4A3LJ 3KHIA 5F6AA 2PD8A 2ESHA 3M4OJ 5ICGA 2ZKZA 2MG4A 4CLCD 3GF2A 3MKEA 3N8RA 5HOOA 3LQ0A 2XROA 4OIOF 4X0GA 2Y48A 2QA4I 2BXZA 3I7JA 5DKKA 4X69A 1T1AA 3KCCA 2L9NA 4YOFA 5FLXK 4JXWA 2L3DA 1KGFA 4ZJ1A 2CLTA 3WTTC 3R61A 1N78A 3DCFA 3J80K 2LH9A 2CQQA 5DS9A 2RQQA 2CJJA 3RKWA 5IU1A 1RR7A 3HRTA 1WWXA 5HD5A 4ZTJA 3UDXA 3CD6I 1HLUP 4XM8A 4G6DA 3LE9A 4LRXC 2QENA 5L7FA 4Z9QA 1R9TJ 4AUOA 3UB8A 3IH9A 3RSNA 2NS7A 2XUBA 5L3BA 1TF1A 4XKBA 2PR5A 1XTAA 1KYWA 3DP7A 4GZBA 2LG4A 2XC7A 4E3OA 3HUGA 2NVYJ 3M7GA 2DOEA 1HVBA 3E5UA 2Y69H 4E04A 2IRFG 3V5MA 2KIQA 1XS9A 3Q82A 4R6LA 4Y0OA 1F98A 1N75A 5FEFA 4J01A 3VYUB 5KSHA 3G2BA 1HTZA 3CCQI 3BTIA 4BXXJ 1BM6A 1VI0A 2VC1A 2GDNA 3KEKA 3HJKA 1GE7A 3BFFA 1IXSB 1MH4A 3PNTA 4C30A 5LHIA 3HBLA 3G31A 2WGVA 2BLSA 1ZGAA 3E98A 1ODDA 1FBQA 3K1MA 4LLGF 4E3MA 2J3TD 4KYWA 3L09A 1OR7A 2EWVA 3K4JA 5FD5A 1IF1A 2DW0A 3S32A 4FOFA 4MEZA 5EPHA 4EETB 1DUXC 1D1JA 2FH5A 4O8GA 2WGWA 1KGSA 4FX0A 5JHUA 1SFEA 1NXYA 1BR1A 1Z67A 1QIBA 1STZA 3HY9A 3GTLJ 4R70A 2R7XA 1MMBA 2GLOA 1OMEA 1FSWA 1ZG1A 3HUGB 4M6XA 5J3WA 3BLSA 1PIOA 5LRRA 2Y2GA 1ZLKA 4HLYA 3KYEA 3F21A 5HFOA 4BQAA 1LJ9A 3N6IA 2BY0A 3LFVA 2WAFA 1LEAA 1ZHFA 3UKGA 3BZCA 4E3NA 1A6IA 5A8BA 2DT7B 3GTJJ 4Y0UA 3EUKL 3EHYA 4E7KA 3DPTA 3ZQHA 2GXAA 3P7NA 3LEZA 1XFUA 1WI9A 1S7AA 3QU6A 4UUTA 3B6CA 2PYPA 5A2QZ 1R1JA 2RJPA 2WWYA 1XKZA 1I1SA 5CJ9A 4R23A 1K7QA 5LHHA 5ILVA 3WU2C 2JT1A 4IPAA 1GHMA 2OOLA 3SZPA 4R1HA 3SEQA 3DTEA 5FKKA 3H9WA 1R1IA 3GMWA 2HQNA 3UNGC 1TQPA 2XF5A 3D0SA 3I54A 2CYYA 2DW2A 2HDDA 5L3GA 2F48A 4BBSJ 3FM3A 3LIFA 2XSJC 1QHHD 4FH4A 4FCFA 1KVLA 1U6GA 1LB2A 4WKEA 2KZVA 5CVUA 1XM5A 5K7HA 4LD5A 2JBFA 2X7MA 2WGWB 1K25A 5FQ9A 3RH8B 4L19A 3BJNA 1BR4A 1KQ8A 2FU4A 4XBHA 2FA5A 1LEBA 1PUFA 5EE8A 3L2RA 4AC0A 2DA5A 3IUOA 3DTKA 3H0DA 3COAC 1ZG4A 4HI4A 1GO8P 1LSXA 2XGEA 2IA2A 4KZ6A 3OPHA 4KMUX 2QBYA 3VE4A 3W4OA 4GJ4A 3H7WA 2DYSH 5FQKA 4PKVA 4CGZA 5H8XA 2QZ8A 1J2XA 1RRJA 3CUOA 3P98A 3LIAA 1YMXA 3F15A 5A93A 4MTDA 1KOUA 1RMZA 5BQTA 4KA4A 4LB5A 1OJLA 1A5JA 4HW0A 1MNCA 1R1HA 1JNUA 4DW6A 1F2KA 2KDKA 4NC7A 3CJRB 2HEOA 1CGEA 3CJQB 4C3IJ 5CRFA 3CCSI 4BXUA 3BQYA 1YIOA 1MJ9A 3ZMVA 3OYDA 4EERA 1KUHA 3PAGA 4RA2A 4EATA 3KSHA 1HD8A 4KT6A 4CSWA 5AVFA 4PSXA 3MXRA 2XQZA 1OCCH 3RXXA 2E1MB 2CV0A 3I59A 1QICA 5JYPA 2RV8A 2Y6CA 1IN7A 3GXOA 2FSWA 1H3QA 3HZJA 1XFWA 5FATA 3BY9A 2KMUA 1PUFB 1UEAA 2EQRA 5DJTA 2WAQN 2O03A 5EVEA 1X3WB 2A3UA 3RDIA 2DRWA 4B43A 4CA0A 3D4FA 5D3OA 3ZMZA 4FSFA 1C3IA 5TR7A 3KE2A 1BQOA 1X0OA 1S8NA 3BC8A 2ZXIA 2E2JJ 1XGJA 3MKLA 5M1AA 2V4BA 4DJAA 3GVAA 3G1MA 5HAPA 2ACGA 2K7SA 1SATA 4ZZDA 1U5TA 4UB8C 2NUPC 2XGXA 3IAM2 2QKPA 1U3EM 3M6BA 4ME4A 4IHXA 4DXBA 4A6DA 3EQVA 3UDIA 5AQBA 3AGEA 3TOIA 1JTYA 4E7ZA 1L0GA 2HOEA 4EJUA 3ZQLA 2X1DA 3MZDA 4BD1A 3SH7A 4IQ4A 4FTHA 2Z1DA 3SHFA 4X6AJ 3CLOA 3JR9A 2O6GE 3C30A 3MVPA 3S1YA 1FYLA 3VYRB 2O3EA 4EUZA 3V8KA 1B1BA 1H88C 5AQ9A 3KLNA 1PJRA 3BTLA 3BY8A 2DODA 3IXBA 3CPTA 5HPIA 2ZSIB 3PAEA 3GZ6A 2ZCWA 1TLHB 5HWWA 2MLSA 2EFQA 1W0TA 5HODA 1JT6A 4AUXA 1ONVA 3LSIA 3NHQA 2HOSA 3DWLE 4L5EA 1I3QJ 4S2NC 3HYGA 4IKFA 2MZIA 3WU1B 2OWHA 1TS7A 5H2FC 2FQ4A 1BI2A 5FLXZ 4JF6A 1MBFA 2Y55A 4BE0A 2VK3A 4J4MA 2COBA 3K69A 1NG7A 4FCYA 1AWIA 3HLDA 1H5XA 3WS1A 4XN3A 2PG4A 1NYYA 2B18A 1XJ2A 1R7JA 4KG5A 1E0EA 4U0WA 5TGTA 2VJ5A 2OCEA 3HB9A 3RQIA 3ZFZA 3I58A 4XICA 2M7UA 2W82A 2EA4A 5TJJA 1XUDA 2IS1A 3MQOA 1JUPA 4S04A 2Y0MA 4H8RA 1UMTA 1XP4A 4R3AA 4KN4X 1G3WA 4IHTA 4M4XA 1ZG5A 4RQ9A 2OAZA 3T1QB 5E2EA 1VQMI 3I55I 5HS9A 2LRDA 3C7VA 1IN5A 2VKEA 4NXBA 3CF5F 3MQQA 2P9VB 2M1BA 3F1NA 2DDFA 1QGPA 5IT5A 3NOUC 4PJNA 5GADJ 2E1OA 1SHVA 1IRFA 2C6WB 5EFWA 2VQCA 1R1VA 2XB5A 4GR8A 1HLVA 1SLMA 3A3IA 1ZKGA 2V1XA 4BJPA 3RI4A 1U8RA 3HOUJ 1ZYRF 4GWNA 4G7ZF 2F2EA 1UHSA 1RNLA 1EV7A 3IQAA 3NECA 2ZJPF 1ZTUA 1CEGA 4LCMA 4X68A 2L1MA 4Q47A 3L0TA 3A0BC 4HMAA 2DK5A 1KYZA 4EUVA 1JTXA 1BI1A 1LLBA 4BJ5C 3V42A 4WXHA 4L9JA 2JJ7A 2CV1A 1DRMA 4UAAA 2K7LA 2B7EA 4WK8F 4A3BJ 1KQ0A 2Y2KA 2KRFA 1H8MA 1BLPA 1G4KA 2OW9A 2KIMA 1FBSA 2EFPA 1IYPA 1ZP5A 2ZJQF 2Q0OA 3F8MA 2CW0F 4YINA 3GX4X 2R92J 3EUHC 3ZYTA 5BMZA 3T8TA 5LEKA 3F1NB 4EM2A 3R7WA 2W24A 3PO3J 4B88A 3LI9A 3C2GA 4DRTA 4HX8A 5GTIC 2DDYA 3MSHA 4CPKA 4Y3IA 2ZFWA 2FF4A 4A12A 2OV5A 2K31A 4K0XA 1FCNA 4WF0A 4HDUA 3WGGA 3CG5A 3PO2J 2MLRA 3K4LA 4HNVA 2Z2LB 1S1ZA 1JKPC 1IADA 3ZP5A 3OS2A 2R7UA 3ZG8B 1IYQA 2XS3A 1FOXA 2X6YA 2OUMA 2BOLA 1X3UA 4MO7A 4RLFA 2W7NA 4WX9A 1O0QA 1J0RA 1BLCA 1E3HA 4HJ3A 3GVBA 1FP1D 4PM8A 4MN5A 3LSGA 3KYQA 4D1QA 3D5SC 4KISA 3JRAA 2E8JA 3G2YA 1TWFJ 3IF6C 1XJ3A 3HOVJ 3LQBA 4Y2FA 3BZ6A 4LV0A 3UMDA 3LR4A 3B47A 1ZC2A 4HF2A 2BHZA 3MFKA 3HGGA 3HIFA 4KQQA 1O7LA 2DO7A 2EZLA 4OPYA 1Z6FA 3IX3A 1E2XA 3A3JA 1SAUA 3CCRI 4AD9A 3LSPA 2X01A 1SVMA 1J9IA 4Q5SF 3Q7VA 1FIPA 3D72A 3RTYA 4DPEA 2IGKA 1EH7A 2Y9ZA 4EGYA 2VUMJ 2FV5A 3OCNA 3R7WB 1ZGJA 5L8MA 3LFUA 1SD7A 5D5UB 1ETOA 4XUZA 3IS2A 2NS8A 2OQRA 2DT6A 3CMEI 3DBLB 2H8RA 4GO1A 3WRZA 4RBOA 4QB8A 3H9JA 4X53A 3AGFA 3F6VA 4Q1LA 1I27A 4QU3A 4A69C 2OD5A 5HL6A 3HJEA 1ZHHB 1FTTA 4P55A 1ZRFA 4KFCA 1FLSA 1JT0A 2PBDP 3RJPA 3QP1A 5KCMA 2BBYA 4L9EA 1F36A 2RDPA 5DUKA 1KDSA 1J59A 1R5HA 2D5VA 4RM2A 4MBKA 3T4JA 3GECA 1DP8A 4KZBA 5G4ZA 4A3JJ 1T1CA 4DF6A 5LD2C 3CWFA 2FZ0A 3UE6A 1EUBA 4OLGA 3ESWB 3BY6A 1B6AA 1Z9CA 3HDAP 5CGWA 4BWIA 4B4ZA 5F68A 1ZRCA 3ZRGA 4GCVA 4MBFA 5I0LA 1CGPA 1V55H 1E3UD 2WYXA 2BW3A 3K9TA 4JPMA 2BZTA 5DM6F 3V8JA 1ACFA 3Q7VB 1YI2I 1S7OA 1AKLA 3H92A 4X1MA 3SHIA 1S29A 3IC7A 4FTXA 3GLXA 1Z3JA 1P4WA 5G18A 3GTMJ 3IS2B 2BY1A 2QF7A 3E3VA 3SH9A 2EB7A 4DD8A 2W1RA 1MIJA 5EM0A 2BVLA 3EGDC 2Z6DA 1IXCA 1UGUA 2NRAC 4JXSA 2VJIA 5EVIA 5C4JJ 3BYDA 2DU9A 4ZRRA 1VQQA 4LFUA 5GLCA 1BULA 1AHDP 1LFPA 4PCQA 2KIUA 4ZYGA 4N9HA 2AXLA 1KE4A 4HBUA 2QQ8A 2Y8HA 2DYRH 1OCPA 5L3FA 3JVUA 3CCMI 3IWZA 3ZQ5A 3GZ5A 3KX2A 1PZOA 3M2KA 2A24A 4UB6C 2DOAA 1Z77A 2V8FA 4BEHA 4DYCA 2BW3B 4BKXA 3L2CA 1OM7A 5D8LB 2V4JC 1WI3A 3NCKA 1BOBA 1X1DA 3Q81A 1N77A 3FMSA 4A2UA 2IGOA 1BW5A 1W5CC 3KSFA 2USNA 5FLVA 3S15J 3JW4A 3IHBA 4DYRA 4DXCA 1IFQA 1K6SA 2M0MA 4Y17A 4D7MA 3A01A 2XEPA 3I3LA 2IA0A 2ELKA 3P9KA 2VLAA 3KP5A 4E6KG 1XXMA 2VGKA 1BTLA 3F1OA 2X3BA 4XORA 4NETA 1PWUA 1MMDA 3VE3A 1GHPA 1CF7B 1K7AA 4NXFA 2EPFA 2FD5A 4GLQA 2R5ZA 1ND1A 1I3AA 4P6ZM 4M3DA 1P7JA 3K4MA 2QZ6A 3HYIA 830CA 4UV9A 2YKHA 2EROA 3ZQ7A 3T4QA 2XPWA 2NVXJ 2XRNA 3E6CC 2A24B 1S67L 2HQ5A 3I64A 2L02A 4ASNA 4BEHB 4CLCA 1NTCA 1Y54A 2Y2MA 2DA6A 4IUWA 2XD1A 2PI0A 1QIAA 1AU7A 4RX3A 4G3KA 3DNGA 4FE4A 4ZAMA 3KZIC 4QPQA 3QP2A 2FMLA 2QWSA 2A61A 1CIZA 3HBUP 2JA6J 5FI7A 3KYCB 1JKOC 3JRHA 5D6FA 3DWBA 2NAZA 3O64A 1MWSA 1A35A 2EV6A 4II2A 2W3EA 4OVDA 2CQNA 2E8IA 3A01B 2E2HJ 3KWVC 4HNUA 2JA7J 3MCZA 2M45A 1FY7A 1B8YA 5J8FA 2V26A 4EJVA 1YLYA 4IN9A 5TBMB 3F1OB 3QYFA 2FNAA 1WKMA 1S0WA 1YKDA 4PGGA 1F4KA 2VIXA 2J83A 3CUEA 1C3BA 2ZC4B 4B9OA 3HRSA 4I03A 3PUFA 5BNGA 3OPPA 2R5ZB 5CEDA 4C2TA 2ZFUA 3F1AA 1B4AA 4DF9A 4Y0TA 3H3UA 2L5QA 4N92A 1FOKA 4L9VA 4OMZA 3UVCA 5DCMA 2HQRA 1TBXA 5LRSA 5D5WB 2DA2A 1QVUA 3GUDA 1V5GA 4PUSA 1HOMA 4CZCA 1Y6IA 4CLCB 3SH8A 1ZAOA 3UO9A 4MNRA 2WOAA 2ESNA 4CCKA 1FIAA 4Q0HA 4U0TA 3L7WA 2O61A 4QKZA 1MSFC 2LDUA 1S3JA 2XAQA 4AIHA 2EX8A 3FHZA 2EV0A 3QAHA 1YSQA 4WF2A 2X1EA 2XR0A 1PWPA 4PFPA 4G9YA 2LLKA 4S2OA 1LDKB 1NJ4A 4O5VA 5IP6A 1ESUA 3CC4I 2COMA 2R0QC 1OTDA 2DAOA 4OMYA 1J7NA 2B5RA 2QYBA 4WLAA 1ERQA 4IHVA 2MC3A 3W2VA 1VQPI 4OKPA 3KEJA 2PFBA 1RKTA 2LC2A 4RDUA 2WB1A 1TS6A 4G94A 4BAYA 2EBIA 1K57A 3LNQA 5G4YA 3FXQA 3Q5FA 1TT5B 1IZ1A 3JRFA 1GA9A 2W57A 4A3MJ 3O2PE 3T1SA 2QWWA 4AIGA 5K5BA 3LR0A 2UV1A 2BHYA 2QYOA 4M3KA 5IY5H 4QD4A 4EJTA 1K0KA 3NQOA 3C4PA 3RJUA 1ZS0A 4N4NB 3HB2P 4Z1WA 5D1SA 3G71I 1XD7A 1OTBA 3H1CA 4AU7A 3G2ZA 5DCMB 1FYKA 1GCEA 2V0WA 4JF5A 4MHGA 4ENJA 4ZDOA 3OOPA 2L9SA 1DP3A 2Y2PA 3V3SA 3ISPA 2KOIA 4OQHA 3JTGA 2FBHA 2Y2LA 1U5TC 3MZYA 1G59A 5CTMA 3RTTA 3G30A 5F0HA 3OYJA 2J80A 1SRPA 1QVTA 1YLJA 1MBJA 1FTZA 4UHTA 3G6EI 4AXQA 3TEDA 1G9KA 3K7NA 4X1EA 5DTSA 3DAVA 3LJTA 2WUQA 4WZ5A 3LO7A 2JT6A 2MFZA 2P81A 5IPAA 2P04A 3O3VA 1YQSA 4DMZA 1Y4OA 3PBTA 1IAEA 3LGOA 4WZVA 5M3MJ 2R7SA 3TDUC 2VONA 3V67A 1MDMA 4BY7J 2EH3A 1BYWA 2K9SA 3H35A 1HFSA 3HTSB 3E4QA 4H2EA 1TP4A 1C7KA 3KFWX 4XM3A 4LK1F 3RYPA 4P0MA 2WZXA 2DQRA 1P9RA 1GKCA 1A0KA 1G2HA 1ROSA 4KZ9A 3GTQJ 2X02A 1N4OA 5F1GA 3L9FA 5CVJA 1QU3A 1JWVA 4QHCA 1I1IP 1JXSA 3WE3A 2O8KA 3J81K 4HF0A 1FT9A 3WV1A 3PUBA 1YE9A 1JIWP 3DEEA 3S22A 2RNJA 5B3SH 2H0YA 3LR3A 4U0VA 3ZGAB 1WJBA 1T38A 4E7HA 4R8HA 2C6YA 4HX4A 4W1UA 2CO5A 1XPBA 3OOVA 1U9NA 2HR3A 5JVTA 4M9XA 5KK1A 3CCLI 3RKXA 1B9MA 3R6SA 3NC8A 2ME6A 5HARA 1TDGA 2H1LA 4N9LA 3JRDA 3TVCA 2ZBBA 1XDSA 4GXOA 1UWNX 1MDMB 5GP9A 1A85A 4L6TA 3KYLA 4D5CA 1ZLJA 1BJAA 3MMHA 3ZVWA 4ZBEA 1OQYA 2WKEA 4YIRX 4BL2A 2DMTA 3UPOA 2QSHX 2PJTA 1H71P 2DDAA 2CC1A 2HFHA 3TG9A 1IAGA 1BM9A 5EZHA 2E1NA 1HCRA 3L1PA 3ZCOA 3BEBA 2HVQA 3C18A 2VE9A 2FJ1A 4QPRA 4E3IA 1ODVA 4KUOA 1OYIA 1MMPA 1UB9A 1YQAA 1A04A 2L4RA 3PR6A 1R6RA 2DMQA 3LIKA 2Y59A 3WGHA 4PGHA 5B1BH 4MQVA 4GKUA 2NS0A 2CFOA 4R79A 2EX6A 4GWMA 4A0YA 1JJ8C 2KISA 2ADUA 2KIFA 3RCOA 1TW2A 3F8BA 1NK3P 3E6BA 2P7CB 1JKYA 1FC3A 3BQZA 2ERPA 3HPGA 3FKWA 3LUQA 4Z2YA 5F83A 2WA0A 3VP1A 1YLZA 2BY3A 1TQMA 4DZJA 2QM3A 1HFCA 3A03A 3P9IA 4HNBA 3AGDA 1Z1DA 4Y13A 2VBWA 3PM1A 3UDFA 1BC7C 4YRVA 4BQNA 5M19A 2IEKA 1GKDA 1K4EA 3FV7A 3N2VA 4RGRA 5CZMA 4A3KJ 3V4GA 1Y93A 3E2KA 3HKZA 4U88A 5HLHA 1AOYA 2JSCA 1I50J 2B95A 3F8NA 1OTAA 1F9IA 1GE5A 2OV7A 1TT0A 2Z6CA 5FAQA 1WRJA 3TP0A 5L3EA 2LTPA 5GLDA 1G4DA 3MD2A 2QLZA 1OISA 2H6CA 2E3XA 4KITB 2CFXA 2DA1A 3HL9A 1BIWA 1MBGA 2ZMVA 4NBQA 1BA5A 1R1UA 2CUFA 4ILWD 3KP3A 3NRVA 3IH4A 5FSRA 3HOXJ 1BR2A 1D8KA 2V1NA 1W5DA 5J1UA 4IHSA 2PJPA 4G8XA 2RQPA 2R9WA 4B93A 2XGCA 2W1OA 1P0ZA 4KZAA 2HP5A 4FQGA 4NC6A 2JQ7A 3HDDA 5FQMA 4XXRA 2DMNA 5DF7A 2HGVA 2NOGA 3AYKA 2ZMEA 1LSWA 1G5UA 4RAZA 1D8MA 3PSIA 4B3AA 2IJLA 1CI9A 4XLPF 3VEPA 4EEFG 2GWRA 4IJAA 3UB9A 2ICWG 4OIRF 4CLCE 3W4QA 5HWTA 4AYKA 3O8GA 5HPFA 1U8BA 4ZYHA 5HNFA 2CUEA 2HDRA 1V5EA 3W6VA 1RZ4A 1FILA 1TC3C 1TD5A 2M0CA 1K79A 4XKWA 2P8TA 3WV3A 4CJNA 2L4MA 1VQ7I 4XT2A 5GL9A 3J7AY 4II7A 2G7UA 3CITA 2OPTA 1HOVA 4XN0A 5FQQA 1EA3A 3EDZA 1ERMA 3ZXSA 5E20A 4LLOB 4OAZA 3EDHA 3ZMDA 1MWUA 1FZPB 3F23A 4X6TA 3FX3A 4IVNA 2MZHA 4E6XA 4GW9A 2D2WA 1XDUA 1SKOA 1ZH5A 4LPZA 3NX7A 2VKHA 1Y8QB 5E17F 2GA1A 5TFQA 5HNHA 1SKFA 1FCOA 2VV6A 3OYEA 2W12A 1I5ZA 4F7ZA 1WZ2A 5J4YA 3T8RA 4YFXF 4S2LA 5EOOA 2VV8A 1BW6A 2JPBA 4F3QA 3E2LA 2R7WA 2IXSA 3I9V2 3VB2A 4WBGA 3E0JB 2AQFA 4KNYA 4P6ZS 4EWFA 2R7ZJ 1YX3A 1LE8A 3HREA 3CDIA 1GDTA 2I8DA 2JK3A 2L54A 2AYKA 1HTDA 2JIHA 3S8PA 3KYZA 2JRTA 1DU6A 5E18F 1BLSA 1MC0A 2ISYA 2FOWA 4LGWA 3GBOA 3I56I 1MMAA 1UHMA 2V0UA 4K0WA 2RCXA 1Z7LA 4XT2B 2W48A 3TT4A 1W5SA 4PDKA 4PHTA 4PJ0C 4CZZA 4XNFA 2QKMB 5M18A 2JKTM 4XM6A 3BLMA 3ZVSA 5GPCA 3LIBA 1GVDA 1I39A 2HXOA 1R00A 4EQ1A 2W4SA 1K55A 3DF8A 3WHCA 1RKWA 2OZRA 1ZQ3P 2LK2A 5EVIC 4QJGA 1SKOB 4C9YA 2L7KA 1J75A 5FLMJ 1XGOA 3LSJA 3CO6C 4ETXA 1QPMA 1S6RA 2EFXA 3JCUC 5KHDA 2X3CA 2E60A 4ON1A 2XA7M 5DJUA 2E19A 1POGA 1ONGA 4DGWB 2CS3A 2XD5A 4HH3A 4IBXA 4JPAA 4L7AA 1B3DA 2A6HF 4M3FA 4V2FA 4BMWA 2B9SA 1ZK8A 2VGJA 5HS8A 1JKRC 2XSDC 4RB3C 3ECHA 2K9LA 1LE8B 1Z3YA 3ABKH 3BR1A 4JA1A 1B72A 5AIQA 3F8FA 1ZRDA 4FHTA 5GPAA 2K3PA 3E4OA 5L07A 1Y0VA 3TSKA 5D6EA 4UY8I 4HV5A 5F69A 5CHMA 1HKQA 2BY2A 3Q2HA 3EUAA 1R1TA 4HG2A 2QQAA 2JPCA 3CDLA 1L3LA 3EETA 5D5XB 3GMEA 2AQEA 3J81Z 1O57A 4MLOA 1A36A 3MS6A 4HRIA 2HDUA 4YNRA 3C2HA 2JA8J 1D06A 1K38A 4QSHA 2PMUA 2L0RA 1K78A 2XSSA 4RLQA 3O8HA 5I3MA 1LL9A 1YX5A 2GOMA 2GX5A 3CP2A 1LVAA 3I71A 4WEKA 3LGPA 5CEBA 1KE3A 4UXNA 5K7ZA 4E7LA 1LI9A 4L0YB 3MXQA 2O3FA 3LQRA 4KICA 2O99A 1LI0A 4BD0A 3K10A 1JJ6C 4BJTA 2Q1ZB 4X25A 3E97A 1OT6A 4XLFA 3WS5A 3F8CA 5A2QK 2WV1A 2EILH 3U1DA 4JKTA 5EDNA 1ZG6A 4C6YA 1PNEA 3CJNA 1F1ZA 2PR6A 4I98B 4DJ3A 2M87A 3NWTA 2WY8Q 1XN7A 2GIZA 3UB5P 1E3UA 1R71A 2J0TA 1PP8F 2QQBA 3BG5A 1B72B 4CHUA 4BNCA 5CERA 1HSJA 3O88A 4KQRA 2H27A 5D7WA 1CF0A 1QMEA 2E7WA 2V7FA 2K9MA 2M34A 2NVUB 3JREA 4ENKA 3DPEA 4XSXF 5F6FA 2VBXA 2BGCA 2DJNA 3CZDA 2N8RA 3D3OA 1PYYA 3ABTA 3P1VA 1YOUA 5AQ7A 5BPDA 1WYBA 4O7DA 2J3WA 2LB5A 5EZGA 3VSKA 1K78B 1XFXA 1O07A 1FLIA 1E4DA 2OLVA 3UN7A 1SVLA 3MR0A 1A31A 3ZQCA 4F94A 1YIJI 4GFBA 1JANA 2WC2A 3EOIA 1MMRA 2W14A 1IV6A 2CU7A 4DIQA 4WXDA 3ZG9B 2IS2A 3HVFA 1WJFA 3RPUD 3G5CA 3G4PA 3AYUA 4G7OF 2W00A 1NRFA 1V5FA 3ZQFA 5GHYA 2GM4A 2HYJA 4FUWA 4S2MA 4D2OA 4BACA 4ITVA 1MXOA 3S1QJ 4YFNF 4H0EA 3AG4H 4JYKA 1KUFA 2A2LA 2PJRA 1V3FA 2XPUA 2G9WA 2HYFA 2A07F 4RX2A 3KEOA 2FE3A 4EEUA 1LL8A 3IHUA 3HTUA 3AIGA 2HS5A 1R5GA 4LK0F 2PQ8A 4XONA 3JRBA 4Q0JA 2V2FF 3HGYA 4GGGA 1EAKA 1RR8C 1JTGA 1H0MA 2R7TA 1Z09A 4YFKF 2ID3A 2D01A 3UY6A 4GYIA 4IXAA 5DD4A 3NWSA 3GO5A 4PJLA 3FM5A 1Z21A 3HSFA 4DBQA 1PWDA 456CA 1GT0C 3ZCZA 4HBTA 1BZSA 4KZ5A 2O9AA 2Z3YA 4AVPA 5I94A 3FWLA 2X51A 3S7NA 1YJWI 1ZR4A 3LR5A 1OJ5A 4O3MA 3DFGA 1LL5A 5D1UA 3BRMA 2VGLM 4CYDA 3S2DJ 5M5YJ 3GDIA 4OIQF 5I43A 4MN7A 1NRJA 2W27A 1DJCA 5E79C 1IG7A 1BC8C 2WO9A 4BQOA 1XX2A 3AAFA 5B1AH 5LLQA 1GO7P 3A0SA 4U0XA 1D5YA 3E6MA 2ZQ8A 4PKTA 3IX8A 3K6GA 3RKYA 2VBZA 3GTOJ 1UTZA 2PJRB 3PHYA 2EZHA 3HXLA 1V9YA 3CZ6A 4EBLA 1P2FA 1DPRA 3DBRB 3LY4A 1TNSA 1ZXVA 1OCRH 2YU3A 4G7HF 1W79A 1WVRA 1LDDA 4JP4A 3OMYA 3IRRA 4A3IJ 1BI3A 1VQ8I 3VP2A 1MNDA 3KP7A 2CMPA 4MTEA 1QMFA 3B42A 5HD3A 3EHXA 1OS2A 4BBRJ 2XAGA 3E6DA 4MDZA 1DGRM 1CAQA 5FDHA 3WG7H 1RUNA 2J5OA 2HI3A 3E8RA 3OS0A 3I4MJ 4NUBA 2WGIA 1ENHA 1UCRA 1JIZA 3PTEA 3G6OA 1JUSA 2W0DA 3DV8A 2EINH 3WE2A 4XRSA 1REPC 3QP5A 2A3SA 4TV7A 4H3XA 1OMIA 3OZHA 4WMCD 1YJ9I 1YPRA 2QEXI 5I2ZA 1EJ9A 2V8CA 3P09A 3TL4X 3GTKJ 4I09A 4XIDA 3IHAA 4Y15A 2KZGA 3MZFA 4KQOA 3UR3C 1D8JA 1S5LC 3LFKA 3LIDA 3F16A 2VV7A 2WZZA 2R7DA 2VX8A 3A3DA 1YW9A 4BYYA 5CVVA 1KU3A 4ZJ3A 3BJ6A 2VXDA 1XB4A 4UQIM 4OPZA 3PIPF 3BFGA 2K86A 5BOTA 4D0PA 2EIKH 1W8QA 3GEZA 2ZSHB 3O3KA 3Q3SA 5DVAA 5AQAA 2HJ9C 3ZN0A 2L4AA 3R60A 4ZYAA 3ICYA 3PQKA 1PVEA 4I0AA 1QZZA 3WTYC 5ILSA 3CUQB 4F93B 2DK8A 3M8FA 2HJEA 5DF9A 1IKIA 1SEUA 5FASA 3MQ0A 4O01A 1R54A 2ZL1A 2DW1A 4IOAF 1KGEA 5ICEA 1XG1A 2OZUA 2E5ZA 4WN5A 3UPPA 5JFRA 3C1DA 1D0XA 2XAUA 3HUNA 1KUGA 1YFHA 1O3QA 4PKYG 1H8ZA 2R7VA 2DI3A 3W4PA 1XA7A 5IYDJ 4GRIA 5EV0A 2KRCA 1XGSA 2V79A 4FETA 1UAAA 3OY9A 4XMYA 5FFXA 3SFZA 1IRZA 4CCOA 1ZGWA 2HPIA 4RB0A 1IABA 3B8ZA 4J00A 2DW4A 3T0YA 4BLMA 2OA4A 5H6QA 2XF7A 2Y2IA 1OPCA 3MKWB 1NLZA 1T95A 2AS5F 3BPXA 3TE8A 5HX9A 2JNPA 3SZGA 4BBTA 2DA3A 3F0CA 2JKTI 3VOLA 3BQAA 3TW8A 5U47A 1UMQA 3Q0VA 1KU9A 3HLWA 1FSEA 2ZXJA 3DSLA 1SLNA 2HNHA 4AYBA 2HDWA 1LHYA 4MFEA 2P5KA 4NXGA 2F5VA 5B5EC 2XLNA 1YAXA 2R7FA 3OC2A 3MKZA 2BE5F 5C5KA 1X1CA 1SD5A 2OF7A 1TWHJ 3BJOA 2X0LA 2LY1A 3OWTA 4HH2A 3ITAA 3QRFF 2K5CA 2R7RA 2CRGA 3ZVTA 2ZL1B 3R4KA 4IEDA 3TOAA 1F5TA 5JYOA 2P08A 1Q2PA 3K1PA 4E4HA 2MH2A 3WTVC 3QOPA 3UE0A 3A0RA 1TS8A 3RPQA 3HJIA 2KFDA 1K4SA 5A91A 2ELHA 1PZPA 1ETYA 2OBPA 3A3FA 3IP4B 4JK1X 3GRJA 4M6YA 2PBYA 4GN2A 3F19A 1G3TA 2AIGP 3SW1A 4NNJA 1JGSA 4AIDA 4U0YA 4RB2C 3C4OA 3N2UA 4DKIA 3KSIA 4Z6YA 3EPZA 4EM0B 3BPVA 1CEFA 2W1TA 2HQAA 1XCBA 4YIIA 3SDBA 2PEXA 4HQMA 1L0FA 4BE2A 4JQGA 4XR6A 4XM7A 4RAYA 1RCJA 5DTKA 2ZMAA 3ZG7B 2IVMA 2HVRA 3DEWA 2Z5UA 4HP9A 1AWCA 4CH7A 3VFHA 5IYCJ 2O9CA 3ZNYA 2Z99A 4HJ4A 2GBYA 3BT9A 3OYLA 2ZMEC 1R23A 1E17A 1UTTA 2Z2SB 4GUYA 1FSHA 2HU9A 3H9GA 1K54C 3W2AA 5JLXA 2QPNA 1XC5A 2PYRA 4L5JA 4HAMA 4P5OA 3DBHB 3W6JB 3BR3A 1CK7A 4LLNA 5GHXA 1U60A 1BJZA 2XFSA 1EI5A 1CXVA 3FMQA 2M9HA 2ZOIA 4K2EA 2PD7A 3UPNA 4BH9A 1LDJA 1XX5A 5J40A 4S2JA 1G68A 3DTIA 2LYCA 1GXDA 5GTHC 2Z2DA 3OCLA 5FJ8J 3F6OA 4J19A 3LA3A 3G1OA 4IX7A 2CQKA 2D1HA 1VHMA 2J7VA 1ZVXA 1RI7A 3B33A 1XSDA 3BROA 3K3CA 1ETVA 4C2UA 3E7LA 4PJJA 1MJAA 2OXWA 2OZ6A 2Y75A 2V6EA 3LIEA 5GHZA 3OV8A 2G0EA 5IS1A 3S17J 1WHUA 2W1TB 3CCJI 4HF1A 3VYTB 2JKRM 1SU3A 1OT9A 3BW6A 4I3JA 2GIVA 2OLUA 3PBOA 3FDYA 2P5VA 4PM5A 1FWZA 1OCZH 2OTJI 2VKSA 3DLAA 4ZTKA 2JKFA 4A5NA 3U21A 1ACIA 4RMNA 2R78A 5HSQA 3HOTA 2MC4A 1JUMA 2PT7A 2PHYA 1K7IA 3ABMH 2CSOA 4XOPA 3TO6A 3FYZA 3L00A 3FC7A 3GTCA 4L5IA 3EQUA 3UNWA 4D9JA 1H9GA 4OPRA 4RGXA 2HF6A 4CQHA 2M8GX 4MBHA 5JHFA 4H49A 1Y56A 2C5WB 4KUMA 2POJA 2Q9NA 3LICA 4IZZA 1P92A 5FKNA 2FNPA 5ILUA 1VQ4I 4X1LA 4FD8A 2EX2A 3MWMA 4IOCF 2X71A 2YSRA 3HEFA 1YMSA 2XRLA 5M5XJ 4B47A 3PBSA 3N97A 3FPVA 1VF9A 2LREA 4L18B 4EJWA 5BS6A 2LF8A 2WY7Q 3LL7A 3SEZA 3VPRA 5J3LA 2O0YA 1TDLA 2VB6A 4G0DA 4JX5A 2IAIA 4CCJA 2H1KA 5DTTA 3DTMA 5D4SA 4NB5A 3OYIA 3T4OA 3M6HA 4XK4A 1AKHA 4ZC3A 1WYCA 2KKOA 3BQ8A 3JSOA 2R9XA 4XKVA 2P6TA 1LPQA 3DPUA 3S93A 2HZ5A 3FK7A 3G42A 1D1CA 2JA2A 3P5JA 2DJIA 1BUVM 1OM6A 1T2KA 3OYMA 4NDLA 2P9VA 4PJMA 3D5LA 1GE6A 1FR6A 3MMYB 1KUKA 5CECA 1T0FC 3PIOF 4XLCA 3VODA 1DTHA 4PK4A 1SFOJ 1LFUP 2B0LA 3MZ8A 2XGNA 5LBQA 2EFNA 1IEMA 2R7OA 3MN2A 4S2NA 3HBRA 1O7EA 2R3SA 5IT9K 5EF6A 5FI6A 4ZJZA 4NQWA 4RM3A 3REOA 2ZMFA 4G6QA 2R4GA 2Z9OA 4KDPA 4UVAA 1K6OA 3A0HC 3AL0C 3S14J 2Y6DA 1NZOA 2CV2A 2OI0A 1C8TA 3ML6A 5CX7A 2DNSA 3ASOH 4IRGA 3T4SA 2OC6A 3BG6A 2L7ZA 2W85A 4OINF 5E43A 2ZM0A 5HLGA 3ZMSA 2GAUA 4OWRB 1MNEA 3GFMA 4DDSA 1AKHB 1XMKA 1JHFA 1JI8A 1M1EB 1K56D 3OSGA 1VQOI 2LFBA 5IT3A 2HVSA 3SS5A 1MZUA 3WWXA 5E2GA 4GDFA 4PFOA 2KDOA 1PYVA 2VGLS 3S7PA 4UVBA 3ASNH 3H5NA 4XKCA 2PX9A 2I72A 3ZUKA 4ESFA 2Y30A 3G1LA 5KVRA 2ZC7A 1BSGA 3AKZA 2RVCA 2NUTC 5F08A 4A3GJ 3NIAA 1IO2A 1XGNA 3SOIA 1D3YA 4P9FA 4KIFA 4E3LA 3IWOA 4IHWA 3ZGKA 3FKIJ 1FEXA 4N9IA 3LYXA 2UWXA 3K7AJ 3BJAA 1N9NA 3FKVA 2HTSA 2GXBA 4IQJA 4ENMA 3R0AA 1HDDC 5L3DA 2ZXHA 4NQWB 1VQ6I 2MH9A 1G3SA 4RS8A 2VA0A 2OW0A 2CKIA 3H9QA 1TQIA 4HIAA 2V9PA 3CMMA 3BG3A 1ZXCA 4IBRA 2DQLA 3VOYA 2FX0A 4PKSA 4WZ4A 2ISZA 3CLQA 4JGRA 1Y8RB 1I6HJ 3KEQA 4I99C 2J9OA 2JHEA 3E4PA 4U3TA 2KL4A 1IAWA 5L10A 3N8SA 4OOIA 4K08A 5LGNA 2N8GA 2YU9J 2D45A 2XPVA 3EUHA 3FZCA 3VI1A 5CHJA 1TS0A 1OFCX 3OYNA 1Z6TA 4Y4RA 2EWNA 1IUFA 3EEAA 3RTRA 1YQYA 5CQEA 4W97A 4OH0A 3LWFA 1WJAA 2OAP1 1T98A 4BL3A 4ANJA 3BCBA 3JAMK 3LKAA 3V8LA 3TGNA 4V2GA 3IWFA 4A5MA 5BOXA 4I5SA 1NH3A 2A68F 5B66C 1JAPA 2VZWA 4WM9A 4DZPA 1AA7A 1U2WA 1ULYA 4EVIA 1EF4A 3OIPA 2Y79A 3E5XA 2HOTA 1R49A 4Y5FA 3IKTA 4UQIS 2L2OA 3S1MJ 1WSUA 2W3DA 4KIBA 2HGCA 1IACA 4A3CJ 3EQLF 4LLLA 1WH5A 1ORKA 1DP7P 1MKMA 1YW7A 2GZWA 3IF6A 2WB1N 1T18A 3J7YJ 3CJMA 2QGUA 1S4RA 3GSGA 3BWGA 2K85A 3OBFA 1UWPX 3RQ4A 1D1BA 4N0BA 2DMUA 2DPUA 2M7AA 4R1GA 5E2HA 1XMAA 1J5YA 4NG2A 1FBLA 2WKIA 2EK5A 3K4KA 1T6SA 1NWZA 4UA9A 1DQUA 4B48A 4OU0A 4EXOA 2KQRA 4PM7A 2CQXA 1HDPA 1B8IA 3QNBA 2HYGD 5FRMA 2EFOA 1U0JA 2PU4A 5EYRA 1GLNA 3MAJA 4EW7A 4A6EA 5L3CA 5J4EA 3KLOA 1W5TA 1OMJA 1X1PA 4EM1A 3MZHA 5CGSA 3OR1C 1AF0A 5I4OA 3ZN1A 2OXUA 2DFFA 1WH7A 1XSVA 5FEGA 2XAJA 4H82A 3T4TA 2NOJB 3DL1A 2B02A 3Q9SA 1U78A 2Y2QA 2VT3A 1JJ9A 3FZVA 4LG3A 2EWWA 1QA6A 4HZFA 1TWAJ 2M5WA 2Y0SA 1IN8A 4ON0A 3HHGA 3IF6B 1S4SA 1D0YA 2XAFA 1W7FA 2WV0A 5HLTA 3LEQA 3FMRA 2XH9A 3IWIA 5E3LA 3HDBA 3GTPJ 2L7MP 1IDZA 1WCMJ 4LJZF 4ZZLA 1PI5A 1R4NB 2OAQ1 3KX0X 2K4JA 3RPUA 1JE8A 4WEJA 3K4BA 3QNCA 4WYYA 1I5QA 1IW7F 1UFMA 3GYHX 4I6ZA 2GZAA 1SMTA 1WNIA 4O0PA 4M3EA 4CICA 3FXOA 5FRNA 3CCUI 1B8IB 2DDBA 5HDNA 2JVHA 2AHQA 2CUZA 1SMYF 1S6LA 1ZTRA 1L0OC 3VOEA 4RVAA 1T39A 1I76A 1BZAA 5HW3A 5D1TA 3RTSA 4WK7A 1FMVA 1VQ9I 1BQQM 2ZNYA 1ZREA 3DPFA 4HQAA 4M3GA 1E3PA 1PFLA 1P4AA 1CF7A 2JKRI 3IX4A 1B9NA 2EIMH 2JC7A 5KIZA 3NEUA 1UG0A 4UV8A 5FFZA 4MNUA 3CKIA 1OYWA 2NVQJ 1M6KA 5FGMA 4JGPA 1HC8A 4ETZA 4CCLA 1ITYA 4R3VA 2OW2A 1BSWA 3OYFA 4BDYA 2J5PA 1EH6A 5L2FA 2PN6A 4LOCA 5J4VA 2DMWA 4IO9F 3M1EA 3JSPA 2DBBA 1DMTA 1GUUA 4U87A 3EDPA 3W6KB 5DKLA 3DWZA 1UHWA 1TVIA 2ID6A 5DF8A 2ZQ9A 2JA5J 2MABA 2XDMA 3QP6A 3CTAA 4ESBA 4AIKA 5HDCA 2DFHA 2OQGA 3BTJA 3IBJA 1MMSA 5HL1A 1OR7C 1LFBA 1P9QC 1WA9A 1W63M 4EBNA 4DN0A 4JX6A 1YITI 3WTWC 1ZR2A 5IT9Z 3EDIA 1SFKA 3JTHA 1F9NA 1XCVA 4QTRA 1D5JA 5FAOA 1QPIA 3M9AA 3G34A 4I39A 3PXPA 2LVSA 2YIGA 1P97A 4Q4ZF 3OL4A 5TBMA 2AO9A 4I35A 5H20A 4FU4A 3OL3A 4CTHA 2KRHA 1J9MA 3NOPC 4AIJA 2UXXA 3OIQA 5C44J 4M3BA 3KMCA 1XAXA 4OOMA 3L2QA 2F4IA 1FPQA 3X2QH 5D3CA 5B5PA 1NY0A 3WODF 5HLIA 3HLBA 1Y8JA 3VOZA 2GOXB 3OPLA 1OCTC 1MSEC 4BXFA 3BFEA 4WMCA 2PMHA 3FPWA 4Y7NJ 4R3JA 3I7IA 1MBLA 4UA6A 1CQAA 4G6TB 3HKZN 3FXMA 3WTSC 3H36A 1EW0A 1H89C 1JK3A 1QUAA 2FOKA 1RGYA 966CA 3QYBA 4UUVA 2HTJA 4PKQA 2HU6A 1XSXA 2V1UA 2MLGA 3LQQA 1MW7A 3TJZC 3QOEA 3OPRA 4M73A 2V20A 4Q48A 2BEOA 5DTDA 4FISA 1XFNA 5EGOA 2VL8A 1Z3XA 2X4HA 4ZYEA 4GHIA 1F5MA 2E1MC 3T5XA 5D8KB 4GOGA 5E1WA 5F5YA 3LA7A 5HWVA 3BWLA 3CF2A 2IS4A 3I53A 4OIPF 3USNA 4IRHA 2WK0A 2EFWA 2KP6A 2BV6A 2JVGA 4EESA 2IT0A 4NK3A 2IA1A 3RFBA 5MC7A 1DY6A 2JT5A 5C3EJ 2K40A 1Z91A 4HLXA 1ES4A 4M9SA 4BBVA 5D5VB 4ZH4F 1ES3A 2FV9A 1R22A 1NLYA 3IL2A 3W3CA 1WJ5A 5DDGA 2OU2A 1HSTA 1OYYA 2HZTA 3JRIA 4M74A 2JN7A 1WJCA 2Y31A 3RZOJ 3BM6A 3V96B 2X6WA 5HZHA 2GJ3A 4GS9A 1GHIA 1G49A 4F52A 2F4MB 4JLFA 1RETA 4H30A 1YSPA 2F4OB 2LY2A 5K1YA 3JAMZ 4LV3A 1O3RA 4HNTA 5CVIA 4G3VA 4OPQA 4CDGA 3LUMA 4RB1A 1K7GA 1D1AA 2XF3A 2MD0A 4WCGA 5EGOB 5L09A 4GHIB 1HZOA 1AXBA 2RKHA 4GB7A 1G12A 2BXYA 2E7XA 1GV2A 2H94A 4DJ2A 3FHNA 3SZTA 3WHBA 4XSZF 4GYGA 4PM6A 4WXCA 2CUJA 1XJ4A 1OM8A 2E2DA 4MIMA 3TKYA 5J1RA 2ZLYA 1H8AC 1CQRA 1X4OA 1KGGA 4WELA 1HBXG 2TCTA 3HLGA 3RIRA 5GAGJ 3LSRA 3BR6A 3E0YA 1XFZA 5DFXA 1GXPA 1FM1A 4R3BA 2EXAA 2L7FP 2QBYB 3BG7A 1Z0XA 3ISGA 3ULQB 3GCMA 3H7WB 3Q7ZA 1IAAA 1ESIA 4S2KA 1OKRA 4DE0A 1YHQI 1YLFA 3K70C 1YS7A 4GS9B 4GDNA 2V1DA 4HOIA 1PUEE 3A2KA 2ERQA 2TDXA 1C0WA 4M71A 2W3HA 2ZM8A 2LD5A 1EROA 5BOHA 3HG9A 3HCYA 4F55A 4A7BA 3U9GA 3KP2A 4ENNA 2WO8A 4CCMA 1IN6A 3F17A 1Y28A 3PNYA 1K6YA 4H76A 3ITBA 4G12A 2E71A 1S9HA 3T50A 2XGDA 4KMFA 3I0TA 2VXZA 3L9KA 1ETQA 2EZKA 3VP4A 3OYCA 3LY3A 3RZDJ 2M2EA 1YS6A 2FUG2 2I10A 5K5OA 1LQ1A 4HV6A 4CCNA 1W7PD 3CESA 3I59B 3R0JA 3VWBA 1HW2A 1W63Q 2QQ9A 3S4XA 2YKFA 2O9LA 1JVJA 3DEUA 4RAFA 1GSWA 3V39A 4BHCA 4PKUA 2QJ5A 3WGIA 3DU5A 1WJDA 2Q2EA 3ULFA 1X1AA 1X58A 1VEUA 2EZIA 4E70A 3I4NJ 4BQQA 3W2WA 5E3OA 1Q2QA 2XS4A 2P7JA 1K4TA 3ZMTA 2K2NA 2Y2HA 5FKLA 3CI6A 3GR2A 1Y1WJ 2XK1A 2KX6A 4AFIA 3D1NI 3JRGA 1PWVA 3OYKA 3J80Z 1VNDA 3WS4A 3WRTA 1X2NA 2V6CA 2P74A 4ETSA 4OQ0A 2FEZA 1U5TB 3Q07A 1BI0A 5J1YA 3U1RA 5BPAA 1D7XA 4A3DJ 2TCLA 3F22A 1IRGA 1XA1A 5E2FA 5E8GA 3QWLA 1RPWA 5EOEA 4QPOA 3MBZA 1GSVA 1T19A 1EH8A 3C7JA 1SCWA 2Y91A 5A92A 2M4GA 3IXHA 4JBAA 3IKVA 1KAPP 4QIWN 1EB6A 4BDZA 1PW1A 2OW1A 1QRYA 1WPKA 2W15A 2ZQ7A 1G8XA 3H5AA 3T4KA 3BOQA 4HJ6A 4B1RA 1VQNI 2LY9A 5EVLA 5KZHA 3CPTB 4CO8A 2M8EA 2Q2EB 1VEUB 3WTZA 1X2MA 1OTIA 4Q8IA 3PL8A 3L0VA 1VQLI 3DLLF 4XL9A 1PRQA 4NEED 3WV2A 2M7VA 5M3FJ 4EQIA 4BJ6C 1OLTA 3CHWP 1LKXA 3HL2A 2V9AA 2QPJA 1YLTA 1VB6A 2R5YA 1MGTA 3S3OA 1FYMA 3C2BA 1ETXA 4OQIA 2LKXA 1PDNC 4H4KC 4WUJA 3NJAA 4KG2A 5J8XA 2VOOA 1ON1A 4FE7A 3TS4A 5FB2A 3T1BA 1Q1HA 3ONQA 4XRFA 3I4PA 2P5LC 3TBIA 2YR2A 2MLKA 2VQGA 4H6JA 2NNNA 3SS4A 3DWKA 4XOTA 4L9FA 3HUMA 2EFUA 2HDCA 3ABUA 2ZB9A 5EUAA 3OR2C 3PNVA 3HRUA 3E1SA 2VODA 2IGNA 4XBFA 3BR5A 5FQIA 4MEXF 4N9KA 1G6OA 1JWPA 2VC0A 3OYAA 3QPSA 2XB0X 1FOWA 3IV5A 2FMYA 3O87A 4LB6B 3V50A 4IRIA 1NHAA 3N8LA 4WF6A 3CMZA 3N4MA 4B4XA 3ZG5A 1QBJA 4XCTA 4QY6A 4IVKA 2IGMA 4BHPA 3OYBA 1TTYA 1YTYA 4YWZA 4EBPA 5J8CA 2IPQX 2A6TA 1GHCA 1CJFA 2JKGA 3ERMA 1N9BA 1KU2A 3DPLC 3KIOA 2LP0A 3WU0A 1MKIA 3DBAA 4OOYA 1MBKA 2R5YB 1R4MB 3O6BB 2NVTJ 2ELJA 2OXZA 4S05A 3LMMA 4BENA 2STWA 1QJIA 3BLYA 3GZNB 4LV1A 1H8YA 1MBEA 3LA2A 4Y33A 1IV8A 1VTNC 5FAPA 4HESA 1BKCI 4H6JB 3TRCA 2KJBA 1ES2A 5KMWA
chains in the Genus database with same CATH topology
2DT7B 1Z3YA 1CXVA 5LD2C 1WJEA 1OO9A 3EHYA 3EUKL 4E7KA 3WV3A 3DPTA 1L6JA 1EUBA 3E8RA 4R3VA 1JKYA 4XN3A 4JA1A 3A2KA 2K9CA 3OS0A 2OW2A 1A86A 1BSWA 2ERQA 2KPMA 4NUBA 3OYFA 4BDYA 2ERPA 3HDAP 3HPGA 1XFUA 4QKZA 3FBNB 2JSPA 2K3PA 1JIZA 4A3WA 2OW0A 2CKIA 3DTIA 2F6CA 4II3A 3ZRGA 1XURA 2LBFA 2WA0A 3HG9A 3H9QA 1Y0VA 1E0EA 3TSKA 3F9KA 2LYCA 2A8HA 5I0LA 3Q2HA 1GXDA 4F55A 2JSDA 4A7BA 1R1JA 2W0DA 2X1EA 1PWPA 1DMTA 3EUAA 5TGTA 2VJ5A 2RJPA 2Z2DA 2M4KA 4U87A 4CCMA 3CMMA 1HFCA 4HG2A 2WO8A 2BW3A 1K7QA 4PFPA 1ZXCA 3PNYA 3F17A 1JAOA 1MMQA 1USNA 3EWJA 2W13A 1YCMA 4IX7A 4PKSA 1QHGA 1K6YA 4BQNA 4YRVA 4H76A 1LDKB 3PJRA 2VQLA 2W82A 1S9HA 3B2ZA 3LK8A 2MABA 1GKDA 1XUDA 3N2VA 3VSLA 1FMWA 2OVZA 4FXYP 4HSTA 2IS1A 2VXZA 5CZMA 1AKLA 2AQEA 4H3XA 1ZVXA 5CUHA 2KLOA 3LSMA 1JH1A 1Y93A 1J7NA 4MLOA 4LIUA 4DBRA 3SEQA 3DTEA 1UMTA 3DKXA 4AVZA 3OYCA 2MZEA 3K7LA 3HKZA 3SHIA 2VJJA 2KL4A 1R1IA 4C2UA 4HRIA 2KRJA 2XDVA 4PJJA 3C2HA 3W2VA 3KEJA 4PSWA 2OXWA 3UNGC 3VDXA 3OHOA 2FUG2 3S3NA 5I2ZA 2LC2A 4BL0B 1OR7C 1AYKA 3L2WA 1P9QC 2V6EA 1GE5A 2WB1A 4CCNA 2XF5A 2OV7A 5BOYA 2L0RA 1Z3JA 3CESA 2HZDA 4RLQA 3TL4X 3VWBA 1TT0A 2DW2A 1D0ZA 3HOSA 5I3MA 3EDIA 4PKRA 1YX5A 1SFKA 3FKJA 3VYTB 2GOMA 2KHMA 1SU3A 2LRDA 5D2BA 3VI1A 2UUZA 3LJZA 2XSJC 3UR3C 3CP2A 4H84A 1QHHD 3MD2A 1D5JA 1XUCA 4DPEA 4PKUA 3LGPA 4DD8A 4GF1A 3H5RA 4AIGA 3FDYA 2PMZA 1O0TA 3OYNA 2UV1A 4WKEA 2BVLA 3DU5A 2KZVA 3F16A 4B44A 4E7LA 4Y4RA 2YIGA 1WJDA 2DDFA 2E3XA 4KITB 3OL4A 2X7MA 1IRXA 1X1AA 5B5OA 1KUIA 1BIWA 4I35A 4PJNA 4LIVA 3OOUA 4HPQA 4HSRA 3RTRA 3K10A 4ZDPA 3L2VA 1YQYA 4ILWD 5CQEA 4L19A 4BJTA 4FU4A 4BQQA 3DLAA 2VQCA 1BR4A 3OL3A 4FASD 3W2WA 1WJAA 2Q1ZB 4N4NB 1ZS0A 2WAEA 3ELMA 3HB2P 2VJIA 2OVXA 4GR8A 3U21A 2KRHA 5D1SA 1SLMA 1BR2A 1NG6A 2VXDA 2P0WA 3PFYA 2V1NA 3PSFA 4RMNA 2MYSA 4JOMA 3OIQA 4AU7A 2VPLA 4XBHA 3IAS2 2X85A 3SYTA 4GQLA 4XLFA 2VASA 1PWQA 2R7QA 4ANJA 3BCBA 3HOTA 2MC4A 1G05A 5BOTA 3LKAA 2XS4A 1K7IA 2IS6A 3KMCA 4ZR5A 4XOPA 3L2QA 3D5RC 1X19A 2F4IA 4F91B 3L2RA 4GWNA 1LFPA 2ZSHB 4ZDOA 3IUOA 2L9SA 1JAPA 3DTKA 3H0DA 2W1OA 1DP3A 5LFAA 3LSKA 1GO8P 2SRTA 2RREA 1S4BP 4D9JA 3NWTA 2WY8Q 1AA7A 3M1CA 4ZYAA 2WAQA 1PWVA 5D3CA 3OYKA 5JHFA 1HA8A 4H49A 2J0TA 4HEA2 5B5PA 3L0TA 1Y56A 2CW8A 4HMAA 1G59A 3OIPA 4PKVA 3RTTA 3KX2A 3OYJA 3AYKA 5H8XA 2POJA 3DU6A 2L2OA 1SRPA 1Y8JA 2LBFB 3HY7A 4IZZA 3U1RA 4F93B 5BPAA 5D7WA 2DOAA 4BUPA 2GOXB 1D7XA 1D8MA 2I47A 3PSIA 4BJ5C 4AXQA 3V42A 4BXFA 2V7FA 4CUGA 1G9KA 2TCLA 3F15A 1IACA 4BEHA 4IJOA 3K7NA 4JQFA 2K9MA 1R54A 1W36D 2CV1A 2BW3B 3DPEA 4G9LA 4DV8A 1RMZA 2DW1A 3LJTA 1ATLA 1MMGA 1OM7A 2HPMA 1QJJA 3I7IA 4QPOA 4G6TB 1SMPA 3I7GA 2JT6A 2V4JC 2MFZA 1MNCA 3DKYA 2N8RA 1R1HA 3KHIA 4ZTFA 4AYKA 1ERDA 1JK3A 1QUAA 4GR3A 1G4KA 2E5ZA 3P1VA 4B47A 1YOUA 2OW9A 1BOBA 5KNLA 5JMYA 2M4GA 1J09A 2LREA 1X1DA 966CA 5HNFA 4NC7A 3QYBA 1ZP5A 1V5EA 3CJRB 1IAEA 1CGEA 4HX3A 1D0XA 3CJQB 4PKQA 5HOOA 2XAUA 2HU6A 1KUGA 3LQ0A 4XLHA 1KAPP 3P24A 1N77A 2WY7Q 3RQ4A 3LL7A 1D1BA 2CW7A 3SEZA 2R7VA 1BKCE 4WZVA 4XKWA 3K70D 2R7SA 1EB6A 2IGOA 4X0GA 3VSKA 2LOOA 2M7AA 3EUHC 4GRIA 2KRCA 4BDZA 1XFXA 1MW7A 2OW1A 5CQGA 2VB6A 2USNA 1FBLA 3OYDA 1KUHA 3QOEA 2W15A 4E7IA 3TMOA 4ZDLA 4FETA 2M0MA 1UAAA 2L9NA 3J7AY 4B3XA 4G0DA 2V9KA 1G8XA 3OY9A 3H5AA 3K4KA 4XMYA 3H35A 4EATA 2K2GA 4L63A 1HFSA 3KRYA 4CCJA 3I3LA 1JANA 2VL8A 1Z3XA 1DQUA 4H2EA 4CCOA 4B48A 4KT6A 2HPIA 4CSWA 1BUDA 2KQRA 4PSXA 1IABA 2VLAA 4KJZA 2E1MC 4U7BA 1MMRA 2W14A 3B8ZA 3OYIA 1HOVA 1C7KA 4XN0A 4J00A 1EA3A 4XM3A 2CLTA 3EDZA 4DIQA 1N78A 2Q2EB 4E6KG 3ZXSA 4OAYA 4XQFA 2IS2A 3CF2A 2E1MB 1WJFA 4OAZA 2LH9A 3RPUD 2CV0A 4BE1A 2IS4A 1ASTA 1X1BA 4ZC3A 1QICA 3EDHA 3G5CA 3USNA 2X3BA 5FRMA 4XORA 2Y6CA 1GKCA 4XKVA 3AYUA 3PL8A 1PWUA 1MMDA 2KP6A 2XF7A 3C2GA 3DPUA 1U0JA 2RQQA 3N05A 3S93A 1ROSA 3L0VA 3MKWB 2DDYA 2W00A 2MZHA 1GLNA 1T95A 1V5FA 4XL9A 2JVGA 3MKYB 3G42A 3WV2A 1PWWA 1D1CA 2JA2A 1XFWA 1CGLA 3TVCA 4BJ6C 4BS9A 2JNPA 3SZGA 1RM8A 1OLTA 2DJIA 1BUVM 4LITA 3ZXHA 1OM6A 1LKXA 4ZTJA 3OYMA 2KMUA 1OMJA 4BACA 2VKHA 3NX7A 4E7SA 1UEAA 2JT5A 4CTHA 4ITVA 4PJMA 3HL2A 4YEJA 3DQVC 1QU3A 2MLRA 2QPJA 1ND1A 3K4LA 4XM8A 3LE9A 5HNHA 3D5LA 1GE6A 3S3OA 3MMYB 2E5NA 1KUFA 5L7FA 2PJRA 1KUKA 1IADA 3M8JA 1SLNA 3DSLA 2HNHA 4AYBA 3K4MA 1T0FC 3OR1C 3OYEA 4XLCA 1AF0A 3OS2A 2HDWA 2R7UA 4AUOA 1I1IP 5I4OA 2XS3A 1KONA 2X6YA 3RSNA 4B43A 5FROA 4CA0A 2OXUA 2W12A 3BA0A 3QODA 2OUMA 2FV9A 2BOLA 3A4CA 4RLFA 2W7NA 2DXIA 830CA 2Z16A 4H4KC 4PK4A 1DTHA 2F5VA 1O0QA 4XKBA 2EROA 3W3CA 1C3IA 1WJ5A 3TS4A 3WV1A 3PUBA 1YE9A 2LG4A 3OYHA 1BQOA 3BC8A 2ZXIA 2VQHA 4H82A 2XC7A 1X4PA 2RJQA 3MKZA 2R7OA 2X1CA 3AIGA 2NOJB 4F3QA 3DEEA 1JIWP 5CXAA 3HC7A 3DL1A 2R7WA 1X1CA 3ONQA 3KMEA 2IXSA 3I9V2 4XONA 2LY1A 2V4BA 3E0JB 3TBIA 4DJAA 3OWTA 1JJ9A 1D8FA 3LSGA 2O36A 2VQGA 3BCAA 3CP8A 2K5CA 4BEHB 4LG3A 1WJBA 5CKTA 3D5SC 2XF6A 4D1QA 2R7RA 4KISA 3MA2A 4GR0A 2AQFA 4E7HA 1EAKA 1WJCA 3OHLA 3A1YA 4ZJZA 2Y0SA 3K4NA 4RM3A 3S3MA 4IUWA 4XOTA 1N75A 1YX3A 3V96B 3KECA 2X6WA 3VYUB 4J01A 1QIAA 3G2BA 2R4GA 1MMNA 3LILA 1G49A 4F52A 3LQBA 2I8DA 2R7TA 3DNGA 1OS9A 2AYKA 2CH0A 3OR2C 3AL0C 1HTDA 2JIHA 3PNVA 4QPQA 1SATA 1D0YA 3E1SA 3S8PA 4E4HA 4FVLA 4H30A 2IGNA 5HLTA 1ZELA 3AL0B 2LY2A 3Q2GA 1BKCA 1BM6A 1CIZA 3HBUP 4WKIA 2BVMA 4HNTA 3GBOA 3NWSA 4PJLA 3IAM2 3HDBA 3LUNA 2Y6DA 1Z21A 4DBQA 1ZTQA 456CA 3EDGA 2RNGA 4JIJA 3HBVP 3VTGA 1MMAA 2CV2A 1XFVA 3KEKA 1BZSA 3LUMA 3VYSB 1K7GA 1D1AA 2VKDA 4YELA 1GE7A 3OYAA 1SAUA 1C8TA 2OI0A 3DWBA 1Z7LA 1CGFA 3TT4A 4XLAA 4F92B 4E7ZA 3O64A 3IP4B 2OY4A 1TZLA 4E7JA 1A85A 4L6TA 4II2A 2MD0A 2X51A 3KYLA 4BU2A 3PNTA 3F19A 2VJ4A 3K4BA 4C30A 3GBGA 1R55A 2OC6A 2AIGP 2O5RA 3OYGA 3KWVC 2X1DA 4XNFA 2IGKA 4HNUA 1KBCA 2QKMB 3BG6A 3K4CA 5D1UA 4WF6A 4NNJA 2YB9A 4XM6A 1WNIA 4IQ4A 3ZVSA 5HVQC 1B8YA 4XCTA 1G12A 3FHNA 2Z1DA 2FV5A 5FRNA 2V26A 4OWRB 1MNEA 2IGMA 3LEAA 5I43A 3N2UA 2D1NA 4IN9A 2W4SA 1LVKA 3LSHA 2X3AA 4PKWA 3HPHA 1JI8A 3OYBA 1JAQA 1I73A 3O2XA 2OY2A 3LFUA 5CPRB 3QYFA 3EPZA 2JVHA 3LJGA 4Y3OA 2CUZA 2PJTA 3VYRB 1H71P 2OZRA 2O3EA 2HQAA 2CUJA 1OM8A 2VIXA 2E2DA 2J83A 3K4JA 2WO9A 3SDBA 4BQOA 2HVSA 4JQGA 2DT6A 4BE2A 3L2UA 3LMCA 1IAGA 2DW0A 2A6TA 1PJRA 4XR6A 3S32A 1I76A 4NC8A 1GO7P 5D1TA 3H9JA 3DPLC 4I03A 4XM7A 2M7BA 1CQRA 2WBMA 3ZCOA 3RTSA 1X4OA 1XFYA 4PKTA 2HVQA 4WK7A 4C9YA 1FMVA 4C2TA 2DCEA 2L7KA 2ZSIB 2WADA 3K6GA 4Q1LA 2ZFUA 4PFOA 3F1AA 1BQQM 2HVRA 2KDOA 1YP1A 1PYVA 1XFZA 1UTZA 3DPFA 2PJRB 2MLSA 4EFSA 4DF9A 3H5NA 3ZR8X 1MMPA 2D1OA 3B92A 3HXLA 3QYEA 2ELJA 4XKCA 4FXQA 1FM1A 2OXZA 3LSIA 3CZ6A 2L5QA 2X6XA 2JUGA 1W36C 1R6RA 4N4OB 4CH7A 4BGDA 3ZUKA 1Q3AA 3LIKA 5KHDA 1BR1A 1QIBA 1ZXVA 3HY9A 2QKLB 3DWLE 4DOZA 3BG7A 3LMMA 2R7XA 3AKZA 2X3CA 2E60A 1FLSA 2CFOA 3OS1A 4R79A 1QJIA 3BLYA 1MMBA 4JP4A 4ON1A 3OMYA 3OYLA 1HY7A 5LABA 3UVCA 4P1WA 5KCMA 3HYGA 1MNDA 4IKFA 4GWMA 3ZQQA 1UG0A 3HUGB 2CMPA 3KEYA 4Y33A 1IAAA 1UTTA 2MZIA 4DGWB 2Z2SB 2CS3A 4GUYA 3ZGKA 4JPAA 2HU9A 3H9GA 1B3DA 3W2AA 4XLEA 1OS2A 3EHXA 3LIRA 4L7AA 5I12A 1WFXA 1BKCI 1DGWY 5L79A 1UMSA 4BE0A 3AFHA 1V5GA 3FBIB 1UELB 4PUSA 4RM2A 3F18A 4CZCA 4P5OA 2UWMA 4J4MA 4IQJA 3CKIA 1Y6IA 4H1QA 2M3AA 1CK7A 1DGRM 3K70C 1CAQA 2YUFA 1VZ0A 3RCOA 2WOAA 1NG7A 2ZXHA 2WAFA 2A5WA 4NQWB 4CCKA 1HV5A 2K9LA 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTE A;  3DTI A; 
#chains in the Genus database with same CATH topology
 1OO9 A;  4ID4 A;  3HOZ J;  2WKQ A;  1A86 A;  2AXT C;  2DLL A;  2TRT A;  2G2W A;  1Z6R A;  4H84 A;  2KT0 A;  4DYQ A;  2LR8 A;  5DYM A;  3GQZ A;  2O7O A;  2KJC A;  1MMQ A;  4G3W A;  2W13 A;  3K0L A;  1QHG A;  2K9Q A;  3FXU A;  3VSL A;  1FMW A;  1IKG A;  4HST A;  1K56 A;  5CUH A;  4LIU A;  5EEG A;  2ZOH A;  3DKX A;  4AVZ A;  4MGR A;  2KRJ A;  1O3T A;  2J8Y A;  3V7R A;  3G73 A;  4DE3 A;  2ECB A;  4UEY A;  2NNY A;  1VET A;  3VP3 A;  2MJ6 A;  3VV4 A;  4KIG A;  4X55 A;  1KQ9 A;  3P9C A;  4B44 A;  3FWE A;  2VOP A;  5FDS A;  1KVM A;  1IUY A;  3NI9 A;  4QY5 A;  2E35 A;  2L9R A;  3L2V A;  4CXF A;  5LAB A;  2IP2 A;  2P4W A;  5F04 A;  1NG6 A;  3PFY A;  4AWX B;  3CAX A;  3LOC A;  1YLW A;  3IAS 2;  1G05 A;  1K83 J;  3CC2 I;  3QPH A;  4IVI A;  3TOB A;  1U9O A;  3LSK A;  1N9L A;  1O3S A;  2AVX A;  4D60 A;  4EGZ A;  1UJ8 A;  3M1C A;  3Q1F A;  2EIJ H;  2WAQ A;  1SDN A;  2LKS A;  4HEA 2;  3L7H A;  3LAJ A;  2CW8 A;  1G3Y A;  2BG1 A;  3IXD A;  2H28 A;  5AVE A;  1T33 A;  5F64 A;  4CUG A;  1MY8 A;  1FOF A;  2RC4 A;  4GD8 A;  1ATL A;  1JTD A;  1QJJ A;  2MBF A;  4WWC A;  3N4I A;  3DKY A;  1CQT A;  2KLI A;  4GR3 A;  1V4R A;  1GV5 A;  1KA8 A;  5KNL A;  4KN7 X;  4MFD A;  1S1Y A;  2YS9 A;  3H0G J;  4S2P A;  1PP7 U;  4XLH A;  3P24 A;  4DNC A;  2LOO A;  5CQG A;  2DT5 A;  3SJM A;  3TMO A;  3NAU A;  1VET B;  5GAE J;  2CG4 A;  2E1C A;  4UVC A;  3A0V A;  1SD6 A;  5AIP A;  4OON A;  3ECO A;  1O7F A;  2GXG A;  4OAY A;  5CTN A;  4I3A A;  4V19 K;  4OLD A;  3AG3 H;  3BTC A;  1FSY A;  2BAS A;  3MKY B;  4WL9 A;  2VKV A;  5TRD A;  5DEQ A;  3IT9 A;  1BN5 A;  2FBK A;  4GNU A;  4PMA A;  3KPH A;  1HF0 A;  5FQJ A;  1HXD A;  3DQV C;  4A0X A;  1E3O C;  5J47 A;  1IGN A;  3NOT C;  1ALQ A;  3J7Z I;  3IF5 A;  1PI4 A;  2HKO A;  3IWQ A;  3A4C A;  4RA7 A;  1JGG A;  3ZG0 A;  2X48 A;  5FA7 A;  1YM1 A;  2RJQ A;  5CXA A;  1IJW C;  3PFI A;  1FBU A;  2HDS A;  3CP8 A;  5EG0 A;  3B3X A;  3ABL H;  2PLY A;  1FR1 A;  1DDN A;  2L0K A;  1ETW A;  3TSG A;  2PDR A;  1OTE A;  1HW1 A;  4E3K A;  1IN4 A;  2CH0 A;  4LEN A;  3LI8 A;  1IXR C;  1P9W A;  3C38 A;  2GQQ A;  1UST A;  1ZEL A;  3Q2G A;  4DDY A;  4NKP A;  4WKI A;  1Y0N A;  3LUN A;  1GXQ A;  5GAH J;  2RNG A;  3AG2 H;  1XFV A;  4KQD A;  3CCY A;  1BOA A;  2A69 F;  3H82 A;  3GFJ A;  2OY4 A;  2PMZ N;  2I9V A;  2MD5 A;  3TW7 A;  3GBG A;  5AJG A;  3K3D A;  3OYG A;  1W4M A;  2V9V A;  1FNN A;  3FG8 A;  2D1N A;  2X3A A;  4YG2 F;  2OY2 A;  3LJG A;  2B63 J;  1LUJ B;  3S1R J;  4LRZ E;  1G6N A;  4GCZ A;  4GDB A;  4I01 A;  3LMC A;  3M8E A;  2UV0 E;  5FD6 A;  1HKT A;  1K6R A;  2GNX A;  4AYB N;  5EVI B;  2FXA A;  3K1N A;  4CYC A;  2E34 A;  4A93 J;  5JR3 A;  3IBR A;  1IEL A;  1W36 C;  4I3I A;  4N4O B;  4BGD A;  2F5E A;  2JRM A;  2QKL B;  4HYE A;  3FIS A;  3OS1 A;  3MF0 A;  1HY7 A;  4F3L A;  5BPI A;  3V3R A;  3ZQQ A;  3KEY A;  3MFD A;  2WKH A;  4CLC C;  4D5F A;  3F18 A;  5EG0 B;  1I2S A;  4Q0I A;  5AON A;  1X3Z B;  3UE3 A;  1HV5 A;  1MD0 A;  3E5Q A;  2H5S A;  3NBL A;  2G7H A;  2P6S A;  2ZQD A;  2BYV E;  2F6C A;  4II3 A;  1MH3 A;  3F9K A;  4KZ8 A;  2JSD A;  3B02 A;  3H82 B;  3AG1 H;  3B6A A;  4IJG A;  2ZC6 B;  2A05 A;  3PJR A;  2VQL A;  3LK8 A;  3C3W A;  5F1J A;  2WKP A;  3TQN A;  5KSC A;  4UUS A;  4AM3 A;  4U7D A;  4I38 A;  3T4L A;  3QU3 A;  1XFQ A;  2W3G A;  1AYK A;  4OP8 A;  5GLB A;  4B09 A;  5BOY A;  2K9N A;  1RUO A;  2FRH A;  3GWZ A;  3CUE C;  1D0Z A;  3HOS A;  1ZN2 A;  2QVO A;  2UUZ A;  2K4B A;  4HDV A;  4FX4 A;  2IBD A;  4CYC B;  3CQZ J;  1EWZ A;  1LT0 A;  3GTG J;  1Q1V A;  1TVF A;  4QWQ A;  3O5Y A;  1KUI A;  3K2N A;  3UME A;  2W84 A;  4HPQ A;  4HEF A;  3T1X A;  1L2S A;  3ELM A;  1SZV A;  2XKO A;  2OTL I;  1M40 A;  3PSF A;  5ICF A;  4JOM A;  4F3L B;  2X85 A;  4JXV A;  2DA7 A;  2VAS A;  2R7Q A;  3MXS A;  3G4S I;  3MZE A;  2ZO4 A;  3D5R C;  1X19 A;  5DV5 A;  1W0U A;  1FIK A;  3SFI A;  1SFU A;  2VN2 A;  2SRT A;  1Y39 A;  3ZNT A;  5K7F A;  2H09 A;  3ZOB A;  4DE1 A;  1R36 A;  3O86 A;  4NHJ A;  3GV9 A;  1T1B A;  4BUP A;  4IUH A;  4HOB A;  4IJO A;  5IYB J;  3T1R A;  2J3T C;  1MMG A;  5EJC A;  1SMP A;  5HDS A;  2XV4 S;  2HDQ A;  1XGI A;  1VFC A;  4UUS B;  1KZH A;  2JTV A;  4RAG A;  2JN6 A;  5IOY A;  1K57 C;  5EM1 A;  4C3Q A;  3VTG A;  3BEC A;  2K02 A;  4PPR A;  5E3N A;  4I2O A;  3S7Q A;  4ZDL A;  3CMY A;  1D7E A;  2K2G A;  3KYD B;  3SXY A;  1O4X A;  1RGZ A;  1FP2 A;  4U7B A;  3UB6 A;  3GFL A;  2ZJ2 A;  1JH1 A;  3PBR A;  1LSV A;  1X1B A;  4L9T A;  1UG2 A;  3BZK A;  3C8C A;  1GA0 A;  1OJG A;  5DUI A;  4EQQ A;  1KDW A;  1CGL A;  3OIO A;  1RM8 A;  4LIT A;  3KZZ A;  1GVJ A;  3NY4 A;  4QLC U;  4C3J J;  2QSF X;  4MLL A;  4UA7 A;  4LRY C;  2DA4 A;  3G3Z A;  5FRO A;  2RN7 A;  5IOZ A;  2DXI A;  1MWT A;  2Z16 A;  2PRF A;  3A3E A;  2X1C A;  3Q0U A;  5H6R A;  3ERE D;  5IHV A;  2O36 A;  2XF6 A;  3OHL A;  4WZ5 C;  3A1Y A;  3WS2 A;  3KEC A;  1XJ6 A;  4FT8 A;  4EV4 A;  1P6R A;  3LIL A;  4IF4 A;  1RC9 A;  1SC7 A;  1OS9 A;  3CUQ A;  1CI8 A;  4HBL A;  3NAR A;  1BKC A;  3A02 A;  2BVM A;  1R58 A;  1ZTQ A;  1WQ2 A;  3EDG A;  5HDK A;  4XLN F;  3TO9 A;  2ZC5 B;  3QP4 A;  4YEL A;  3NUL A;  3M3Y J;  1CGF A;  4XLA A;  5HDD A;  1TZL A;  3Q0W A;  1T08 B;  4BU2 A;  2O9B A;  2O5R A;  1KBC A;  1I1G A;  2YPR A;  5HVQ C;  4OP5 A;  1DU0 A;  4PKW A;  1I73 A;  1SDE A;  3QHY A;  2LSO A;  4Y3O A;  2HP9 A;  2ZJR F;  4HX7 A;  1OPX A;  2Y4A A;  5F0F A;  5FO5 A;  2ZBK A;  2WBM A;  4OOL A;  2WAD A;  3BR2 A;  5FKM A;  1D5V A;  3ZR8 X;  3QQA A;  3QYE A;  3S7O A;  3EWK A;  3C7U A;  4HY8 A;  4N1X A;  3MJQ A;  4EU0 A;  3VP0 A;  4P1W A;  3EYI A;  4MCW A;  1YO5 C;  3HSE A;  3JVV A;  1SAX A;  5I12 A;  5LGU A;  1FJL A;  2DFI A;  1UEL B;  4ABZ A;  2YUF A;  4KEN B;  4M72 A;  1YT4 A;  3F3X A;  1XGM A;  1WJE A;  3FIW A;  1SAN A;  2ECC A;  1L6J A;  5LEJ A;  4I7H A;  2FFF B;  2EA9 A;  4RYE A;  4BBU A;  4P96 A;  2Y2J A;  4JBF A;  3HRM A;  5J6X A;  2ETH A;  4HQE A;  3EWJ A;  3FXJ A;  2XKP A;  1FCM A;  5JLW A;  3CCV I;  1DPU A;  3S2H J;  5KAI C;  2K27 A;  2ZQC A;  5K5R A;  2KLO A;  3LSM A;  3PQJ A;  1G6A A;  4DBR A;  1MNM C;  4M9Z A;  3K7L A;  1BL0 A;  2XDV A;  2QHK A;  3S3N A;  4BL0 B;  2V1A A;  2HZD A;  3OLO A;  2VE8 A;  4EMS A;  1LNW A;  3FXR A;  1GSX A;  5D2B A;  4MMN A;  3LJZ A;  3C2W A;  1S72 I;  4L9G A;  4GF1 A;  3H5R A;  4JGO A;  3LCE A;  2PMZ A;  3RXW A;  2R93 J;  1NZU A;  1IRX A;  5B5O A;  2WAE A;  4JP0 A;  3GFI A;  4S2I A;  1IOU A;  3IXG A;  2OWJ A;  2MYS A;  3NDG A;  4YFM A;  1PWQ A;  1IDY A;  4HA8 A;  2E2I J;  4BHB A;  2IS6 A;  4ZR5 A;  3U2A A;  1TWC J;  5DCF A;  4Y7P A;  3UB7 A;  2FQ3 A;  1YJN I;  1JWZ A;  1ES5 A;  3K2Z A;  2Q8K A;  4UNO A;  1IYS A;  1OZ9 A;  3W8K A;  2A5Y B;  1KE0 A;  3LAP A;  2YX4 A;  1HA8 A;  3FXK A;  2PBI A;  2ZC3 B;  3QPL A;  1R5I D;  2FBI A;  5D4R A;  2F5C A;  3U1K A;  3DU6 A;  5CGX A;  1TWG J;  4PKY A;  4I0B A;  4ESP A;  2DOF A;  2JZY A;  1YYV A;  1P4X A;  4DV8 A;  4G9L A;  2QSG X;  1RES A;  5CVR A;  4FH2 A;  2IWB A;  3I7G A;  2I5U A;  1NK2 P;  1W7P A;  4JGQ A;  2P7V B;  4HHD A;  4ZTF A;  3F1P A;  5JMY A;  1J09 A;  4LV2 A;  5E3M A;  1EKE A;  2O8X A;  2MW8 A;  4DQ2 A;  1RIO H;  3DXJ F;  3K70 D;  5EEH A;  3HOW J;  3EYY A;  1L0D A;  1BIA A;  5C4X J;  1ETK A;  4B8X A;  2EX9 A;  2HV1 A;  3VFF A;  4KJZ A;  1ZAR A;  3EGX C;  4IHQ A;  4P9U A;  3CO7 C;  2H6B A;  1AST A;  6PAX A;  3WTX C;  3QPT A;  5JI6 A;  1T56 A;  2ZQA A;  2HXI A;  3IH3 A;  1YRN A;  2HPB A;  1PWW A;  2HP6 A;  3CCE I;  2ACJ A;  4IHY A;  5I5L A;  1YLP A;  1QQI A;  4E7S A;  1J7K A;  2QUF A;  4YEJ A;  2XHK A;  3TDZ C;  3M8J A;  3ZDJ A;  4O6J A;  1K4F A;  3BA0 A;  3QOD A;  4L0Z B;  2L01 A;  2DTR A;  4PM9 A;  3BR0 A;  1MJB A;  2VQH A;  1X4P A;  4DE2 A;  4KUK A;  1V54 H;  1SVO A;  3B73 A;  2ZD8 A;  3BCA A;  1K54 A;  3MA2 A;  2A49 A;  2V1Z A;  3S3M A;  5F0C A;  1W7P B;  1MMN A;  4BQM A;  1QZE A;  3F1P B;  4D7N A;  2H8W A;  3VMA A;  2XA7 S;  2H0T A;  1G28 A;  2Y2O A;  4GD6 A;  4ZJ2 A;  4JXG A;  1S66 L;  4RGS A;  2A6E F;  4JIJ A;  3HBV P;  2OCC H;  3VYS B;  2VJW A;  2VKD A;  1Y1V J;  3HHH A;  2VJ4 A;  4E3J A;  1R55 A;  3K4C A;  1Y0U A;  3NDE A;  1PWC A;  2JWT A;  3IRQ A;  3LEA A;  5LBR A;  1MBH A;  1JAQ A;  5CPR B;  3TP3 A;  3HLF A;  3G32 A;  3PYP A;  5M5W J;  1YRN B;  1E25 A;  3H3V K;  3HLC A;  2JMW A;  2JE5 A;  2YUS A;  5DM7 F;  4NC8 A;  4KZ7 A;  5K5Q A;  2PU2 A;  5IP7 J;  4L9N A;  3PBQ A;  1HKS A;  1YP1 A;  4YIF A;  2QJ7 A;  3B92 A;  4FXQ A;  3D9Y A;  1TNT A;  4PZJ A;  1A6Q A;  3Q9V A;  2INW A;  4R4R A;  2VEA A;  4XLE A;  2J9P A;  2Y0S N;  2QCO A;  2ZME B;  1JKQ C;  1DJB A;  2STT A;  5L79 A;  1UMS A;  5DD8 A;  2MGQ A;  3FBI B;  1DP9 A;  1BIB A;  2UWM A;  1TL8 A;  2M3A A;  5F1R A;  2ME0 A;  2EXB A;  3MFX A;  5CYV A;  2K9C A;  2CGP A;  2VI6 A;  3FBN B;  2CQ7 A;  2JSP A;  3EEH A;  4A3W A;  3J7A O;  2W0N A;  2Y9Y A;  3HLE A;  1VQ5 I;  2IW5 A;  1J3W A;  2ZNZ A;  1VM1 A;  2M4K A;  4MEY F;  2MSY A;  1USN A;  3N7W A;  2V1B A;  2Z2M B;  2OVZ A;  3FK6 A;  4LCL A;  3OSF A;  2MZE A;  1K55 C;  2JCH A;  2NYX A;  4PSW A;  4JX4 A;  3KZY A;  2RL3 A;  2CWE A;  2DTZ A;  2MA3 A;  4A3E J;  2D02 A;  1WGX A;  3FKJ A;  3CC7 I;  4A0Z A;  1XUC A;  2H10 A;  1APL C;  3MEX A;  1I2W A;  2DMP A;  2L9V A;  2Z33 A;  2Q9M A;  3GLL A;  4PAU A;  3TO7 A;  2KDZ A;  4LIV A;  3HSR A;  1SFX A;  2Y2N A;  3VFZ A;  2XFT A;  4ARZ A;  2VPR A;  4ESJ A;  3SYT A;  4K91 A;  1L0E A;  2EJR A;  4GQL A;  4RGU A;  3JRC A;  1JHH A;  5FKO A;  3HOY J;  4F91 B;  3KET A;  2IWC A;  3SS3 A;  2RRE A;  1S4B P;  4XUX A;  3RYR A;  2YX7 A;  2G2U A;  1DP6 A;  1T0F A;  1RP5 A;  1ZG3 A;  3H3Z A;  3FF5 A;  1QNT A;  2ZJ9 A;  3HM5 A;  5IP9 J;  1K61 A;  2BTF P;  5EEC A;  1N25 A;  3KP6 A;  1V9Z A;  3M07 A;  3FXL A;  1HW5 A;  2XIG A;  3CMA I;  1IYO A;  1PW8 A;  2HPM A;  1IC8 A;  4L0L A;  3HUO A;  1ERD A;  4OQG A;  3BDD A;  1FQG A;  4BY1 J;  1F43 A;  4HX3 A;  1SD4 A;  3RKQ A;  1UZC A;  2CW7 A;  1BKC E;  3ELK A;  3O2X A;  4QWO A;  2OSU A;  2PAV P;  4P87 A;  1H9T A;  4E7I A;  4B3X A;  2V9K A;  4L63 A;  3KRY A;  1MZB A;  1BUD A;  4MN6 A;  3KSG A;  2HKX A;  4A5R A;  1HQC A;  3WS0 A;  4XQF A;  5CXW A;  2DPD A;  2GA2 A;  4BE1 A;  2RGV A;  1BUE A;  2LKP A;  3TW6 A;  3T12 B;  2QMI A;  3N05 A;  4X56 A;  2W25 A;  4N1H A;  4ARZ B;  1BLH A;  1Z7U A;  4BS9 A;  3ZXH A;  1QO0 D;  2XAS A;  1USS A;  5LHG A;  5FI2 A;  2M30 A;  3MKF A;  2E5N A;  1TEM A;  1Z05 A;  3CDH A;  2HWV A;  1KON A;  5TIS C;  3PBN A;  3ZQG A;  3BFD A;  3WG9 A;  9ANT A;  2CMN A;  1ON2 A;  3GW2 A;  4A3F J;  3OYH A;  3HC7 A;  2XVC A;  2VLG A;  3KME A;  4IEJ A;  1T8I A;  1D8F A;  1BBY A;  5CKT A;  4GR0 A;  3UE1 A;  2DFE A;  4ZYD A;  5ICC A;  1WE4 A;  3K4N A;  1NYM A;  4P6B A;  3ZMU A;  2L0W A;  4FVL A;  2RAE A;  3I5U A;  3AL0 B;  4Y52 J;  5LGT A;  5E1Z B;  3JYI A;  2M1C A;  4B4C A;  2FFY A;  1DJA A;  5FL3 A;  3CJT B;  4F92 B;  4LG0 A;  3C5A A;  4E7J A;  2K3F A;  3KP4 A;  5TGF A;  3LST A;  5DFY A;  4MQ9 F;  2YB9 A;  4R0Q A;  1FX7 A;  3SQN A;  4E6W A;  2X6O A;  5ED4 A;  5F1F A;  4HP4 A;  3BP8 A;  1LVK A;  3LSH A;  3HPH A;  3V7S A;  2VBY A;  1FOY A;  3V7C A;  3L2U A;  2M7B A;  4LMY A;  2DN0 A;  5J7E A;  1XFY A;  2DCE A;  3ZHH A;  1XPX A;  2E36 A;  4KZ4 A;  5HAI A;  1W8Y A;  4EFS A;  2D1O A;  5EEA A;  2X6X A;  2JUG A;  1Q3A A;  2ZC2 A;  3ZPL A;  4DOZ A;  2X9D A;  1P7I A;  5CHU A;  4C2M J;  4C75 A;  4P85 A;  4R38 A;  3G35 A;  3LIR A;  1WFX A;  1DGW Y;  4EJO A;  3AFH A;  1W1W E;  4R4S A;  4NXE A;  4H1Q A;  2UXN A;  2DCF A;  1VZ0 A;  1BT5 A;  2UZK A;  2A5W A;  3P01 A;  3WTU C;  4JF4 A;  5EVI D;  1XMX A;  3U4L P;  2WKR A;  2F5F A;  2OJE D;  2WTE A;  2EV5 A;  2NXN B;  3ROU A;  2KPM A;  3BG9 A;  4XRM A;  1XUR A;  2LBF A;  2XAH A;  2A8H A;  2D1V A;  3SDG A;  3K2A A;  5GLA A;  3S2W A;  1YG2 A;  1S7E A;  1JAO A;  1YCM A;  3W2Z A;  4LG0 B;  1ZKJ A;  3B2Z A;  3S16 J;  4FXY P;  4I02 A;  2IWD A;  4S0H B;  1N9O A;  2HOA A;  3S1N J;  2VT2 A;  5KAF C;  2VJJ A;  1MWR A;  3VDX A;  3OHO A;  1VQK I;  1ONH A;  3L2W A;  5HS7 A;  4C3H J;  2JUC A;  5CLS A;  4PKR A;  5F27 A;  3KO6 A;  1QZY A;  2KHM A;  3JPU A;  4M6V A;  4XRS G;  2Y2Z A;  5JVG F;  3F72 A;  3IH2 A;  4KZ3 A;  1O0T A;  3BFC A;  1CK3 A;  2ZM2 A;  5ERI A;  1B59 A;  4UHU A;  1YW8 A;  3OOU A;  4HSR A;  4ZDP A;  5HAQ A;  3U2R A;  3M2J A;  4FAS D;  5E8I A;  4ZDX A;  5HDG A;  5E1X A;  2OVX A;  1YOV B;  2P0W A;  2VPL A;  2LNB A;  3DKW A;  1I6X A;  1KU7 A;  2LMD A;  1PWG A;  4KG6 A;  5LFA A;  3IH8 A;  4EV0 A;  5A90 A;  2LF7 A;  1OCO H;  4IL6 C;  2F5D A;  4KT5 C;  4IUK A;  3QP8 A;  5F82 A;  4EEP A;  3CUQ C;  1MPL A;  2W3F A;  2LBF B;  3HY7 A;  2I47 A;  3ZQI A;  4JQF A;  2EA2 A;  1W36 D;  2LB9 A;  3DW0 A;  1TW3 A;  2ZXW H;  4I76 A;  4A3L J;  3KHI A;  5F6A A;  2PD8 A;  2ESH A;  3M4O J;  5ICG A;  2ZKZ A;  2MG4 A;  4CLC D;  3GF2 A;  3MKE A;  3N8R A;  5HOO A;  3LQ0 A;  2XRO A;  4OIO F;  4X0G A;  2Y48 A;  2QA4 I;  2BXZ A;  3I7J A;  5DKK A;  4X69 A;  1T1A A;  3KCC A;  2L9N A;  4YOF A;  5FLX K;  4JXW A;  2L3D A;  1KGF A;  4ZJ1 A;  2CLT A;  3WTT C;  3R61 A;  1N78 A;  3DCF A;  3J80 K;  2LH9 A;  2CQQ A;  5DS9 A;  2RQQ A;  2CJJ A;  3RKW A;  5IU1 A;  1RR7 A;  3HRT A;  1WWX A;  5HD5 A;  4ZTJ A;  3UDX A;  3CD6 I;  1HLU P;  4XM8 A;  4G6D A;  3LE9 A;  4LRX C;  2QEN A;  5L7F A;  4Z9Q A;  1R9T J;  4AUO A;  3UB8 A;  3IH9 A;  3RSN A;  2NS7 A;  2XUB A;  5L3B A;  1TF1 A;  4XKB A;  2PR5 A;  1XTA A;  1KYW A;  3DP7 A;  4GZB A;  2LG4 A;  2XC7 A;  4E3O A;  3HUG A;  2NVY J;  3M7G A;  2DOE A;  1HVB A;  3E5U A;  2Y69 H;  4E04 A;  2IRF G;  3V5M A;  2KIQ A;  1XS9 A;  3Q82 A;  4R6L A;  4Y0O A;  1F98 A;  1N75 A;  5FEF A;  4J01 A;  3VYU B;  5KSH A;  3G2B A;  1HTZ A;  3CCQ I;  3BTI A;  4BXX J;  1BM6 A;  1VI0 A;  2VC1 A;  2GDN A;  3KEK A;  3HJK A;  1GE7 A;  3BFF A;  1IXS B;  1MH4 A;  3PNT A;  4C30 A;  5LHI A;  3HBL A;  3G31 A;  2WGV A;  2BLS A;  1ZGA A;  3E98 A;  1ODD A;  1FBQ A;  3K1M A;  4LLG F;  4E3M A;  2J3T D;  4KYW A;  3L09 A;  1OR7 A;  2EWV A;  3K4J A;  5FD5 A;  1IF1 A;  2DW0 A;  3S32 A;  4FOF A;  4MEZ A;  5EPH A;  4EET B;  1DUX C;  1D1J A;  2FH5 A;  4O8G A;  2WGW A;  1KGS A;  4FX0 A;  5JHU A;  1SFE A;  1NXY A;  1BR1 A;  1Z67 A;  1QIB A;  1STZ A;  3HY9 A;  3GTL J;  4R70 A;  2R7X A;  1MMB A;  2GLO A;  1OME A;  1FSW A;  1ZG1 A;  3HUG B;  4M6X A;  5J3W A;  3BLS A;  1PIO A;  5LRR A;  2Y2G A;  1ZLK A;  4HLY A;  3KYE A;  3F21 A;  5HFO A;  4BQA A;  1LJ9 A;  3N6I A;  2BY0 A;  3LFV A;  2WAF A;  1LEA A;  1ZHF A;  3UKG A;  3BZC A;  4E3N A;  1A6I A;  5A8B A;  2DT7 B;  3GTJ J;  4Y0U A;  3EUK L;  3EHY A;  4E7K A;  3DPT A;  3ZQH A;  2GXA A;  3P7N A;  3LEZ A;  1XFU A;  1WI9 A;  1S7A A;  3QU6 A;  4UUT A;  3B6C A;  2PYP A;  5A2Q Z;  1R1J A;  2RJP A;  2WWY A;  1XKZ A;  1I1S A;  5CJ9 A;  4R23 A;  1K7Q A;  5LHH A;  5ILV A;  3WU2 C;  2JT1 A;  4IPA A;  1GHM A;  2OOL A;  3SZP A;  4R1H A;  3SEQ A;  3DTE A;  5FKK A;  3H9W A;  1R1I A;  3GMW A;  2HQN A;  3UNG C;  1TQP A;  2XF5 A;  3D0S A;  3I54 A;  2CYY A;  2DW2 A;  2HDD A;  5L3G A;  2F48 A;  4BBS J;  3FM3 A;  3LIF A;  2XSJ C;  1QHH D;  4FH4 A;  4FCF A;  1KVL A;  1U6G A;  1LB2 A;  4WKE A;  2KZV A;  5CVU A;  1XM5 A;  5K7H A;  4LD5 A;  2JBF A;  2X7M A;  2WGW B;  1K25 A;  5FQ9 A;  3RH8 B;  4L19 A;  3BJN A;  1BR4 A;  1KQ8 A;  2FU4 A;  4XBH A;  2FA5 A;  1LEB A;  1PUF A;  5EE8 A;  3L2R A;  4AC0 A;  2DA5 A;  3IUO A;  3DTK A;  3H0D A;  3COA C;  1ZG4 A;  4HI4 A;  1GO8 P;  1LSX A;  2XGE A;  2IA2 A;  4KZ6 A;  3OPH A;  4KMU X;  2QBY A;  3VE4 A;  3W4O A;  4GJ4 A;  3H7W A;  2DYS H;  5FQK A;  4PKV A;  4CGZ A;  5H8X A;  2QZ8 A;  1J2X A;  1RRJ A;  3CUO A;  3P98 A;  3LIA A;  1YMX A;  3F15 A;  5A93 A;  4MTD A;  1KOU A;  1RMZ A;  5BQT A;  4KA4 A;  4LB5 A;  1OJL A;  1A5J A;  4HW0 A;  1MNC A;  1R1H A;  1JNU A;  4DW6 A;  1F2K A;  2KDK A;  4NC7 A;  3CJR B;  2HEO A;  1CGE A;  3CJQ B;  4C3I J;  5CRF A;  3CCS I;  4BXU A;  3BQY A;  1YIO A;  1MJ9 A;  3ZMV A;  3OYD A;  4EER A;  1KUH A;  3PAG A;  4RA2 A;  4EAT A;  3KSH A;  1HD8 A;  4KT6 A;  4CSW A;  5AVF A;  4PSX A;  3MXR A;  2XQZ A;  1OCC H;  3RXX A;  2E1M B;  2CV0 A;  3I59 A;  1QIC A;  5JYP A;  2RV8 A;  2Y6C A;  1IN7 A;  3GXO A;  2FSW A;  1H3Q A;  3HZJ A;  1XFW A;  5FAT A;  3BY9 A;  2KMU A;  1PUF B;  1UEA A;  2EQR A;  5DJT A;  2WAQ N;  2O03 A;  5EVE A;  1X3W B;  2A3U A;  3RDI A;  2DRW A;  4B43 A;  4CA0 A;  3D4F A;  5D3O A;  3ZMZ A;  4FSF A;  1C3I A;  5TR7 A;  3KE2 A;  1BQO A;  1X0O A;  1S8N A;  3BC8 A;  2ZXI A;  2E2J J;  1XGJ A;  3MKL A;  5M1A A;  2V4B A;  4DJA A;  3GVA A;  3G1M A;  5HAP A;  2ACG A;  2K7S A;  1SAT A;  4ZZD A;  1U5T A;  4UB8 C;  2NUP C;  2XGX A;  3IAM 2;  2QKP A;  1U3E M;  3M6B A;  4ME4 A;  4IHX A;  4DXB A;  4A6D A;  3EQV A;  3UDI A;  5AQB A;  3AGE A;  3TOI A;  1JTY A;  4E7Z A;  1L0G A;  2HOE A;  4EJU A;  3ZQL A;  2X1D A;  3MZD A;  4BD1 A;  3SH7 A;  4IQ4 A;  4FTH A;  2Z1D A;  3SHF A;  4X6A J;  3CLO A;  3JR9 A;  2O6G E;  3C30 A;  3MVP A;  3S1Y A;  1FYL A;  3VYR B;  2O3E A;  4EUZ A;  3V8K A;  1B1B A;  1H88 C;  5AQ9 A;  3KLN A;  1PJR A;  3BTL A;  3BY8 A;  2DOD A;  3IXB A;  3CPT A;  5HPI A;  2ZSI B;  3PAE A;  3GZ6 A;  2ZCW A;  1TLH B;  5HWW A;  2MLS A;  2EFQ A;  1W0T A;  5HOD A;  1JT6 A;  4AUX A;  1ONV A;  3LSI A;  3NHQ A;  2HOS A;  3DWL E;  4L5E A;  1I3Q J;  4S2N C;  3HYG A;  4IKF A;  2MZI A;  3WU1 B;  2OWH A;  1TS7 A;  5H2F C;  2FQ4 A;  1BI2 A;  5FLX Z;  4JF6 A;  1MBF A;  2Y55 A;  4BE0 A;  2VK3 A;  4J4M A;  2COB A;  3K69 A;  1NG7 A;  4FCY A;  1AWI A;  3HLD A;  1H5X A;  3WS1 A;  4XN3 A;  2PG4 A;  1NYY A;  2B18 A;  1XJ2 A;  1R7J A;  4KG5 A;  1E0E A;  4U0W A;  5TGT A;  2VJ5 A;  2OCE A;  3HB9 A;  3RQI A;  3ZFZ A;  3I58 A;  4XIC A;  2M7U A;  2W82 A;  2EA4 A;  5TJJ A;  1XUD A;  2IS1 A;  3MQO A;  1JUP A;  4S04 A;  2Y0M A;  4H8R A;  1UMT A;  1XP4 A;  4R3A A;  4KN4 X;  1G3W A;  4IHT A;  4M4X A;  1ZG5 A;  4RQ9 A;  2OAZ A;  3T1Q B;  5E2E A;  1VQM I;  3I55 I;  5HS9 A;  2LRD A;  3C7V A;  1IN5 A;  2VKE A;  4NXB A;  3CF5 F;  3MQQ A;  2P9V B;  2M1B A;  3F1N A;  2DDF A;  1QGP A;  5IT5 A;  3NOU C;  4PJN A;  5GAD J;  2E1O A;  1SHV A;  1IRF A;  2C6W B;  5EFW A;  2VQC A;  1R1V A;  2XB5 A;  4GR8 A;  1HLV A;  1SLM A;  3A3I A;  1ZKG A;  2V1X A;  4BJP A;  3RI4 A;  1U8R A;  3HOU J;  1ZYR F;  4GWN A;  4G7Z F;  2F2E A;  1UHS A;  1RNL A;  1EV7 A;  3IQA A;  3NEC A;  2ZJP F;  1ZTU A;  1CEG A;  4LCM A;  4X68 A;  2L1M A;  4Q47 A;  3L0T A;  3A0B C;  4HMA A;  2DK5 A;  1KYZ A;  4EUV A;  1JTX A;  1BI1 A;  1LLB A;  4BJ5 C;  3V42 A;  4WXH A;  4L9J A;  2JJ7 A;  2CV1 A;  1DRM A;  4UAA A;  2K7L A;  2B7E A;  4WK8 F;  4A3B J;  1KQ0 A;  2Y2K A;  2KRF A;  1H8M A;  1BLP A;  1G4K A;  2OW9 A;  2KIM A;  1FBS A;  2EFP A;  1IYP A;  1ZP5 A;  2ZJQ F;  2Q0O A;  3F8M A;  2CW0 F;  4YIN A;  3GX4 X;  2R92 J;  3EUH C;  3ZYT A;  5BMZ A;  3T8T A;  5LEK A;  3F1N B;  4EM2 A;  3R7W A;  2W24 A;  3PO3 J;  4B88 A;  3LI9 A;  3C2G A;  4DRT A;  4HX8 A;  5GTI C;  2DDY A;  3MSH A;  4CPK A;  4Y3I A;  2ZFW A;  2FF4 A;  4A12 A;  2OV5 A;  2K31 A;  4K0X A;  1FCN A;  4WF0 A;  4HDU A;  3WGG A;  3CG5 A;  3PO2 J;  2MLR A;  3K4L A;  4HNV A;  2Z2L B;  1S1Z A;  1JKP C;  1IAD A;  3ZP5 A;  3OS2 A;  2R7U A;  3ZG8 B;  1IYQ A;  2XS3 A;  1FOX A;  2X6Y A;  2OUM A;  2BOL A;  1X3U A;  4MO7 A;  4RLF A;  2W7N A;  4WX9 A;  1O0Q A;  1J0R A;  1BLC A;  1E3H A;  4HJ3 A;  3GVB A;  1FP1 D;  4PM8 A;  4MN5 A;  3LSG A;  3KYQ A;  4D1Q A;  3D5S C;  4KIS A;  3JRA A;  2E8J A;  3G2Y A;  1TWF J;  3IF6 C;  1XJ3 A;  3HOV J;  3LQB A;  4Y2F A;  3BZ6 A;  4LV0 A;  3UMD A;  3LR4 A;  3B47 A;  1ZC2 A;  4HF2 A;  2BHZ A;  3MFK A;  3HGG A;  3HIF A;  4KQQ A;  1O7L A;  2DO7 A;  2EZL A;  4OPY A;  1Z6F A;  3IX3 A;  1E2X A;  3A3J A;  1SAU A;  3CCR I;  4AD9 A;  3LSP A;  2X01 A;  1SVM A;  1J9I A;  4Q5S F;  3Q7V A;  1FIP A;  3D72 A;  3RTY A;  4DPE A;  2IGK A;  1EH7 A;  2Y9Z A;  4EGY A;  2VUM J;  2FV5 A;  3OCN A;  3R7W B;  1ZGJ A;  5L8M A;  3LFU A;  1SD7 A;  5D5U B;  1ETO A;  4XUZ A;  3IS2 A;  2NS8 A;  2OQR A;  2DT6 A;  3CME I;  3DBL B;  2H8R A;  4GO1 A;  3WRZ A;  4RBO A;  4QB8 A;  3H9J A;  4X53 A;  3AGF A;  3F6V A;  4Q1L A;  1I27 A;  4QU3 A;  4A69 C;  2OD5 A;  5HL6 A;  3HJE A;  1ZHH B;  1FTT A;  4P55 A;  1ZRF A;  4KFC A;  1FLS A;  1JT0 A;  2PBD P;  3RJP A;  3QP1 A;  5KCM A;  2BBY A;  4L9E A;  1F36 A;  2RDP A;  5DUK A;  1KDS A;  1J59 A;  1R5H A;  2D5V A;  4RM2 A;  4MBK A;  3T4J A;  3GEC A;  1DP8 A;  4KZB A;  5G4Z A;  4A3J J;  1T1C A;  4DF6 A;  5LD2 C;  3CWF A;  2FZ0 A;  3UE6 A;  1EUB A;  4OLG A;  3ESW B;  3BY6 A;  1B6A A;  1Z9C A;  3HDA P;  5CGW A;  4BWI A;  4B4Z A;  5F68 A;  1ZRC A;  3ZRG A;  4GCV A;  4MBF A;  5I0L A;  1CGP A;  1V55 H;  1E3U D;  2WYX A;  2BW3 A;  3K9T A;  4JPM A;  2BZT A;  5DM6 F;  3V8J A;  1ACF A;  3Q7V B;  1YI2 I;  1S7O A;  1AKL A;  3H92 A;  4X1M A;  3SHI A;  1S29 A;  3IC7 A;  4FTX A;  3GLX A;  1Z3J A;  1P4W A;  5G18 A;  3GTM J;  3IS2 B;  2BY1 A;  2QF7 A;  3E3V A;  3SH9 A;  2EB7 A;  4DD8 A;  2W1R A;  1MIJ A;  5EM0 A;  2BVL A;  3EGD C;  2Z6D A;  1IXC A;  1UGU A;  2NRA C;  4JXS A;  2VJI A;  5EVI A;  5C4J J;  3BYD A;  2DU9 A;  4ZRR A;  1VQQ A;  4LFU A;  5GLC A;  1BUL A;  1AHD P;  1LFP A;  4PCQ A;  2KIU A;  4ZYG A;  4N9H A;  2AXL A;  1KE4 A;  4HBU A;  2QQ8 A;  2Y8H A;  2DYR H;  1OCP A;  5L3F A;  3JVU A;  3CCM I;  3IWZ A;  3ZQ5 A;  3GZ5 A;  3KX2 A;  1PZO A;  3M2K A;  2A24 A;  4UB6 C;  2DOA A;  1Z77 A;  2V8F A;  4BEH A;  4DYC A;  2BW3 B;  4BKX A;  3L2C A;  1OM7 A;  5D8L B;  2V4J C;  1WI3 A;  3NCK A;  1BOB A;  1X1D A;  3Q81 A;  1N77 A;  3FMS A;  4A2U A;  2IGO A;  1BW5 A;  1W5C C;  3KSF A;  2USN A;  5FLV A;  3S15 J;  3JW4 A;  3IHB A;  4DYR A;  4DXC A;  1IFQ A;  1K6S A;  2M0M A;  4Y17 A;  4D7M A;  3A01 A;  2XEP A;  3I3L A;  2IA0 A;  2ELK A;  3P9K A;  2VLA A;  3KP5 A;  4E6K G;  1XXM A;  2VGK A;  1BTL A;  3F1O A;  2X3B A;  4XOR A;  4NET A;  1PWU A;  1MMD A;  3VE3 A;  1GHP A;  1CF7 B;  1K7A A;  4NXF A;  2EPF A;  2FD5 A;  4GLQ A;  2R5Z A;  1ND1 A;  1I3A A;  4P6Z M;  4M3D A;  1P7J A;  3K4M A;  2QZ6 A;  3HYI A;  830C A;  4UV9 A;  2YKH A;  2ERO A;  3ZQ7 A;  3T4Q A;  2XPW A;  2NVX J;  2XRN A;  3E6C C;  2A24 B;  1S67 L;  2HQ5 A;  3I64 A;  2L02 A;  4ASN A;  4BEH B;  4CLC A;  1NTC A;  1Y54 A;  2Y2M A;  2DA6 A;  4IUW A;  2XD1 A;  2PI0 A;  1QIA A;  1AU7 A;  4RX3 A;  4G3K A;  3DNG A;  4FE4 A;  4ZAM A;  3KZI C;  4QPQ A;  3QP2 A;  2FML A;  2QWS A;  2A61 A;  1CIZ A;  3HBU P;  2JA6 J;  5FI7 A;  3KYC B;  1JKO C;  3JRH A;  5D6F A;  3DWB A;  2NAZ A;  3O64 A;  1MWS A;  1A35 A;  2EV6 A;  4II2 A;  2W3E A;  4OVD A;  2CQN A;  2E8I A;  3A01 B;  2E2H J;  3KWV C;  4HNU A;  2JA7 J;  3MCZ A;  2M45 A;  1FY7 A;  1B8Y A;  5J8F A;  2V26 A;  4EJV A;  1YLY A;  4IN9 A;  5TBM B;  3F1O B;  3QYF A;  2FNA A;  1WKM A;  1S0W A;  1YKD A;  4PGG A;  1F4K A;  2VIX A;  2J83 A;  3CUE A;  1C3B A;  2ZC4 B;  4B9O A;  3HRS A;  4I03 A;  3PUF A;  5BNG A;  3OPP A;  2R5Z B;  5CED A;  4C2T A;  2ZFU A;  3F1A A;  1B4A A;  4DF9 A;  4Y0T A;  3H3U A;  2L5Q A;  4N92 A;  1FOK A;  4L9V A;  4OMZ A;  3UVC A;  5DCM A;  2HQR A;  1TBX A;  5LRS A;  5D5W B;  2DA2 A;  1QVU A;  3GUD A;  1V5G A;  4PUS A;  1HOM A;  4CZC A;  1Y6I A;  4CLC B;  3SH8 A;  1ZAO A;  3UO9 A;  4MNR A;  2WOA A;  2ESN A;  4CCK A;  1FIA A;  4Q0H A;  4U0T A;  3L7W A;  2O61 A;  4QKZ A;  1MSF C;  2LDU A;  1S3J A;  2XAQ A;  4AIH A;  2EX8 A;  3FHZ A;  2EV0 A;  3QAH A;  1YSQ A;  4WF2 A;  2X1E A;  2XR0 A;  1PWP A;  4PFP A;  4G9Y A;  2LLK A;  4S2O A;  1LDK B;  1NJ4 A;  4O5V A;  5IP6 A;  1ESU A;  3CC4 I;  2COM A;  2R0Q C;  1OTD A;  2DAO A;  4OMY A;  1J7N A;  2B5R A;  2QYB A;  4WLA A;  1ERQ A;  4IHV A;  2MC3 A;  3W2V A;  1VQP I;  4OKP A;  3KEJ A;  2PFB A;  1RKT A;  2LC2 A;  4RDU A;  2WB1 A;  1TS6 A;  4G94 A;  4BAY A;  2EBI A;  1K57 A;  3LNQ A;  5G4Y A;  3FXQ A;  3Q5F A;  1TT5 B;  1IZ1 A;  3JRF A;  1GA9 A;  2W57 A;  4A3M J;  3O2P E;  3T1S A;  2QWW A;  4AIG A;  5K5B A;  3LR0 A;  2UV1 A;  2BHY A;  2QYO A;  4M3K A;  5IY5 H;  4QD4 A;  4EJT A;  1K0K A;  3NQO A;  3C4P A;  3RJU A;  1ZS0 A;  4N4N B;  3HB2 P;  4Z1W A;  5D1S A;  3G71 I;  1XD7 A;  1OTB A;  3H1C A;  4AU7 A;  3G2Z A;  5DCM B;  1FYK A;  1GCE A;  2V0W A;  4JF5 A;  4MHG A;  4ENJ A;  4ZDO A;  3OOP A;  2L9S A;  1DP3 A;  2Y2P A;  3V3S A;  3ISP A;  2KOI A;  4OQH A;  3JTG A;  2FBH A;  2Y2L A;  1U5T C;  3MZY A;  1G59 A;  5CTM A;  3RTT A;  3G30 A;  5F0H A;  3OYJ A;  2J80 A;  1SRP A;  1QVT A;  1YLJ A;  1MBJ A;  1FTZ A;  4UHT A;  3G6E I;  4AXQ A;  3TED A;  1G9K A;  3K7N A;  4X1E A;  5DTS A;  3DAV A;  3LJT A;  2WUQ A;  4WZ5 A;  3LO7 A;  2JT6 A;  2MFZ A;  2P81 A;  5IPA A;  2P04 A;  3O3V A;  1YQS A;  4DMZ A;  1Y4O A;  3PBT A;  1IAE A;  3LGO A;  4WZV A;  5M3M J;  2R7S A;  3TDU C;  2VON A;  3V67 A;  1MDM A;  4BY7 J;  2EH3 A;  1BYW A;  2K9S A;  3H35 A;  1HFS A;  3HTS B;  3E4Q A;  4H2E A;  1TP4 A;  1C7K A;  3KFW X;  4XM3 A;  4LK1 F;  3RYP A;  4P0M A;  2WZX A;  2DQR A;  1P9R A;  1GKC A;  1A0K A;  1G2H A;  1ROS A;  4KZ9 A;  3GTQ J;  2X02 A;  1N4O A;  5F1G A;  3L9F A;  5CVJ A;  1QU3 A;  1JWV A;  4QHC A;  1I1I P;  1JXS A;  3WE3 A;  2O8K A;  3J81 K;  4HF0 A;  1FT9 A;  3WV1 A;  3PUB A;  1YE9 A;  1JIW P;  3DEE A;  3S22 A;  2RNJ A;  5B3S H;  2H0Y A;  3LR3 A;  4U0V A;  3ZGA B;  1WJB A;  1T38 A;  4E7H A;  4R8H A;  2C6Y A;  4HX4 A;  4W1U A;  2CO5 A;  1XPB A;  3OOV A;  1U9N A;  2HR3 A;  5JVT A;  4M9X A;  5KK1 A;  3CCL I;  3RKX A;  1B9M A;  3R6S A;  3NC8 A;  2ME6 A;  5HAR A;  1TDG A;  2H1L A;  4N9L A;  3JRD A;  3TVC A;  2ZBB A;  1XDS A;  4GXO A;  1UWN X;  1MDM B;  5GP9 A;  1A85 A;  4L6T A;  3KYL A;  4D5C A;  1ZLJ A;  1BJA A;  3MMH A;  3ZVW A;  4ZBE A;  1OQY A;  2WKE A;  4YIR X;  4BL2 A;  2DMT A;  3UPO A;  2QSH X;  2PJT A;  1H71 P;  2DDA A;  2CC1 A;  2HFH A;  3TG9 A;  1IAG A;  1BM9 A;  5EZH A;  2E1N A;  1HCR A;  3L1P A;  3ZCO A;  3BEB A;  2HVQ A;  3C18 A;  2VE9 A;  2FJ1 A;  4QPR A;  4E3I A;  1ODV A;  4KUO A;  1OYI A;  1MMP A;  1UB9 A;  1YQA A;  1A04 A;  2L4R A;  3PR6 A;  1R6R A;  2DMQ A;  3LIK A;  2Y59 A;  3WGH A;  4PGH A;  5B1B H;  4MQV A;  4GKU A;  2NS0 A;  2CFO A;  4R79 A;  2EX6 A;  4GWM A;  4A0Y A;  1JJ8 C;  2KIS A;  2ADU A;  2KIF A;  3RCO A;  1TW2 A;  3F8B A;  1NK3 P;  3E6B A;  2P7C B;  1JKY A;  1FC3 A;  3BQZ A;  2ERP A;  3HPG A;  3FKW A;  3LUQ A;  4Z2Y A;  5F83 A;  2WA0 A;  3VP1 A;  1YLZ A;  2BY3 A;  1TQM A;  4DZJ A;  2QM3 A;  1HFC A;  3A03 A;  3P9I A;  4HNB A;  3AGD A;  1Z1D A;  4Y13 A;  2VBW A;  3PM1 A;  3UDF A;  1BC7 C;  4YRV A;  4BQN A;  5M19 A;  2IEK A;  1GKD A;  1K4E A;  3FV7 A;  3N2V A;  4RGR A;  5CZM A;  4A3K J;  3V4G A;  1Y93 A;  3E2K A;  3HKZ A;  4U88 A;  5HLH A;  1AOY A;  2JSC A;  1I50 J;  2B95 A;  3F8N A;  1OTA A;  1F9I A;  1GE5 A;  2OV7 A;  1TT0 A;  2Z6C A;  5FAQ A;  1WRJ A;  3TP0 A;  5L3E A;  2LTP A;  5GLD A;  1G4D A;  3MD2 A;  2QLZ A;  1OIS A;  2H6C A;  2E3X A;  4KIT B;  2CFX A;  2DA1 A;  3HL9 A;  1BIW A;  1MBG A;  2ZMV A;  4NBQ A;  1BA5 A;  1R1U A;  2CUF A;  4ILW D;  3KP3 A;  3NRV A;  3IH4 A;  5FSR A;  3HOX J;  1BR2 A;  1D8K A;  2V1N A;  1W5D A;  5J1U A;  4IHS A;  2PJP A;  4G8X A;  2RQP A;  2R9W A;  4B93 A;  2XGC A;  2W1O A;  1P0Z A;  4KZA A;  2HP5 A;  4FQG A;  4NC6 A;  2JQ7 A;  3HDD A;  5FQM A;  4XXR A;  2DMN A;  5DF7 A;  2HGV A;  2NOG A;  3AYK A;  2ZME A;  1LSW A;  1G5U A;  4RAZ A;  1D8M A;  3PSI A;  4B3A A;  2IJL A;  1CI9 A;  4XLP F;  3VEP A;  4EEF G;  2GWR A;  4IJA A;  3UB9 A;  2ICW G;  4OIR F;  4CLC E;  3W4Q A;  5HWT A;  4AYK A;  3O8G A;  5HPF A;  1U8B A;  4ZYH A;  5HNF A;  2CUE A;  2HDR A;  1V5E A;  3W6V A;  1RZ4 A;  1FIL A;  1TC3 C;  1TD5 A;  2M0C A;  1K79 A;  4XKW A;  2P8T A;  3WV3 A;  4CJN A;  2L4M A;  1VQ7 I;  4XT2 A;  5GL9 A;  3J7A Y;  4II7