3DTEA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
247
Chain Sequence
b'PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IrrE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 70
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dteA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dteA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dteA01
3DTKA 3DTEA 3DTIA
chains in the Genus database with same CATH superfamily
1IN6A 3WE3A 1FMWA 2HZTA 2Y9YA 4C9YA 4BS9A 1CQTA 4DRTA 3Q81A 1BUDA 1MD0A 2ZXJA 2O03A 2OU2A 4EJOA 3H1CA 4I3JA 2R7FA 4LFUA 5B5PA 5J47A 3N05A 1E17A 1R58A 5D1SA 5DTKA 2VBZA 4WF2A 3BQZA 3IXBA 1UEAA 4E7HA 3W6KB 1FBQA 2V4JC 1FIAA 2X01A 2USNA 1XGSA 3PBSA 3KO6A 2V8FA 3E4PA 3R7WA 1LVAA 4L0YB 1FOWA 3W6JB 3M6BA 1NYYA 2PJRB 3FXUA 4D5CA 1BSGA 5M5YJ 2LKSA 1MKMA 4JA1A 4I0AA 4D9JA 1B8IA 2LMDA 4LD5A 5F83A 3H3VK 2F6CA 2KHMA 1MMSA 3ZVTA 4AC0A 4KT6A 1A31A 5LEJA 3CP2A 1CGLA 3DPLC 1T0FA 4WBGA 4DYQA 3CJRB 5E17F 1IV8A 2WAQN 3MWMA 3BT9A 3WV1A 2ACGA 3GF2A 1TTYA 1MMPA 4HNVA 1A86A 3AG3H 5HAQA 5DTSA 1W5SA 2XFTA 4Y33A 2DT7B 4XLHA 1J9IA 1YW7A 4FD8A 3KEQA 1K54A 5DV5A 3PQKA 4D2OA 3DXJF 5IS1A 2WKIA 2X6OA 2NXNB 1QMFA 1T1BA 3LI8A 2HTSA 4IO9F 1WH7A 3ZXSA 1ZAOA 4JX4A 4BBTA 1XURA 1J75A 3SEZA 4H6JB 3GZNB 5ILVA 4HHDA 3ZMVA 1ASTA 3SZTA 4BDZA 5EFWA 4GKUA 4XUZA 4P6BA 3ZCOA 1P9RA 3LICA 4RYEA 1IRGA 1FLSA 1FEXA 3UB8A 3LIKA 3GEZA 1RKTA 1P7IA 4K0XA 1W5DA 5GHYA 1JIZA 4GR3A 1WJEA 4HBLA 3P7NA 4JLFA 1C8TA 2NVXJ 4KMFA 2HXIA 3KSFA 2XV4S 5FASA 4EQ1A 3ZYTA 1ES3A 1J59A 4ZC3A 1VM1A 5HDDA 4KZ9A 2E5ZA 4ZYHA 1IAWA 4Y0OA 2ZQ8A 5LGTA 1GVJA 4E7SA 3U1RA 2R7WA 2CU7A 2FQ4A 1WKMA 3AFHA 2P5LC 4IJGA 2JA8J 3T4QA 3DP7A 4FASD 2PJPA 1I27A 5IT9K 1R7JA 1D3YA 1JH1A 2KP6A 4BJ6C 3W4QA 2XF5A 3E0JB 2QEXI 2G2UA 5U47A 3WHCA 3IS2A 3ICYA 3ASOH 4BE0A 2VGLS 3FMSA 2Y2OA 3ECHA 1IN4A 3B3XA 1BKCI 1Z3XA 2L9SA 5EZHA 5D3CA 1NWZA 3MZFA 4GRIA 3UNWA 2K85A 5CHJA 3OOVA 4B44A 5TJJA 3EWKA 5B5EC 4CH7A 3S7PA 3BJAA 2ZOHA 1ZK8A 4I2OA 4MNUA 3B47A 5J8CA 4RS8A 4MTDA 1C3IA 5HNFA 3OMYA 4PJJA 4KG2A 2KOIA 4GD8A 3EUAA 5HOOA 4OLGA 3IV5A 3HRUA 3EGDC 1LL5A 2ZXHA 2M4KA 5GHXA 2ZQAA 2G2WA 1XM5A 4Q4ZF 2L02A 1LI9A 3BOQA 4KZBA 4UUSA 1W1WE 2K2GA 3B73A 2OW9A 2AXLA 3RPUA 5EEAA 2XAJA 1OCOH 4ON1A 1ETQA 2W3HA 4LOCA 4I38A 3K2NA 3ABLH 3U1DA 4WLAA 4IKFA 2HYFA 2K9CA 2FU4A 2WKHA 1ONGA 4IVNA 1OFCX 4OPZA 4ZYAA 1ZC2A 2GM4A 5D6EA 3HBLA 4PM5A 4DZPA 2DDBA 4E3MA 3IF6A 2ESNA 5KZHA 3CKIA 3BA0A 3OYKA 2ZCWA 3SQNA 2OW0A 2E71A 2K9SA 3OYNA 4EGYA 4ZDPA 5AVFA 2ZC5B 2EXAA 5I94A 2LB5A 2L9NA 3QYBA 3KX2A 3PSIA 4FX0A 2WGWA 2OCEA 3FM3A 1MBGA 5EUAA 2LY2A 4M73A 4G12A 3D5RC 4OOYA 4F94A 4EMSA 1R1TA 1W5TA 1B59A 3FXRA 2V6CA 3KFWX 4CLCB 2P0WA 5TISC 4AU7A 4ABZA 4HX8A 3M1CA 5EYRA 3H9GA 2J0TA 3BTCA 1PZOA 4XONA 2WK0A 4BJ5C 1Q2QA 3PHYA 2VLAA 3TP0A 4RB2C 4IHSA 5B1AH 2LTPA 2Y2MA 3BY8A 5ERIA 2HF6A 2OF7A 3NQOA 3T50A 4EV0A 2CW0F 4M71A 5EG0A 3S7OA 1I6HJ 4B3XA 2HOEA 5DTDA 2CSOA 2JUGA 4XQFA 2HJ9C 1ETWA 2CO5A 3OPLA 1ZG4A 2CJJA 4KZ3A 2E60A 5FKMA 5DVAA 4JBFA 2Y75A 5CKTA 4I7HA 5F6AA 1NRJA 2VOPA 4KG6A 2DA2A 1YT4A 4JX5A 1D7XA 1XA1A 4OIPF 1XFZA 4S04A 2A5WA 3MQOA 4UA6A 3CCQI 4HQEA 3M3YJ 3BWGA 2Y2NA 2Y59A 4WZ4A 5L3DA 2C6WB 1VB6A 3FXMA 2RNGA 966CA 4Y13A 1O3QA 4WF0A 2V2FF 3L7HA 3OPRA 1D1CA 3C8CA 1PP7U 4F93B 3I64A 4MFEA 4YFKF 3FXLA 3H7WB 3DW0A 1Z6FA 2WZXA 3RQIA 3H0GJ 3LCEA 3N4MA 1X1BA 2EPFA 2CV2A 3CMAI 3KPHA 3P09A 2MD0A 4CYCA 3B02A 3B6AA 1S6RA 1IXCA 1TNTA 3DBRB 4A12A 4ESFA 2EK5A 3TVCA 5B5OA 1XC5A 2BW3A 2XRLA 4KENB 3CF5F 2KMUA 1U8BA 1JHFA 4FCYA 1X3UA 4UB8C 3IL2A 5FA7A 3FISA 3G2YA 1X3WB 3WHBA 4JGRA 1K78A 1JJ6C 3Q82A 1MH4A 5H20A 1TEMA 4R79A 4FISA 3RJPA 3GTOJ 1I73A 1SD4A 4DGWB 3S22A 2OW1A 2XGCA 3L0VA 3R61A 3V4GA 1IAAA 1YX3A 1PUFB 2Z16A 3CZ6A 2GZWA 3LIFA 3K7LA 2OZ6A 4BXFA 2O6GE 2G7UA 2GQQA 2M1BA 4YOFA 4MFDA 2QQBA 3NULA 1VQPI 3W6VA 2PU2A 1XD7A 3G1LA 2PX9A 4OLDA 3BFGA 2J9PA 1D1AA 1ZREA 3HOXJ 2VASA 1FSHA 3CCRI 5HS8A 3LY4A 4XBFA 5JVTA 2J80A 1G59A 1HD8A 3ABTA 4M6YA 4YINA 1LJ9A 4ZJ3A 1TQIA 1CGFA 1ON1A 1XXMA 3MCZA 2Y2GA 1JTGA 2Z2SB 2OAQ1 2FV5A 4C3IJ 3HM5A 4XLNF 2BHYA 1LFUP 2LF7A 5I0LA 2Q2EA 1W63M 3OV8A 2ZJQF 5E1XA 2IT0A 4MQVA 3SFIA 4R3VA 5FD5A 1QNTA 4A5NA 3KSGA 1ZH5A 4E6XA 1PRQA 1E3PA 5KAFC 1WNIA 2DMNA 2WOAA 4LB5A 4I35A 4H4KC 3IXGA 1XKZA 3LIAA 4HEA2 1LQ1A 4EXOA 4E3KA 1PWQA 3WTVC 3OYAA 4A5RA 2H1KA 1HA8A 3BWLA 3WU0A 3I4MJ 2ZXWH 3O64A 1R22A 4PFOA 3IWZA 5CXWA 2JZYA 5HW3A 5JI6A 1HW5A 4OVDA 4I3IA 3A3IA 2EQRA 2JQ7A 3IAM2 3BG9A 2CUJA 5FQMA 2K2NA 3DTIA 1W7FA 1UHWA 2W24A 1XUDA 3MQQA 4DE1A 2F5CA 2XPVA 3F8CA 3VODA 2R5ZA 4CLCD 1IACA 3ABKH 1T56A 4LIVA 1USTA 3PL8A 4Y3IA 5LLQA 5LBRA 4RBOA 1P97A 2CQXA 2Y2ZA 1MPLA 5FFXA 2GJ3A 2EXBA 3V8LA 3CUQB 4PUSA 4B43A 4RB0A 3K4MA 3HUMA 2PRFA 2FQ3A 2DW0A 2VKSA 3H5AA 3BR1A 5ILSA 3BG3A 1KAPP 3T12B 4U0VA 3U21A 2Y6DA 3BPXA 5KNLA 3GQZA 2DA3A 4NUBA 1UELB 2OWHA 2NUTC 4RVAA 3HUGB 4PDKA 2STWA 1VNDA 3QHYA 3A0HC 3JRBA 1K6YA 6PAXA 2B0LA 1QJJA 2LBFB 4ZDXA 5BPAA 3S2HJ 1B9MA 4DPEA 1XMKA 3BLMA 3C7JA 2HS5A 2WKEA 3C4OA 2I8DA 1XTAA 3DWLE 3ZG7B 4D7MA 3A1YA 1R49A 3I71A 2LSOA 2VT2A 5F08A 2KFDA 4IHYA 4DOZA 1IELA 2K7SA 2A05A 2WV1A 1LFBA 2IVMA 4G3KA 1RUOA 1I6XA 3DBHB 3KZYA 2ISYA 2VQGA 4HNBA 1MWSA 1QVUA 4I5SA 3FZVA 2DTZA 4YIRX 5CRFA 4FCFA 2EWNA 4S2KA 3QYEA 2GNXA 4CLCE 2G7HA 2JVHA 3KHIA 1JKRC 4D1QA 5DUKA 2XPWA 1G49A 1G12A 5E8GA 3R7WB 3BZCA 4Y3OA 2XS4A 3DWBA 4QLCU 3TW8A 3JRHA 3E4OA 1KUIA 5EEHA 3IF5A 1YKDA 1ZGAA 2A2LA 3PFYA 2NS7A 4X6AJ 2HPMA 4ZTJA 2Y2IA 4Z1WA 1B8IB 2DJIA 2OXWA 4P87A 1GA0A 4XRSG 4QIWN 3OZHA 4G6QA 1IYQA 1HZOA 2R9WA 1XFYA 4DNCA 2XF6A 3HLCA 3MR0A 2B95A 1WJAA 3SS3A 1RR7A 2HDCA 5L7FA 1N4OA 2MW8A 1MBEA 4IVIA 2Y6CA 5E2EA 5F0CA 1FOXA 1AA7A 2BG1A 2FBIA 2DXIA 2KRJA 2YUSA 2EIJH 3KYZA 1UHMA 3IX3A 2J3TD 5IP7J 3O88A 1ZGJA 2K7LA 1EV7A 4IQ4A 1QRYA 5HAPA 1AF0A 2RREA 3RXXA 1ATLA 3WG9A 5H8XA 3AG4H 4G6TB 3A01A 1D1JA 3LILA 1LVKA 5FKLA 3S7NA 2ZM0A 1Y8RB 3N2UA 4OU0A 2W3GA 4DQ2A 1X1PA 2C5WB 2JKTM 1L0GA 5IU1A 4LV2A 1W0UA 3VFFA 3VEPA 4GYGA 2P04A 4HYEA 3DTKA 1X2MA 2VXZA 4M74A 2M9HA 2JKTI 5D5XB 4F7ZA 2JN7A 3ZQQA 1MMAA 2P8TA 3GTMJ 2EX6A 2XUBA 1Z67A 1TQMA 1UCRA 1FBLA 2NAZA 4UXNA 3IWFA 2XB5A 2X9DA 4R8HA 2XC7A 4BJTA 3OYBA 1Z3YA 3G3ZA 4R3JA 3QOPA 2VJJA 1Z09A 3U2RA 1GCEA 2JJ7A 1BLCA 3ELKA 4XOPA 4IZZA 3M8EA 2IGKA 5FQKA 4OQGA 4HZFA 5FDHA 3H92A 3LA3A 4LV3A 4PKUA 4KUMA 4MEXF 3ZQHA 2NS0A 2DCFA 2YKFA 2VBWA 3IS2B 3S1NJ 1PFLA 5A2QZ 3HLFA 4OP8A 1OTBA 3GUDA 1CGPA 1I1GA 5D7WA 1IN7A 2A5YB 2P81A 3E3VA 3J7YJ 3MZEA 1MC0A 1SFUA 3NOTC 2QJ7A 3IAS2 4Q47A 5HL6A 3ZG9B 4MMNA 3ZGAB 1O4XA 1S4BP 3LSIA 4R1GA 4WKEA 3LSKA 4IUKA 2IRFG 4L5IA 3TE8A 2YU9J 4G6DA 3JRCA 3C18A 5F6FA 4H76A 2EZKA 3ABUA 3MKFA 3ZCZA 1KYZA 2XF7A 2XAQA 3U1KA 3WTZA 1BTLA 1ESUA 2R7VA 4IXAA 1ZHHB 4EFSA 4CUGA 3S4XA 2Y2QA 4C30A 3WGIA 1IAGA 4P9FA 2WKPA 3LE9A 5DF8A 1R9TJ 5JMYA 4HEFA 2XRNA 2QF7A 1K7GA 1R5GA 5F1JA 1K4TA 1K6OA 5EVLA 4UUSB 4I02A 4S05A 2M7VA 1MH3A 1ZR2A 4A3JJ 1Z6RA 1H8ZA 2K4JA 2FSWA 4DBQA 3GFIA 1WRJA 2JRMA 5HDNA 3VOZA 2LYCA 4Q0HA 3N7WA 2YIGA 4AM3A 3FHNA 3LA7A 2R78A 3IF6B 2VEAA 1FC3A 2PDRA 4NBQA 4Y52J 1JNUA 1YLZA 4PKRA 1CF0A 1D8KA 2UUZA 4A0YA 2L7KA 3BCBA 2DBBA 4GW9A 2Q1ZB 2WGWB 3E6MA 3K10A 1G5UA 3W4OA 2LH9A 3BTIA 3HHGA 4IF4A 1R1VA 1ORKA 5AIPA 3ZPLA 3KYQA 1PW1A 4YFMA 2P7VB 3B2ZA 1NLZA 2QSGX 4PKQA 1NTCA 1GKCA 4OQ0A 3T0YA 2JBFA 2EFUA 4HSRA 1SANA 2XR0A 2M7UA 4YELA 2AO9A 3ELMA 1NHAA 2R7TA 2NVYJ 4ENJA 3N4IA 1NXYA 1QVTA 5D5VB 4H82A 1X19A 3UE1A 2OC6A 3T1QB 4BL2A 2UXNA 3VE4A 5EG0B 4E3NA 1Q1VA 2E1OA 4AUOA 2K9NA 4F3QA 4S2LA 5KVRA 2ZQCA 2JT1A 3TRCA 4FTXA 3G5CA 5LHIA 2B02A 1JWPA 4PKYG 1XJ2A 1BI0A 2NVTJ 3S7QA 4H1QA 4IEJA 5GLDA 3OL3A 1U5TC 2E8JA 3Q0UA 2H09A 1Y0VA 5BOYA 5DCFA 3C2GA 2BVLA 2KLOA 5HWTA 2JSPA 2F5FA 5DKKA 4OP5A 2E3XA 3WE2A 5HLGA 4R38A 1BUEA 4RA2A 3A3EA 1Z05A 1BW6A 3QP8A 3K1MA 1O0QA 1SMTA 4M9SA 3DEUA 2KJBA 1KGEA 5HLTA 1XSXA 5JLXA 2V8CA 1O7LA 4NC8A 1EWZA 3PUFA 2RQPA 5ICFA 3FMQA 5DEQA 3QPHA 1WZ2A 1HVBA 2J8YA 4L9EA 1ZR4A 3OHOA 2IWDA 2HVSA 4I01A 1R36A 4QU3A 2ZC3B 3OYDA 1Q3AA 3TL4X 3V7CA 2QQAA 3ZOBA 1Z91A 4NC6A 3AGFA 2HR3A 4CYCB 1XGIA 2QUFA 2EINH 1JGSA 4GB7A 4HP4A 1HDDC 2ERQA 1FQGA 3V96B 1SRPA 2EA9A 3HYIA 2D02A 2DJNA 2BW3B 1M1EB 3O3VA 5FROA 1XFNA 5CVRA 2FOWA 2K5CA 3WS0A 2VJ4A 2H27A 3HREA 2DFIA 2PEXA 1W79A 2JA5J 4KIGA 2CYYA 4A3BJ 5EDNA 1K78B 2IGNA 2KIUA 3LSMA 4CICA 4W1UA 3BG7A 2EV6A 2NS8A 4MLLA 1JXSA 4Q48A 4XKVA 5IYDJ 1TT5B 5HLHA 3DLLF 2VKVA 1OM8A 1BZAA 1G3SA 1P7JA 1HXDA 1K0KA 3FKVA 1S0WA 2CG4A 2X1DA 1DU0A 2XB0X 1PIOA 2RAEA 1SLMA 5FL3A 3S16J 3K4CA 2HDQA 2MGQA 1FTTA 1USNA 2EX2A 4B3AA 2HGVA 3G2ZA 3CCVI 1G05A 4BWIA 3G1MA 1XJ4A 3ZQLA 4Q8IA 2ZM2A 4OIOF 4BY1J 3SDGA 1YSPA 2PR5A 2LK2A 1S66L 3BR0A 1HKTA 1V9YA 2Z2MB 1GE6A 1PWWA 1PVEA 4HX7A 5E2FA 3OR2C 2QM3A 2X7MA 4Z9QA 2L54A 3E1SA 3UY6A 2Q2EB 3MF0A 3ML6A 5D4RA 2WKRA 1BULA 4CYDA 3DF8A 1JTDA 4GD6A 2CRGA 1FPQA 3H35A 4EM2A 3G71I 2ZMFA 3FK6A 1Z7UA 3RPUD 1T38A 2IS2A 4MTEA 2CQQA 3QPSA 1QQIA 3H3ZA 4CLCC 3DBLB 1MJAA 9ANTA 2DN0A 4QPRA 2R7XA 1UJ8A 3DU5A 2LLKA 2D1NA 4JQGA 1JTXA 3C3WA 2HP9A 1UHSA 1XG1A 1Q1HA 1RP5A 2IWCA 2HU9A 5HFOA 3LA2A 1D5YA 4BXUA 3ISGA 5E3NA 4GO1A 1H8MA 4RGXA 3X2QH 5AVEA 4ZJ2A 3BEBA 2X0LA 3IX4A 4KZ8A 3HOSA 1MMDA 2M45A 2GDNA 1ZN2A 3M1EA 1RUNA 1GHCA 1NZOA 3KP2A 2R5ZB 2NNYA 4A2UA 2V0UA 3JTGA 5HODA 1PI5A 3FG8A 3JSOA 1P9QC 1MNCA 5J3WA 4PM9A 1FSEA 2PT7A 3IRQA 4UQIS 2PYPA 1FR6A 4GDFA 5GAEJ 3S14J 3HOUJ 5HSQA 2KLIA 3TEDA 3CMMA 1YLYA 1A0KA 4Q5SF 3LYXA 2ECBA 3VP4A 2A07F 2L9VA 4Y7PA 1Y0NA 3DEEA 3HJIA 1G3YA 2X71A 1K4EA 1YJ9I 3V5MA 1GHMA 2JWTA 1NH3A 3ITAA 4KZ5A 2NVQJ 4XUXA 3P98A 2GIVA 1F4KA 1TVIA 4KNYA 4JIJA 2P5VA 4H6JA 4EBPA 3Q7VA 2BLSA 4IX7A 4BDYA 4OIQF 4X6TA 5TRDA 3BG6A 2L0RA 1Z9CA 4FTHA 2W1OA 1U5TA 2D5VA 3ZG8B 3VFHA 1QHGA 1PI4A 4NDLA 1VQNI 4KUKA 4CA0A 5BPIA 4E04A 4RAGA 3CHWP 3J7AO 4U3TA 4HI4A 4R4SA 3UB7A 2EROA 3VP2A 1OPXA 4LRXC 4Y7NJ 1GXQA 4A3DJ 4F91B 3PUBA 2PD7A 1VZ0A 4X68A 5TBMA 3A03A 2KPMA 2RC4A 1L0DA 1ZELA 5IT5A 3TW7A 4EJUA 4HAMA 3LR3A 3PTEA 5EECA 4U0XA 5AQBA 3PM1A 1J0RA 4FSFA 2FRHA 3PNVA 4HV6A 2DU9A 1SD7A 4DXBA 3S8PA 1D0ZA 2PFBA 3HLGA 2HQNA 3BR5A 4UUVA 1ONVA 1F5MA 3CDIA 2H0TA 4N1XA 2GLOA 4TV7A 4Y5FA 2KKOA 3PBRA 2BZTA 3F15A 4L9FA 2GX5A 4CSWA 1VQ4I 5DF7A 1MBLA 3D0SA 2J3TC 3KYEA 1KE0A 3OCLA 3GBGA 2BGCA 1WJBA 3OPHA 3I0TA 2POJA 3WTSC 2H8RA 2JCHA 2BY2A 3LAPA 1OS2A 2CW8A 1SFEA 4JGPA 4EJWA 1JUMA 3LQ0A 3LQBA 1W7PA 4B4CA 3KECA 4AYBA 2KJCA 1GSXA 4P6ZM 1CGEA 1DUXC 3ITBA 3TQNA 4AD9A 4A0ZA 2V1DA 1E25A 1APLC 2WB1N 2VV8A 2HWVA 3R0AA 1U78A 3EUHA 3BP8A 3G6EI 3LMCA 5LHHA 1H5XA 3L2QA 4KZAA 3ASNH 1R23A 2NUPC 3HRMA 1LL9A 1HKSA 2JE5A 3A01B 4U0WA 2JVGA 5J1YA 4WX9A 2J9OA 1G6AA 4KJZA 1BA5A 3N6IA 4G0DA 4D5FA 4DKIA 4HF2A 2EBIA 4MN5A 5EM1A 3LUMA 2ECCA 5FB2A 1IRZA 4CDGA 3K2AA 2X4HA 4M3BA 3KLNA 4E3IA 5FQQA 1DJBA 4FVLA 2IGMA 4UUTA 2WO9A 3EUKL 4KQQA 2OJED 2XSJC 4PM6A 1OMJA 2OBPA 2V9KA 1V54H 5CTNA 4P1WA 4G7OF 1W8QA 5CGSA 4S2MA 1HW2A 1XSVA 4HNTA 4WZ5A 4BKXA 2KZVA 5AQ9A 4R0QA 3DKWA 1Y39A 4IL6C 2DPDA 4QWQA 5I43A 2VJWA 1R6RA 4UY8I 4DBRA 4H84A 4UV8A 4Q0JA 2WV0A 1YQSA 1WI3A 4HSTA 1AWCA 2Y79A 1K7AA 3CUQC 1SAXA 4BQNA 1XDSA 1MWUA 2OTLI 5L10A 5I3MA 1RI7A 2JA7J 1HDPA 1KU2A 1DQUA 3F9KA 3QODA 1IW7F 3Q3SA 4GOGA 1DJAA 2XSSA 2A6TA 1JJ9A 3WG7H 1I2WA 2WAQA 4MIMA 1A36A 5FJ8J 2XGDA 2BY0A 1G8XA 3IWQA 3MBZA 3S2WA 3LQQA 2BY3A 2P74A 3JW4A 1F43A 5CVVA 3SS5A 2R92J 5LHGA 2PD8A 1ZTQA 3LFKA 2DK5A 2M7BA 3REOA 1FYMA 4RGRA 3LUQA 3RZOJ 2HKXA 4GZBA 5HD3A 5J8FA 3S3MA 3G42A 4EU0A 4DIQA 5KIZA 3I59A 1KGFA 3H9WA 5IYBJ 3SDBA 4UB6C 2ELJA 3OYJA 1LB2A 1HFCA 3WGHA 1BQQM 5C3EJ 1JE8A 3DWZA 4IEDA 1FT9A 2IS6A 2GXBA 1PWUA 3ERED 5A90A 3WS1A 1S7EA 1FSYA 3BZ6A 2RNJA 2PAVP 1T18A 1GO8P 4DDSA 4CCLA 3FZCA 2DMWA 4HJ4A 4BD1A 4KG5A 4L7AA 2MYSA 2NYXA 3CC2I 3ZG5A 2JSDA 5FKKA 2IWBA 2DT6A 3ECOA 4M3EA 1I2SA 3CPTA 1XX5A 1XGOA 4UA7A 4GLQA 1ALQA 2L4MA 1PP8F 1QJIA 3CMYA 1U9OA 4E70A 3ZMSA 4AIJA 4PSXA 2ISZA 2P6TA 4OPQA 1STZA 2XPUA 1SC7A 2INWA 3LR4A 5FKOA 3T5XA 2VODA 5GL9A 3Q07A 3J81K 3HDAP 3C5AA 4OMYA 4I76A 4MBHA 3T4TA 4F55A 1SFOJ 4XMYA 3KRYA 3DKYA 5M3MJ 4V2FA 1Z0XA 2MLKA 3C7UA 3LSGA 2YKHA 3GTKJ 1UTZA 3JRGA 4W97A 4PGHA 2FV9A 4BL3A 3GFJA 3F21A 4PKSA 2P08A 1K54C 3W2VA 1JAQA 1IDYA 1PWCA 3D4FA 1TWGJ 5JYPA 2STTA 4GXOA 5E1ZB 2V0WA 2W3FA 2OLVA 2XROA 3FYZA 3MFXA 3LNQA 3FX3A 4Z6YA 1CK3A 2A61A 5J8XA 1AKLA 3LSHA 1IRXA 3CO7C 3I53A 1G28A 1EH7A 1O3SA 2W27A 2I9VA 2WGIA 3ZG0A 1N9LA 4H49A 2V9VA 1YJNI 3A02A 2FUG2 1KDWA 1PZPA 4M9ZA 2F5VA 4FT8A 5HPFA 2V1XA 2DQLA 2EV0A 2V1BA 2OPTA 4BBRJ 2ME0A 1D1BA 2OY4A 2W12A 4AIDA 5K5RA 4B48A 4A3MJ 3JYIA 5FATA 4B4ZA 4KYWA 4JOMA 4ETZA 1SAUA 3VP0A 4H8RA 5D1UA 2JPCA 2DDFA 2M3AA 3QP1A 1IKGA 3NAUA 2JT5A 4ZH4F 4N9LA 2DOEA 4WK7A 2VN2A 4QSHA 5TR7A 2E1MB 3KMEA 4AWXB 2JIHA 4R3AA 5KMWA 3VYUB 4HBUA 3I56I 4ARZA 1ERMA 2D1HA 3S1QJ 1MKIA 2FH5A 3VV4A 1H0MA 1T08B 4LCLA 3RIRA 1K56A 3RCOA 4QY5A 4PKWA 4N1HA 2IP2A 1BYWA 4EQQA 2OW2A 1A6IA 2A3SA 1RPWA 3BTLA 5HDCA 4JF4A 4A93J 2IA2A 1JTYA 2V7FA 4OIRF 2GXGA 2O9BA 3I4NJ 2PMZN 2L1MA 1YW8A 4ZTKA 4BMWA 2MLGA 3OYIA 1LT0A 1WVRA 4XCTA 3F1NA 3HLDA 3I7GA 4CCNA 1IN5A 1SLNA 1DGWY 5H6RA 3OSFA 3ZGKA 4IHQA 1I3QJ 3WTWC 1YOUA 2XS3A 4XR6A 4LITA 1DP7P 2QLZA 4HOBA 5IY5H 1OTDA 4NG2A 2UXXA 2E2DA 5TFQA 3QP2A 2LKPA 5J40A 4A6EA 2QYOA 3CESA 4EM0B 4HQMA 3T4KA 3TKYA 3E6CC 2Y2HA 3OIPA 2QQ9A 2CV1A 2XA7S 2H10A 1YLPA 1IXRC 3DPUA 4S2PA 1HSTA 4UA9A 4FXYP 1BM6A 3IP4B 5AJGA 2V1NA 3OYLA 1E2XA 5FQ9A 3OBFA 1BL0A 2A68F 4JQFA 3A2KA 4WKIA 4DE0A 1LDDA 1WJCA 4ZZDA 4XRSA 4BH9A 3G34A 4QD4A 2MFZA 5J6XA 4M3DA 4RQ9A 1K4FA 3V67A 3ROUA 1IGNA 1FWZA 1WPKA 2R7SA 3PBOA 3BR6A 5E2HA 4B93A 4GGGA 3QAHA 1AHDP 1KONA 4ZJZA 3E0YA 3T8RA 2VPRA 4KISA 1W8YA 4D60A 1KQ0A 3O86A 2ZLYA 3ONQA 3G73A 4E6KG 1BOBA 4HQAA 4DJAA 2W4SA 1JGGA 2RJPA 1U9NA 2V26A 3LJGA 3WTTC 1H3QA 2EFWA 2M2EA 3LY3A 1H8AC 3J80K 2QHKA 4N9IA 4S2NA 4JGOA 5C4JJ 1R00A 4B9OA 2VE8A 1S6LA 3I7IA 4IUWA 3JPUA 2VGLM 2B7EA 2WY7Q 2BOLA 4GWNA 5BOTA 3JRIA 1D0YA 2HTJA 3IHAA 2AHQA 2PU4A 1OTIA 5M3FJ 2G0EA 1EJ9A 3ZMTA 2MBFA 3P9CA 3OS2A 2XH9A 1BIBA 5CJ9A 1R1HA 3LUNA 3V8JA 4E7LA 3NIAA 5BPDA 5CECA 1LDJA 3BJ6A 3Q2GA 3CDHA 1DP8A 3EEHA 4I98B 5FAPA 3TP3A 3NJAA 2J5OA 5LFAA 1BI2A 4OAZA 1P0ZA 3F72A 2UV1A 3OS1A 4MGRA 3NC8A 1FILA 2EFNA 2XDVA 1MBJA 1TWCJ 2L4AA 4XRFA 2ZNZA 4E3LA 2EZLA 3LAJA 3MD2A 4HMAA 2PBDP 1MXOA 3HUOA 1E0EA 1VQOI 4FE7A 4N9KA 1W0TA 4ENNA 4X69A 2CGPA 1D06A 1Y1VJ 2K4BA 2F2EA 1YMSA 4R1HA 1ZLJA 1S7OA 2W84A 2DMPA 4M9XA 5HDGA 3D1NI 4OKPA 1IJWC 4R70A 2GBYA 4P5OA 3Q7VB 3HL2A 1YI2I 1MZBA 2ZMEC 4A3KJ 1DDNA 1BR4A 4IOAF 3TJZC 4OMZA 2IS4A 1ZG5A 3BLYA 2R5YA 3E2KA 3BDDA 1U5TB 4G9LA 4BD0A 3RKXA 3BQ8A 4IRHA 1ES5A 3GTLJ 4GR0A 4DN0A 3UDXA 2I72A 3HC7A 4L5EA 1NRFA 1GA9A 1MNEA 2L0KA 1XFVA 2QKLB 4BENA 1K83J 1MNDA 1XMXA 3U4LP 4A0XA 1HW1A 2Z9OA 2E35A 2A6HF 2B18A 1YSQA 2DRWA 3CAXA 4QWOA 4DF9A 1RKWA 5L8MA 5TBMB 1CQRA 2L4RA 1HCRA 1VQ7I 1FZPB 4UV9A 1HF0A 4ZZLA 1VTNC 1G2HA 2TDXA 2EX8A 2EFQA 1EAKA 4HA8A 2BV6A 2HOSA 3KEYA 1GV2A 2R7ZJ 5EF6A 4M6VA 3BRMA 3EEAA 1T33A 4L9GA 2ZJRF 3WV3A 4YWZA 1CF7A 2X6WA 2JUCA 1ETOA 1VEUA 1RESA 1ITYA 4BBSJ 3KMCA 1X4PA 1OISA 4P0MA 1LHYA 4X55A 5CUHA 3WTXC 1XPBA 2QVOA 3PNTA 2GA2A 2WAFA 2X51A 3F22A 5FGMA 5JHFA 4PKVA 3SZPA 2W14A 2UWMA 5DUIA 4AIGA 2OY2A 5CPRB 1UFMA 3RSNA 1UZCA 2XEPA 3O8HA 1UMQA 2QBYA 1HTZA 2JSCA 4E7JA 5D8KB 3HBRA 1W7PB 3L2UA 1WSUA 1MJ9A 2E7WA 4L5JA 2R0QC 1YG2A 3S1RJ 3EDGA 4KQDA 4P9UA 4CJNA 5EPHA 2WADA 1NG7A 5HL1A 3RKYA 4WL9A 4PJ0C 4HX4A 3L09A 1XAXA 2PYRA 3DPTA 1A35A 1D8MA 2LR8A 4C3JJ 4HH3A 3FBIB 2E19A 1K6SA 1TVFA 5J4EA 4LLLA 2XFSA 1J5YA 1P4WA 3EETA 2X1CA 4HF0A 3MAJA 2DQRA 4HESA 4NETA 2BTFP 3WV2A 3K7AJ 3FK7A 1S4RA 1GHPA 4N4OB 5FFZA 2V1ZA 4II3A 1SKOA 1YLFA 3HB9A 3JSPA 4ZYEA 1Y4OA 4XKWA 2QSHX 5G18A 1U3EM 3NOUC 4GDBA 1HKQA 3ZMUA 1FBSA 3K70C 4ZRRA 4DMZA 4K2EA 1VQQA 2WAEA 2LD5A 3BTJA 4B8XA 5IT3A 4DF6A 2M34A 1FBUA 4UHUA 1OT6A 1ZVXA 4PKYA 5LEKA 4MLOA 5HNHA 1ZARA 5CVIA 2BXZA 4MHGA 2ZO4A 1LI0A 4BU2A 4GUYA 4GWMA 4ESPA 3IWOA 5HPIA 2N8RA 1IADA 2NOGA 2Z1DA 3BROA 5FEGA 1EROA 4ANJA 3KWVC 2OSUA 4KT5C 4FX4A 4E3OA 1UGUA 2BEOA 3O5YA 1JWVA 2RV8A 3U9GA 2XGXA 4V19K 3PBQA 2A49A 2DA1A 3CCJI 3PAGA 3KLOA 3AG2H 2TRTA 2R7QA 5DYMA 3USNA 1EW0A 1FLIA 5A92A 2KT0A 3KIOA 3LR0A 5J4YA 1XFWA 1T98A 2LOOA 5J4VA 2CC1A 4ENKA 1TDLA 3IXHA 4ZBEA 1YS7A 1FP2A 1R71A 4QHCA 4IJAA 3I59B 3T4JA 3TG9A 2O8KA 2Y2PA 4DE2A 4XICA 1IXSB 3F0CA 3FV7A 1TWFJ 2DOFA 3ULQB 3PBNA 4BHPA 1R1JA 5D8LB 3NHQA 3UR3C 4IRGA 2JKFA 1N9NA 2K02A 3F1OA 2WTEA 2HPIA 2X1EA 3I7JA 1SVOA 4A3GJ 2OWJA 4ON0A 4HNUA 1H9GA 3G35A 2V9AA 1P92A 1HC8A 1YAXA 4GR8A 2BYVE 2O3FA 4LG3A 2ZMEA 3LFUA 2CUFA 3NBLA 4DJ2A 3E98A 1DRMA 3UE3A 4OH0A 3S17J 3L9FA 2XGNA 1DTHA 2CV0A 3CPTB 1YLJA 1GDTA 1EUBA 1XGJA 2W1RA 3C30A 1KUFA 4GYIA 5FAQA 1YCMA 3VE3A 1Y8QB 5IHVA 2W57A 4WWCA 1CI9A 2HOAA 3A0RA 4M6XA 2EWWA 4PJNA 2VBYA 3B92A 5B3SH 1BKCA 2RN7A 3NX7A 3GFMA 3AL0B 2DCEA 1ETXA 5D6FA 3TDZC 4P6ZS 2OQRA 3RXWA 1HOMA 3HVFA 3CC4I 2MG4A 1NJ4A 3HBUP 1ZRCA 3S3NA 4ZJ1A 4RDUA 2CW7A 1FJLA 2M0CA 4XBHA 4LG0A 2MLRA 2OV7A 1P4AA 2COMA 1G9KA 2P7CB 2ME6A 3UNGC 1A5JA 3K1NA 3UPPA 4HF1A 1OM7A 5M5XJ 4JBAA 1PNEA 5E2GA 5FI6A 1O0TA 3E97A 3UE6A 4GDNA 1K7IA 3TDUC 4XM3A 1BLSA 5M18A 2EIMH 3FWEA 4XLAA 2YPRA 3GVBA 1YS6A 3F1PA 2DPUA 4O7DA 4WEKA 2XHKA 5L07A 1IAEA 2KX6A 1W7PD 3PIOF 2VONA 1YW9A 3BLSA 4DJ3A 3OIOA 2JT6A 3OY9A 2PG4A 1YYVA 3HY9A 4UVCA 3HOYJ 4C6YA 2V4BA 1K4SA 2L2OA 4BUPA 3I5UA 3SOIA 4EETB 4XM8A 2FA5A 1SKFA 4U0YA 1OTEA 1KUHA 3EOIA 2JC7A 2VIXA 5FLXZ 3UE0A 3KEKA 4NK3A 1WJDA 3WRZA 4Y4RA 2Q8KA 1IFQA 3BM6A 3KSHA 2AYKA 4HJ3A 5C4XJ 2VI6A 3HLEA 1AXBA 2Y31A 3GYHX 3UDFA 1EA3A 4II7A 4GHIA 1N25A 3COAC 1OCRH 1L2SA 2XASA 2IGOA 5CX7A 3AYKA 1YIOA 1G3WA 3CUOA 1W36D 3HYGA 1KU3A 2X6XA 4ARZB 3G4PA 4BY7J 1IC8A 2K86A 4F92B 2M1CA 3R60A 2RKHA 1QIBA 3F18A 2I10A 4L63A 4BQAA 3TOBA 1M6KA 4OWRB 2IAIA 5E18F 5IP6A 3N8SA 2FX0A 2R7RA 3V3SA 4LB6B 4N4NB 5CEBA 3LI9A 1QICA 3P01A 5DS9A 1OLTA 4Y0UA 2EWVA 2DYSH 2Y48A 3E7LA 2JA2A 3F6OA 5DFYA 2BY1A 2L7ZA 2JK3A 2OVZA 3VOLA 2OXUA 4M3GA 1F98A 3F1NB 1GO7P 1TZLA 1WI9A 2TCLA 3BFEA 2J3WA 4XORA 1HFSA 4RAYA 2LDUA 1MW7A 1S9HA 1U8RA 1O7EA 3OYGA 3TGNA 4IJOA 4A69C 2HKOA 1UG0A 2E2IJ 5A8BA 2LY9A 1DP6A 3BYDA 2VQHA 1IOUA 1TT0A 2CMNA 3FXOA 4MQ9F 2LREA 3RTRA 2DK8A 1N9BA 3BFCA 3TO9A 1S29A 2VKDA 4BNCA 2WY8Q 4LENA 3JRAA 5FRNA 4O5VA 3HRTA 2Y55A 5D4SA 3F8MA 4P96A 1XFQA 1WE4A 1OCTC 3OPPA 4LMYA 5AQAA 3DBAA 2K40A 1PDNC 3MA2A 2FEZA 3DPFA 2EX9A 5GHZA 3HGGA 1KVMA 3LR5A 2A69F 2MA3A 3J7AY 1KUKA 3UPNA 2DW4A 2HDUA 1VQ5I 3DEWA 1LKXA 4XSZF 3ISPA 4EESA 3F16A 3KE2A 4H2EA 4R4RA 1YOVB 3GBOA 4AYBN 3BQAA 2V9PA 2OXZA 4D7NA 2L7FP 3BW6A 4OINF 4L0ZB 2QJ5A 3CJQB 2VOOA 3NI9A 2HDDA 5GAHJ 2PLYA 3CJTB 3T1RA 3GTGJ 3TS4A 1AOYA 5D3OA 2GZAA 5DFXA 3WODF 2ZFWA 4L19A 1OJ5A 3HG9A 3OYMA 3S93A 4E4HA 2HQAA 1J2XA 1GLNA 1MMQA 3GWZA 5E79C 3R4KA 1JT6A 3LGPA 1BLHA 3SH9A 1LEBA 4OQIA 2RJQA 3VI1A 4BQQA 4JXWA 2OAZA 1KQ8A 2K9QA 1BJZA 3MN2A 5K7FA 2VX8A 1D8FA 3MZHA 1VETA 5AONA 1EI5A 1JJ8C 2JRTA 2C6YA 3CUEA 830CA 1CEGA 1T19A 1MBKA 5E3LA 2Y0SA 1FYKA 4NXEA 3N8RA 1YE9A 3BJNA 1ENHA 4EWFA 2H6BA 3M6HA 2F4MB 1NY0A 3QQAA 1XMAA 4HG2A 2XSDC 4XN3A 2QMIA 5GPAA 1TC3C 1ERQA 1WCMJ 2HYJA 1BZSA 1X2NA 1P9WA 1QA6A 3HKZN 3P24A 4HIAA 1E4DA 2IA1A 5L79A 3D72A 2E1MC 4BL0B 4EATA 3Q1FA 3PXPA 2H8WA 1LUJB 2O61A 1Y0UA 1QUAA 2R5YB 2DW1A 4LIUA 4IVKA 4ID4A 4RA7A 1I5ZA 4I03A 2LKXA 5CYVA 3NDEA 1GE7A 3QU3A 2XF3A 5C5KA 3FXJA 1XB4A 2W0DA 4CPKA 2H1LA 3FF5A 4GN2A 1KVLA 3E5QA 1N78A 3DTEA 1GUUA 2O7OA 1GHIA 4NEED 2GWRA 1ACFA 2LB9A 2DMTA 4ZAMA 5GAGJ 4FE4A 3PO2J 1I76A 2MJ6A 3FBNB 2X3BA 1RR8C 5GADJ 1D5VA 1FTZA 5FLMJ 1SD6A 1K56D 1L0EA 2HV1A 2BE5F 3T1BA 1CF7B 1BLPA 5FSRA 1P6RA 2ZL1A 1VEUB 3CP8A 3E4QA 1S8NA 1QPIA 4DXCA 1UMTA 2HZ5A 1EB6A 1VI0A 4RMNA 4EV4A 2Q9NA 1TDGA 3HBVP 4WK8F 5FO5A 3EWJA 3QWLA 3CZDA 1UTTA 4MNRA 3MXSA 3OCNA 3BQYA 2LP0A 5KHDA 1U2WA 3J7ZI 2DO7A 3I55I 3FC7A 3BY6A 2KRHA 3ZQFA 2ICWG 1WYBA 2WGVA 2QBYB 1SATA 4BEHA 3B8ZA 5K5BA 4JP4A 2DDAA 1TS8A 1JKOC 4S0HB 3E5UA 4BE2A 2KZGA 4J01A 4L9VA 1W5CC 4JYKA 1IF1A 1FR1A 3C7VA 3IH8A 3IBRA 3IHBA 1Y56A 2YUFA 3F8NA 1YFHA 3OWTA 1M40A 4GQLA 3PIPF 4X1LA 1C7KA 3CITA 3GTPJ 3D9YA 2Y0MA 3RYPA 5EVIA 1MBHA 3HIFA 1SVMA 5FLXK 4V2GA 3JRDA 2FF4A 3VFZA 3NEUA 1ZTUA 5AQ7A 2DTRA 2DDYA 1PYVA 3SH8A 3F3XA 1SKOB 3SHFA 4YNRA 5CVUA 1NZUA 2EFOA 1O07A 1GV5A 1RGYA 2W82A 4LV0A 2ZMAA 2VT3A 4XOTA 2ZC6B 4IPAA 2K9LA 3QPLA 1IYPA 3G6OA 3LWFA 2V20A 1U6GA 5J1RA 3M9AA 5DM6F 4RM3A 1OJLA 4A5MA 2LF8A 2IJLA 4U7BA 3K6GA 4X1EA 3HY7A 2YU3A 1BN5A 4EQIA 1V5EA 3HSFA 5ICCA 4OPYA 3GZ6A 5KCMA 5CLSA 1K6RA 4L9NA 1WH5A 2EZHA 1E3UA 1TS7A 1IN8A 3MKZA 2K31A 3O3KA 1Q2PA 1BR2A 3GVAA 2WZZA 3HEFA 3PFIA 3FMRA 5HX9A 4ITVA 5M5WJ 1GSWA 3CQZJ 5G4ZA 2H0YA 2UWXA 4U88A 5AIQA 2F4OB 4G94A 3V42A 1ESIA 1J7KA 2YS9A 1QIAA 2LNBA 1PWGA 1RNLA 3LMMA 1HTDA 4XL9A 1V9ZA 3G30A 4S2OA 4B4XA 3HDBA 4NKPA 2AVXA 4R6LA 2EV5A 2VBXA 4C2UA 1NK2P 4IOCF 1F9NA 4GJ4A 2YSRA 1RIOH 4MCWA 2VV7A 2WB1A 4HLXA 1TS0A 4I0BA 2QA4I 4EJVA 1KGSA 1ZGWA 2M5WA 2E5NA 1XJ6A 2ZMVA 5LGNA 1HV5A 5FI7A 2FMYA 4DW6A 3UPOA 5EJCA 3OSGA 1RRJA 3K4KA 1Y8JA 4CZZA 1MY8A 2KDOA 5HAIA 1QZYA 5HS7A 1IZ1A 1OMIA 3HOWJ 2P6SA 4G3WA 4EVIA 3H5RA 1AKHA 3QNBA 1ERDA 4QKZA 3C4PA 2H28A 4IRIA 4LRZE 4A3IJ 4ZTFA 3WWXA 1MSFC 3W4PA 3F1OB 4OPRA 3LSTA 4PCQA 4IHVA 3ZVWA 1UB9A 2FBHA 1XCVA 2DA5A 3HGYA 4HW0A 4WZVA 2P5KA 2W3EA 2VC1A 1IDZA 3FKWA 2ZMEB 1S72I 2CS3A 3MXQA 4O01A 2GAUA 1T1CA 1BIAA 2O9AA 5CGWA 5A93A 2IEKA 1ZTRA 4HDUA 3RKWA 4AXQA 2DT5A 2JTVA 1ZQ3P 3MS6A 2ERPA 4EEPA 2WBMA 3F19A 1OS9A 2DLLA 1QZEA 3ZXHA 2G9WA 1WJFA 1IV6A 4UQIM 3LIRA 3L7WA 4RX2A 2FMLA 3VDXA 3LL7A 4IN9A 3TMOA 1Z7LA 4GCVA 2IXSA 1B8YA 1A04A 5I5LA 1IG7A 4XK4A 2VGJA 2HQRA 3F8FA 1OT9A 3T4SA 4LG0B 1A6QA 2XK1A 5IPAA 4MN6A 3ZNYA 3LOCA 5D5UB 2VA0A 1JAPA 2JMWA 3EUHC 4HP9A 2ZSHB 1MDMA 1N9OA 1T2KA 3ZDJA 3VYTB 3RKQA 3K2ZA 2VXDA 1K61A 2Y69H 5L3BA 3W8KA 3HB2P 2D1VA 3F1PB 3V7SA 2VUMJ 2E7XA 3DQVC 4CQHA 1V5GA 2M4GA 2Y8HA 4CCKA 3JTHA 1Y1WJ 3HL9A 5LD2C 3EQVA 4H3XA 1G3TA 3KSIA 3LSPA 2MLSA 3CI6A 2LC2A 2MABA 1T6SA 3BC8A 1N77A 1R4MB 1KE3A 3P5JA 3K4NA 3WTUC 1VQMI 1W36C 1A85A 3W2ZA 2VJ5A 3CTAA 4E7KA 2Z2DA 4WZ5C 4HLYA 2X3CA 3E6BA 4B1RA 2PI0A 1ES2A 5J1UA 2OD5A 3F23A 1SVLA 4N9HA 4PAUA 3TW6A 3KZIC 2EA4A 4DYCA 2MZHA 1W63Q 4QPQA 2DAOA 1AWIA 5ILUA 1S1YA 2CMPA 2X48A 1TL8A 3LGOA 2N8GA 4GHIB 1E3HA 3SW1A 1CQAA 1YMXA 5EOOA 3HTSB 2JNPA 2EH3A 1JANA 5GPCA 2EFPA 1XDUA 2DA4A 4QY6A 2QWSA 2V1AA 3H3UA 1SHVA 2VE9A 4IBXA 1DMTA 1XP4A 1AU7A 4A3LJ 4BBUA 1MMGA 1TW3A 3OOUA 4S2JA 1BBYA 3J81Z 4XKCA 3HSRA 4M72A 4PZJA 1BI3A 5DD4A 1NYMA 5HLIA 2CWEA 2XLNA 5F04A 1ODDA 3S32A 1K7QA 2YX7A 3RZDJ 3ZQ7A 4NQWA 2GOMA 4UAAA 2DA7A 3UDIA 1UWPX 3JVUA 3BECA 4ASNA 2NVUB 4O6JA 3H9QA 1F1ZA 4KICA 1H88C 3VMAA 4MDZA 1UG2A 1KDSA 2X02A 4XNFA 3PSFA 1QBJA 1GVDA 1V5FA 5D2BA 3HSEA 5D1TA 1ETVA 5B66C 4LV1A 4WMCD 3UVCA 4LJZF 4IQJA 1WQ2A 3W3CA 1FMVA 5F27A 1GSVA 3F8BA 1T1AA 1YJWI 1OYYA 4JGQA 1ZG6A 3BPVA 4XIDA 3DPEA 3C2HA 1RZ4A 3WS4A 3A0SA 3OIQA 2VPLA 3PNYA 5F1FA 1USSA 2ZSIB 5GTHC 2FNAA 1ETKA 3L2RA 3M4OJ 1FNNA 3EYIA 1MGTA 3GFLA 3RYRA 3L1PA 5CERA 3ZQ5A 2PMHA 2CFOA 2ZB9A 2Y30A 3RTTA 3G1OA 3BFFA 1WA9A 3HZJA 4Q1LA 2E1CA 5JVGF 3OR1C 3NCKA 5I12A 3CJNA 1XPXA 4HH2A 3K9TA 5LGUA 4XN0A 2O8XA 5A91A 1YTYA 4OOMA 4WUJA 3W2AA 1I1SA 4AUXA 5I4OA 4L6TA 1R54A 4IUHA 2L7MP 3L2CA 1F36A 3AL0C 4RB3C 3GLLA 1JI8A 4BQMA 3VB2A 3BFDA 3G32A 5HD5A 3SZGA 3CO6C 1X0OA 1DY6A 2MC3A 4JKTA 3FWLA 1ETYA 3DNGA 3LEAA 2OZUA 5GLCA 5DKLA 3GLXA 4L9JA 2P9VA 1XGMA 2ZQ9A 3LKAA 4C2MJ 4GS9A 5EGOA 3K4BA 2PMZA 3UMEA 1IUYA 2K27A 5I2ZA 1WHUA 3A0BC 1ACIA 2FFFB 4LK1F 1S4SA 1K55C 3SH7A 1LE8A 1Y6IA 3NRVA 4JF5A 4NXBA 2COBA 4G9YA 5H2FC 4EEUA 2L3DA 5CHMA 3IBJA 4XLPF 2ZM8A 3IH2A 4HPQA 1B9NA 3WGGA 4XSXF 4XLCA 2FFYA 5LRSA 2XAFA 5F69A 1NG6A 1FCNA 1VETB 3L9KA 1QHHD 1UMSA 2Y9ZA 2VV6A 3BY9A 4XXRA 2Z99A 3DAVA 1QPMA 3ESWB 1XN7A 5DCMA 4O0PA 1VQ9I 3SFZA 1CEFA 4KZ4A 3FIWA 1TD5A 4H30A 1I1IP 4WN5A 3JVVA 1RETA 2DODA 1IUFA 1BOAA 3A3DA 1MMBA 3H36A 4LK0F 2HI3A 3HDDA 2IPQX 4RAFA 4ZDOA 4KQOA 3KP5A 4EM1A 4RLQA 3AIGA 3CCEI 1O7FA 3GW2A 5C44J 4UEYA 2CQNA 1RM8A 1ONHA 2VC0A 1FIKA 3JR9A 2VZWA 1EF4A 1D0XA 4R23A 2ADUA 3CMZA 1MSEC 1Z21A 5F68A 1SEUA 2Z2LB 2I5UA 3OOPA 1T95A 2RGVA 3BR2A 3DV8A 3U2AA 2A8HA 3AYUA 3ZR8X 1MMRA 1MNMC 1HQCA 4GFBA 3FKIJ 3WU1B 3MMHA 5F5YA 4AFIA 2VB6A 4WCGA 2CUEA 1KGGA 3WTYC 3T1SA 1BKCE 4DZJA 4G3VA 2HEOA 4OONA 3OYHA 3V7RA 1PWDA 4J19A 3J80Z 4O3MA 2QPNA 4CZCA 4KIFA 1TWHJ 3HLWA 2Z6DA 4HJ6A 1U0JA 5D5WB 3EDIA 3K70D 4OOLA 2HQ5A 3LEZA 3M8FA 4NC7A 1VF9A 3SHIA 1B3DA 4WF6A 4BYYA 4IHTA 2M30A 2ZL1B 4D0PA 2CH0A 3ZQGA 3CDLA 1KBCA 2GXAA 3LIBA 5CTMA 4FUWA 1X1AA 2V79A 2R4GA 2R7OA 2ZJ9A 3GRJA 2XD5A 3VPRA 3LQRA 5DJUA 4ZR5A 3MZ8A 5CZMA 1FYLA 2JN6A 3GMEA 3CCMI 3I4PA 1HY7A 4J4MA 4BEHB 1BT5A 3FPWA 3EYYA 3L00A 4EUZA 1KOUA 4RB1A 2QCOA 1ZG3A 3GXOA 4BBVA 1K57C 4Y2FA 3K69A 1YP1A 3HOVJ 1YO5C 5J7EA 3V3RA 5FI2A 3PQJA 1G68A 4A3EJ 2XAUA 1T39A 4B88A 1LLBA 2WC2A 1OPCA 2PMUA 2LVSA 2QENA 3IUOA 5EVIB 3QU6A 3K1PA 4KIBA 3K7NA 3H82A 3LEQA 1OR7C 1TP4A 3CCSI 3HJEA 2K9MA 2P7JA 4BGDA 2ESHA 4ZDLA 4X0GA 2BHZA 1OM6A 2HDSA 4YEJA 1B4AA 4S2NC 1LSVA 2EFXA 3MXRA 3G31A 3SEQA 2MZIA 3ZN1A 2W48A 2OI0A 4AIHA 3DKXA 1RGZA 1MMNA 2JHEA 2HGCA 2WA0A 3QYFA 3QNCA 2HP6A 4B47A 4MBFA 4OQHA 2PQ8A 1ZG1A 2P4WA 4QTRA 4CXFA 2BVMA 4Y15A 2K3FA 1ZKJA 1LPQA 3HOZJ 3GECA 2I47A 2ZD8A 1U60A 3M07A 2VQLA 3E8RA 2XIGA 5K5QA 2BXYA 2QZ6A 2KRCA 4PKTA 5M1AA 1XS9A 2IS1A 5HWVA 4LLGF 4XT2A 1VFCA 3M7GA 3S15J 2ZJ2A 5JR3A 1TBXA 4FH2A 3KYCB 5K5OA 1PYYA 1BC7C 1KE4A 3K4JA 4PMAA 2XA7M 5IOYA 3C38A 5IYCJ 5F82A 5EEGA 3Q5FA 3HOTA 1K55A 3I58A 1JVJA 3PJRA 4WM9A 4IHWA 1SCWA 5L3GA 4KQRA 4G7HF 2HXOA 4X53A 3M2JA 1D7EA 2R7DA 3QP5A 4RAZA 2E2HJ 1Z1DA 1JUSA 1R5ID 3K3DA 2OOLA 4YIIA 3ULFA 3ZFZA 2J7VA 1IYOA 1V4RA 2E8IA 1X58A 5HDKA 3CC7I 2RL3A 3NDGA 2W7NA 5GTIC 2WYXA 3WS5A 4I09A 2HFHA 5B1BH 1AKHB 5E43A 1O3RA 3OYFA 2ACJA 2Y2KA 4CTHA 1MZUA 2XGEA 1C0WA 1I39A 2M87A 1SFXA 1YIJI 5H6QA 1YITI 3V8KA 3Q2HA 4HRIA 1JKYA 1YM1A 3IWIA 4EBLA 5BS6A 1LEAA 3KX0X 3EQUA 3WRTA 4WYYA 2OV5A 4CHUA 2KDKA 3B33A 1FOKA 1ODVA 1QGPA 4FETA 3O6BB 1NLYA 2QGUA 1FP1D 2R9XA 5M19A 3HLBA 2O3EA 4L18B 2XAGA 3CD6I 1DPRA 4BQOA 3T1XA 4JK1X 2NNNA 4K91A 1LDKB 2MSYA 1OYWA 1B1BA 4S2IA 2ZKZA 2IA0A 1KUGA 2QZ8A 1G4DA 1JUPA 1F9IA 3O2XA 1YRNA 5JFRA 4FH4A 1IABA 4F3LA 4LLOB 1SD5A 3CCLI 2XQZA 2H5SA 5TGTA 2ELHA 4KMUX 1VQLI 3RFBA 1Z3JA 2MD5A 4DV8A 5HS9A 1KU9A 1I5QA 2M0MA 4BACA 2DMUA 3CWFA 2X85A 1TW2A 2DI3A 1TF1A 1L0OC 3HXLA 1MDMB 2B9SA 5E1WA 1I3AA 2IBDA 2OLUA 3Q9VA 3VTGA 1EKEA 2W1TA 1H8YA 3DLAA 2X6YA 1J09A 1IO2A 3ZN0A 3IKTA 3ERMA 3FKJA 2FE3A 4EUVA 4RM2A 2D2WA 2A3UA 5F0FA 1UWNX 1X1CA 3MFKA 4Y17A 3CCUI 4HY8A 3IKVA 3MKYB 4JP0A 1GE5A 1LSXA 3IC7A 1QO0D 3N97A 1YPRA 4BE1A 2QPJA 4CGZA 2X3AA 3K4LA 1CK7A 2WWYA 1UAAA 5FDSA 2HNHA 3A3JA 1CIZA 1K57A 4JXSA 4KZ7A 1D8JA 1WJ5A 1SFKA 2M7AA 5EVID 1G6NA 4Y0TA 2MH9A 3JRFA 2A24A 4MEZA 2GA1A 3PYPA 4KDPA 2VKHA 1BQOA 1L6JA 3O2PE 1MIJA 5FAOA 1OR7A 5EVEA 2GOXB 1HLUP 2OTJI 4EERA 1NK3P 3QOEA 3K0LA 5L3EA 1P2FA 1JKPC 3IQAA 2HU6A 2PBIA 4AVZA 4BHBA 4CCOA 2ZQ7A 1DP3A 3HRSA 2Y0SN 1FIPA 4EEFG 4QB8A 4AVPA 2WKQA 4CO8A 2UZKA 1B72A 5HARA 2L01A 2HZDA 3GTQJ 5L3FA 3UN7A 3EDPA 2DA6A 3FXKA 1CAQA 3P9IA 4P55A 4LLNA 1JIWP 2QWWA 2ID6A 3BJOA 4G8XA 4GCZA 4M4XA 2D1OA 4P85A 3DL1A 1Y54A 2FBKA 4PJLA 2VLGA 2Y91A 1FCOA 4KUOA 3OHLA 3S3OA 1IYSA 1YX5A 2ZC2A 3KP4A 1OCPA 5CQEA 1FM1A 1E3UD 1ZS0A 2LY1A 5DF9A 3C1DA 2J5PA 2H6CA 1ES4A 4NQWB 1X1DA 5CVJA 4I3AA 3S1YA 4HOIA 3FDYA 2M8GX 4U7DA 2RVCA 1TLHB 2MC4A 1WFXA 5EE8A 2FD5A 1OJGA 5F0HA 5TGFA 5BOXA 1YLWA 1S5LC 4NXFA 4YFNF 1BM9A 3VSLA 5ICEA 2MH2A 2KDZA 3UB6A 2EB7A 3TT4A 3IH9A 1S1ZA 5KSHA 3RTSA 4A3FJ 1X4OA 1RC9A 3V50A 4BHCA 3SYTA 3G4SI 4KZ6A 3FPVA 1EH6A 1G6OA 4C75A 3E2LA 3ABMH 4MEYF 3LK8A 3E6DA 3KZZA 5FEFA 3CG5A 3IH3A 2HOTA 2PJRA 2B5RA 2HP5A 5MC7A 3OLOA 3VYSB 3RI4A 4JXVA 3GV9A 3RTYA 3OL4A 1B6AA 4ETSA 2OAP1 2LRDA 4OOIA 3PO3J 2HDRA 4N0BA 2RQQA 4XM6A 2YB9A 5DD8A 3AGDA 3QRFF 3KP7A 3PBTA 3VOYA 5A2QK 4XRMA 1IKIA 1ZKGA 1CJFA 3CLQA 5CHUA 1SMYF 3G2BA 1SDEA 2AIGP 4BJPA 3HHHA 3MZYA 1JK3A 2OZRA 1R1IA 4ESBA 3GCMA 4E3JA 4KITB 4U0TA 5CQGA 1PJRA 4MBKA 3NARA 1Z77A 1WGXA 1R5HA 5CGXA 2FOKA 3UB5P 3MKEA 2Z33A 1H89C 3R0JA 4JX6A 3GX4X 3C2BA 1N75A 1BUVM 3MFDA 3LIDA 3T4OA 1TNSA 3DCFA 5K7ZA 4QPOA 2GIZA 5KAIC 2PBYA 5L2FA 2P9VB 4H0EA 1V55H 4GS9B 5EGOB 5BNGA 5DJTA 4K08A 5EM0A 3Q0WA 4GF1A 3NWTA 4ZYGA 1ZHFA 3CLOA 4DE3A 2KIFA 3B6CA 3LJZA 2BASA 1KU7A 4UNOA 2E34A 1LE8B 2NOJB 4L9TA 5E20A 1GT0C 2XDMA 4JXGA 1PW8A 5J3LA 3EHYA 3NECA 3O87A 4KA4A 3GDIA 3ZQIA 3IXDA 1Z6TA 2O99A 3JAMZ 1GXDA 2F5DA 4RLFA 2KIQA 4M3FA 1JHHA 5CXAA 4E6WA 4I39A 3TOAA 2DW2A 2YR2A 1Y28A 3R6SA 2W13A 1XGNA 2OQGA 3GZ5A 1QZZA 1W4MA 3C2WA 2E2JJ 3HPGA 2EZIA 3ZVSA 5DDGA 3RQ4A 1VQKI 4WXCA 5DCMB 1SZVA 3SS4A 1XSDA 2ETHA 2KL4A 1XX2A 4PM7A 1R1UA 3PR6A 1CI8A 3ZQCA 2D01A 1OMEA 4NB5A 4ENMA 2ZNYA 2LFBA 3H0DA 4DYRA 1L0FA 4ETXA 3UO9A 3HPHA 5GP9A 1Y93A 2L9RA 3BG5A 3T8TA 2WO8A 3AAFA 3JREA 1F5TA 3I54A 3F17A 1JWZA 3MEXA 3BR3A 2ZC4B 3WS2A 3CCYA 3V39A 3D5SC 4ZYDA 2AQFA 1FY7A 3HUNA 3VSKA 3N2VA 4KN4X 4CCMA 3MJQA 4FU4A 3RPQA 1OTAA 3AGEA 3HCYA 4LCMA 4A7BA 2F4IA 3TO7A 2JKRM 3S1MJ 3DWKA 1I50J 1TQPA 5KSCA 1FSWA 1KA8A 3DTMA 2O36A 1K79A 5JLWA 1LNWA 2JKRI 3S2DJ 3CJMA 4PM8A 1BI1A 5L09A 2M8EA 4RGSA 4E7ZA 3VOEA 1YLTA 2F48A 2QKPA 1PWPA 1FOFA 4RX3A 2EIKH 5BOHA 1XCBA 1C3BA 5FQIA 2QKMB 4M3KA 1PWVA 3FXQA 4PSWA 2HJEA 3KETA 2L5QA 2FJ1A 2VQCA 5JHUA 3AKZA 4WEJA 4IBRA 1S67L 3EQLF 4A6DA 3E5XA 1XA7A 4IHXA 4FQGA 3P1VA 1OZ9A 1TWAJ 1HSJA 4YFXF 1ZXCA 4YRVA 4GNUA 1CXVA 1AYKA 1D5JA 3CF2A 1JAOA 1QU3A 1SDNA 1ZRDA 4A3CJ 3LJTA 2K3PA 4LPZA 2V6EA 4WMCA 5IOZA 3KEOA 4QJGA 1R4NB 3W2WA 5FD6A 1DGRM 4B09A 3D3OA 2JKGA 2Z6CA 1FCMA 1J7NA 2E36A 3EPZA 1S7AA 2FZ0A 4UHTA 2RDPA 2ID3A 4KFCA 1ULYA 3SJMA 4ESJA 2AS5F 1BR1A 2CKIA 1SMPA 3LSJA 3T4LA 4N92A 1SU3A 4CLCA 1ON2A 1XJ3A 3M8JA 1OYIA 3GSGA 1ZYRF 1MWRA 3HKZA 3BCAA 5LBQA 3RH8B 3NY4A 3Q0VA 3MKLA 4UVAA 1J3WA 4A3WA 4FXQA 2EJRA 3SXYA 2IW5A 4HV5A 1LSWA 5EZGA 1OCCH 4ME4A 3KEJA 3DFGA 5G4YA 4KN7X 5HWWA 3KYDB 3H82B 3MQ0A 1GKDA 2D45A 5F1GA 1IRFA 4II2A 1ND1A 2E1NA 2HVRA 3ZP5A 2HPBA 5F1RA 5E8IA 4XKBA 1KZHA 5EOEA 5DTTA 2YX4A 4BXXJ 3UMDA 3AG1H 2V1UA 5E3OA 4NHJA 4F52A 1K25A 1RCJA 3N8LA 1XFXA 1VQ8I 1DJCA 1T8IA 2WUQA 3LO7A 2DFEA 5IP9J 2DNSA 4K0WA 1MJBA 2PN6A 1BW5A 3D5LA 1BSWA 3LIEA 5FKNA 3MSHA 3UKGA 2CQKA 3ZRGA 2PR6A 2W15A 1R55A 4PJMA 3TO6A 2R93J 3KYLA 2H94A 1IEMA 4G7ZF 3RJUA 4J00A 2QYBA 2Q9MA 4LGWA 3H7WA 5CEDA 4XT2B 2LG4A 4PPRA 3MMYB 3CUEC 3I3LA 3GMWA 2TCTA 3QP4A 4EGZA 2CLTA 1FOYA 2KIMA 1J9MA 3LFVA 5HVQC 2CUZA 2Y4AA 3OYEA 3HJKA 1POGA 2O5RA 4XLEA 1O57A 4NXGA 4JF6A 2DOAA 4Z2YA 2PJTA 1EH8A 2ZJPF 1O3TA 1S3JA 1XUCA 5ED4A 1OO9A 3A3FA 1HBXG 3ZUKA 2R7UA 2QQ8A 4PGGA 1BC8C 2CFXA 456CA 2JPBA 3A4CA 3L0TA 3FHZA 3VP1A 2ZC7A 1MBFA 3DU6A 1G4KA 4O8GA 1GXPA 5K1YA 1YQAA 2ZFUA 1PUEE 4JPAA 3DSLA 3ZMDA 4DDYA 1REPC 2XVCA 2Z5UA 3NWSA 1RMZA 2O0YA 1T0FC 2B63J 4PHTA 2JA6J 2EILH 2VKEA 3L2WA 4C3HJ 3KP3A 5IT9Z 1HLVA 1WYCA 1PUFA 2FXAA 5HZHA 2XAHA 1VQ6I 3VWBA 2EA2A 3GR2A 2Z3YA 4XLFA 2OVXA 4UVBA 1OKRA 1DP9A 1X3ZB 2R3SA 2AXTC 4I99C 3RDIA 1L3LA 1WWXA 4L0LA 4NNJA 2OUMA 2W00A 5LABA 4YIFA 3ZMZA 3VP3A 1K38A 5FQJA 1ZLKA 2KISA 2HDWA 4JPMA 3CMEI 4X1MA 4BAYA 4I6ZA 4AYKA 3FM5A 3NOPC 4ILWD 2DMQA 1F2KA 3WU2C 2L0WA 1MWTA 3IRRA 4R3BA 2F5EA 4DD8A 4AIKA 5F64A 2XKOA 1FX7A 2UV0E 2A6EF 2O9CA 2ELKA 1KYWA 1ROSA 4OAYA 4FHTA 3M2KA 4MN7A 3EGXC 1YRNB 2XKPA 2KRFA 2O9LA 4BLMA 1OCZH 3MVPA 4PFPA 4FOFA 4F3LB 5GLBA 1OQYA 2FNPA 2NRAC 2SRTA 3PAEA 4C2TA 2J83A 5L3CA 4X56A 3L2VA 3JAMK 3KP6A 5GLAA 3MKWB 3GO5A 4EBNA 3F6VA 3KCCA 2W25A 3O8GA 2Y2LA 1ZRFA 1H71P 3MZDA 3UB9A 3TBIA 4E7IA 1XFUA 1E3OC 4HX3A 3BZKA 5FRMA 1TS6A 1BJAA 5E3MA 3GTJJ 2OCCH 1YHQI 2W1TB 3TSKA 5EVIC 4WXHA 3IH4A 2W85A 2XD1A 3Q7ZA 4EJTA 1V3FA 5EV0A 2VL8A 3ZHHA 4WELA 2AQEA 5KK1A 2ZBKA 4LRYC 4U87A 4Q0IA 2VK3A 1DPUA 5K7HA 5BMZA 4C3QA 4XM7A 4CCJA 4HBTA 3ZNTA 2W0NA 2VJIA 3EHXA 2KQRA 3I9V2 3B42A 2DYRH 2W3DA 3CUQA 2ZXIA 4YG2F 4RGUA 2HVQA 1QMEA 4X25A 5ICGA 3OYCA 2BBYA 1H9TA 1ZP5A 2PHYA 1P4XA 1JT0A 3VYRB 2A24B 3F1AA 3Q9SA 1LL8A 3HTUA 4HDVA 5DM7F 3IT9A 3P9KA 2CQ7A 2VGKA 1KQ9A 3IHUA 3IX8A 3H5NA 3A0VA 4EW7A 3H9JA 3HUGA 5LRRA 4WXDA 1BIWA 2ZBBA 1DU6A 3EDHA 2LBFA 3OS0A 4MO7A 5HDSA 3K3CA 3TSGA 3OC2A 2ZQDA 3JCUC 2Y2JA 2MZEA 3QP6A 3QPTA 2DFFA 1ZXVA 1B72B 1YQYA 3TOIA 2RCXA 3LSRA 1LFPA 2HYGD 2Q0OA 1JKQC 2QSFX 2ZOIA 5FLVA 1HOVA 1VHMA 3GTCA 3IF6C 5BQTA 3EDZA 2DFHA 2OA4A 5JYOA 4PK4A
chains in the Genus database with same CATH topology
2W15A 3OS1A 4FETA 4PJMA 4CSWA 1R55A 1N75A 2X3CA 1BUVM 1HA8A 2VJJA 4H3XA 4ZYAA 2WY8Q 2XDVA 3W2VA 1JAQA 1FMWA 3KYLA 3GBGA 1WJBA 3O64A 2O3EA 2IGNA 3LSMA 4PFOA 5FRNA 4C9YA 3BG7A 3MD2A 4BS9A 4HMAA 3CKIA 2VB6A 1BUDA 3BA0A 4J00A 1E0EA 4BQOA 3OYKA 2POJA 4XKVA 4QPOA 2DDYA 2OW0A 1PYVA 1LDKB 1OM8A 2LG4A 4XOPA 2MZHA 3MMYB 4QPQA 4IZZA 1BKCE 1AKLA 5B5PA 1R1JA 2IGKA 3LSHA 3N05A 3IAM2 3OYNA 3OYHA 1IRXA 2CUJA 4ZDPA 1OS2A 4GF1A 3NWTA 2CW8A 3I3LA 3MA2A 1KUGA 3LE9A 5D1SA 3UR3C 2CMPA 2W82A 2X1DA 2CLTA 2L9NA 3DPFA 4XOTA 3LQ0A 3QYBA 3O2XA 3KX2A 3LQBA 3PSIA 3LJZA 4PKUA 1UEAA 3KECA 4E7HA 2K9LA 4AYBA 4CZCA 5HVQC 2CUZA 3OYEA 3DTIA 2LY2A 1CGEA 1SLMA 2NOJB 1XUDA 2O5RA 1JANA 3J7AY 4XLEA 2JNPA 4H49A 1IABA 3K4CA 1U0JA 2HPIA 2V4JC 2X1EA 4P5OA 4RM3A 3D5RC 2USNA 3HL2A 3EDIA 2DOAA 3K70D 2FUG2 1IACA 4U7BA 1KUKA 1DMTA 2PJTA 3EHYA 5D7WA 2P0WA 4HNUA 1MMGA 2F5VA 3K6GA 4LIVA 4AU7A 4NC7A 3PL8A 1USNA 3SHIA 3OOUA 1B3DA 1XUCA 1BR4A 5TGTA 1OO9A 3HY7A 3ZUKA 3M1CA 2R7UA 3IAS2 4GR8A 1D1BA 1LKXA 4XKCA 1GXDA 2OY4A 2W12A 4LG3A 3F16A 1Z3JA 3H9GA 2IS4A 4H2EA 3LMCA 1S4BP 4RLFA 3LSIA 1V5EA 4WF6A 3BLYA 2J0TA 4WKEA 4B48A 4ZR5A 3LSKA 3LFUA 1G05A 456CA 5CXAA 2CH0A 3GBOA 3A4CA 2PJRB 3L0TA 4DV8A 4XONA 5KCMA 4G9LA 2DW2A 1KBCA 3L2QA 2OXZA 4BJ5C 3DU6A 2M0MA 2K2GA 4BACA 2W13A 4GR0A 1X1AA 4PUSA 4B43A 1G4KA 4JOMA 2X85A 4JA1A 4D9JA 4H76A 2R4GA 3HC7A 1DTHA 2VLAA 2CV0A 2ZFUA 4JPAA 1EUBA 3HPGA 1MNEA 3K4MA 3S32A 2R7OA 1K7QA 1SAUA 1XFVA 2DW0A 3DSLA 3HXLA 3ZVSA 2JVGA 3RQ4A 1KUFA 3MKZA 2F6CA 2QKLB 2KL4A 3H5AA 3CJQB 1MNDA 3NWSA 1GE6A 1BR2A 2GOMA 1KAPP 1RMZA 1YCMA 3VTGA 2KHMA 4KJZA 1T0FC 5D1UA 2XF7A 1PWWA 4ITVA 3U21A 2Y6DA 4G0DA 4B3XA 2R7VA 3DLAA 5KNLA 2DDFA 4KT6A 2X6YA 2M3AA 2JUGA 3OR2C 4XQFA 3L2WA 4NUBA 3H0DA 3CP2A 1J09A 2X7MA 1CGLA 3LUMA 3E1SA 5CZMA 4PJNA 4EFSA 3DPLC 4CUGA 1UELB 4L19A 2JT5A 4DF9A 3CJRB 3HUGB 3B92A 4WK7A 3V42A 3HG9A 1BKCA 3OYMA 3NX7A 3HPHA 1CQRA 4C30A 3S93A 2E60A 1QIAA 4E4HA 2HQAA 2Q2EB 1Y93A 3FKJA 1GLNA 1IAGA 3VWBA 4FVLA 3AL0B 2E1MB 2DCEA 2IGMA 3H9QA 5CKTA 1MMQA 2WO9A 2WO8A 1K6YA 1HY7A 3KMEA 3LMMA 3EUKL 1QJJA 4J4MA 4RM2A 2LBFB 3WV1A 1HTDA 2XSJC 5BPAA 4XL9A 4XLFA 4BEHB 4DPEA 2JIHA 2OVXA 1X1CA 1OMJA 5JMYA 3LGPA 3H35A 1K7GA 3HDBA 3F17A 3VYUB 4XNFA 1EAKA 1D7XA 1MMPA 3MKYB 2RJQA 3VI1A 4BQQA 1A86A 3PSFA 2V9KA 1XFZA 3HBUP 1GE5A 2A5WA 2I8DA 3KEYA 1V5FA 4P1WA 4BE1A 2QPJA 3D5SC 3DWLE 2X3AA 4C2UA 5D2BA 2AQFA 3S3NA 4Y33A 5D1TA 3K4LA 3A1YA 2DT7B 4NNJA 2OUMA 4XLHA 2CW7A 2W00A 3RPUD 3VSKA 4HNTA 4CCMA 1CK7A 4IQJA 2IS2A 3N2VA 4XBHA 3W3CA 1UAAA 2OI0A 4FU4A 1YP1A 3WV3A 3RCOA 1FMVA 2X6WA 2MLRA 4PKWA 5LABA 2KZVA 2HNHA 2WB1A 2OV7A 1CIZA 2OW2A 4A7BA 4DOZA 1G9KA 4DBQA 1D8FA 2F4IA 2RNGA 3UNGC 2XAUA 3KMCA 1X4PA 3DPEA 966CA 2E5NA 2HDWA 5CUHA 3C2HA 5I43A 1WJ5A 2LYCA 1SFKA 2M7AA 3PNTA 1OM7A 1R6RA 3IUOA 3OIQA 3ZXSA 1HV5A 2V7FA 2VPLA 2R7XA 4DBRA 830CA 4H84A 4AYKA 3DU5A 2YIGA 4ILWD 2O36A 2WAFA 3FHNA 3PNYA 2D1NA 2ZSIB 4JQGA 3K7NA 1O0TA 1OR7C 1D1CA 3K4KA 3L2RA 1Y8JA 2Y0SA 1XURA 4HSTA 4F93B 1K7IA 2VQGA 3SEZA 4XM3A 2K9MA 2X51A 2VKHA 2KDOA 2HU9A 4BGDA 3OYIA 1BQOA 1L6JA 2CFOA 5JHFA 4PKVA 4ZDLA 4PKRA 3RTTA 2W14A 4X0GA 4XCTA 4BQNA 1ASTA 1OM6A 4DD8A 3I7GA 4XLAA 4BDZA 2UWMA 1YE9A 2GOXB 4CCNA 1SLNA 4Q1LA 4YEJA 4AIGA 5I3MA 2UUZA 3OR1C 1DGWY 5CPRB 2OY2A 3H5RA 4E7ZA 3RSNA 5I12A 1DQUA 1X1BA 3F9KA 1ROSA 3QOEA 3QODA 3ZGKA 4OAYA 3ZCOA 2L7KA 1IAEA 2CV2A 3BCBA 3SEQA 1ERDA 1PWPA 2MZIA 1YOUA 4QKZA 2XS3A 4XR6A 4HG2A 4LITA 1FLSA 2A6TA 4XN3A 4XN0A 3HOSA 4E7JA 2HU6A 1JJ9A 3DKXA 3QYEA 4AVZA 3L2UA 2Q1ZB 1MMDA 2QKMB 3LIKA 1PWVA 4CCOA 2MD0A 1DP3A 4PSWA 3K10A 2JVHA 4ZTFA 2L5QA 1MMNA 3W2AA 1BZSA 3OY9A 2JT6A 2WAQA 3KHIA 5I4OA 4L6TA 2VQCA 2WA0A 2LH9A 3QYFA 4PFPA 3AKZA 1WJEA 1JIZA 1R54A 2E2DA 3EDGA 3HY9A 4GR3A 3P24A 2HZDA 3CESA 1C8TA 3B2ZA 3TVCA 2WADA 2SRTA 2V4BA 4D1QA 5L79A 3AL0C 2E1MC 1G8XA 4PKQA 1NG7A 1GKCA 4BL0B 2L2OA 1G12A 1G49A 4EATA 3P1VA 4BUPA 1P9QC 4WZVA 5B5OA 1MNCA 4C2TA 2J83A 2BW3A 4B47A 1JI8A 1ZXCA 3L2VA 1CAQA 4YRVA 1ZTQA 4HSRA 4Y3OA 1JIWP 2XS4A 1CXVA 3DWBA 4XM8A 1QUAA 2KMUA 2DW1A 2BVMA 3OIPA 4LIUA 2CV1A 2D1OA 1AYKA 3MKWB 3TS4A 2CS3A 3DPTA 1D8MA 3DL1A 2M7BA 1D5JA 4ZC3A 3CF2A 1KUHA 4YELA 1KUIA 3DPUA 3ELMA 1JAOA 1H71P 2R7TA 3FBIB 2E5ZA 4PJLA 3PFYA 3SZGA 1QU3A 2VIXA 2I47A 3UVCA 3KEKA 2VQLA 3OHLA 3CMMA 3E8RA 4I03A 3S3OA 3TBIA 1WJDA 4E7IA 1YX5A 4Y4RA 3S3MA 1XFUA 2HPMA 3G42A 1GE7A 4FXYP 1BM6A 4ZTJA 5CQEA 4HX3A 1FM1A 4DIQA 3IP4B 2DJIA 2X1CA 1ZS0A 4E7SA 1X19A 3LJTA 4H82A 2AYKA 2K3PA 2OXWA 4PKTA 2KRCA 2LY1A 3DNGA 3U1RA 2R7WA 5FRMA 3WV2A 2OC6A 4R79A 3LEAA 3DEEA 2V6EA 4AXQA 3AFHA 4NQWB 1X1DA 2V1NA 3SDBA 2IS1A 2ERPA 4N4OB 1I73A 1XFYA 2ELJA 3OYLA 4FASD 4II3A 2WBMA 3W2WA 4DGWB 3OYJA 3TSKA 3LKAA 1DGRM 2XF6A 2OW1A 3F19A 3FDYA 1OS9A 1HFCA 3K4BA 2PMZA 3L0VA 4AUOA 1BQQM 2W0DA 1J7NA 2MC4A 3EPZA 3ZXHA 1WFXA 1IAAA 4JQFA 1EA3A 1YX3A 4F3QA 3A2KA 1N78A 4XKWA 3DTEA 5I2ZA 4WKIA 1JH1A 2KP6A 4BJ6C 1WJFA 3K4JA 2VL8A 1WJAA 2Z16A 2IS6A 3LIRA 1WJCA 3CZ6A 1PWUA 2XF5A 3VDXA 3E0JB 3G5CA 2IGOA 3K7LA 5L7FA 3K70C 4BXFA 3LL7A 1Y6IA 2AQEA 3VSLA 3TMOA 4IN9A 4JIJA 3AYKA 1Z7LA 1BR1A 2Y6CA 2MFZA 2CKIA 3TT4A 1SMPA 4BE0A 2IXSA 1AA7A 1W36D 1B8YA 1I76A 2WAEA 3HYGA 3HOTA 4U87A 3PJRA 1SU3A 2X6XA 2R7SA 2DXIA 3RTSA 3FBNB 2X3BA 2KRJA 1X4OA 4H1QA 4IX7A 4BDYA 1KONA 3SYTA 1GO8P 3OL3A 3M8JA 4CCLA 4ZJZA 1BKCI 1D1AA 1Z3XA 1Y0VA 4F92B 2L9SA 4KISA 4IQ4A 4HPQA 5BOYA 3C2GA 2BVLA 3BG6A 2VASA 2KLOA 3HKZA 3BCAA 2MYSA 4L7AA 4XM7A 5D3CA 3ONQA 4CCJA 4GRIA 2L0RA 3LK8A 4E6KG 1AF0A 2JSDA 2JSPA 1BOBA 4XLCA 2VJIA 2RREA 2W1OA 2PJRA 3EHXA 1ZVXA 2KQRA 4DJAA 2W4SA 1QIBA 3F18A 2E3XA 1QHGA 4B44A 4MLOA 5HNHA 1NG6A 4L63A 4A3WA 3CP8A 4FXQA 1ATLA 1G59A 2DT6A 3I9V2 4OWRB 4CH7A 2RJPA 4CA0A 3VYSB 1QHHD 2V26A 1UMSA 3LJGA 5H8XA 2ZXIA 1UMTA 4BU2A 2HVQA 2R7RA 4GUYA 1EB6A 3OYCA 3KEJA 1O0QA 3OL4A 4RMNA 4N4NB 1JAPA 2LRDA 4GWMA 3EUHC 4G6TB 1ZP5A 1CGFA 3VYRB 3HBVP 2ZSHB 1QICA 2RQQA 5HLTA 4XM6A 3I7IA 2N8RA 1QJIA 2YB9A 1IADA 1OLTA 4NC8A 3EWJA 3F1AA 3LILA 4IUWA 1LVKA 3VYTB 1UTTA 2Z1DA 2JA2A 2EROA 1GKDA 1C3IA 3N2UA 5HNFA 2Z2SB 3OMYA 4PJJA 2VXDA 4II2A 3EUAA 1ND1A 4H30A 1I1IP 2FV5A 2OVZA 4PSXA 2HVRA 2WY7Q 2BOLA 5HOOA 3HB2P 4ANJA 2OXUA 3KWVC 2W7NA 4XKBA 3H5NA 5KHDA 1MMBA 1GO7P 4GWNA 5BOTA 3OHOA 1TZLA 5I0LA 4F91B 3PUBA 1D0YA 2TCLA 3H9JA 2ZXHA 2M4KA 2HVSA 1VZ0A 2KRHA 4ZDOA 4XORA 3DTKA 1HFSA 1BIWA 2VXZA 3LUNA 3OYDA 3HDAP 1Q3AA 3DQVC 3OYFA 2KPMA 1V5GA 1ZELA 1MW7A 2M4GA 3G2BA 3EDHA 4RLQA 3TL4X 4F52A 1SATA 2LBFA 3OS0A 2AIGP 1S9HA 3AIGA 4CTHA 4CCKA 4BEHA 3B8ZA 4JP4A 1XFXA 1JK3A 4R3VA 3OYGA 3OS2A 5LD2C 1RM8A 4F55A 2MZEA 3PNVA 1R1IA 2OZRA 4IJOA 1R1HA 1UG0A 4XMYA 4BE2A 3KRYA 1ZXVA 3ZQQA 3DKYA 3Q2HA 4HRIA 4KITB 1JKYA 2R7QA 2ERQA 1D0XA 1MMAA 3S8PA 4J01A 4E7LA 1D0ZA 2VQHA 1YQYA 3USNA 1TT0A 1WNIA 5CQGA 3V96B 1SRPA 2MLSA 2WOAA 1PJRA 2OW9A 2LC2A 1Z21A 2MABA 3BC8A 1N77A 3LSGA 1LFPA 2LREA 3RTRA 3Q2GA 4I35A 4H4KC 2BW3B 1UTZA 3D5LA 5FROA 4ON1A 1Y56A 2YUFA 1T95A 4HEA2 1BSWA 3K4NA 2K5CA 1W36C 1A85A 3OWTA 1FBLA 2VJ4A 2VJ5A 4GQLA 4E7KA 2FV9A 2Z2DA 1HOVA 4IKFA 1C7KA 1PWQA 1XFWA 3ZRGA 2LOOA 2XC7A 2A8HA 5LFAA 2K9CA 3OYAA 2VKDA 3AYUA 4OAZA 3ZR8X 4BJTA 3OYBA 3EDZA 1Z3YA 1MMRA 4PKSA 2UV1A 4PK4A 3F15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTE A;  3DTI A; 
#chains in the Genus database with same CATH topology
 1IN6 A;  3WE3 A;  1FMW A;  2HZT A;  2Y9Y A;  4C9Y A;  4BS9 A;  1CQT A;  4DRT A;  3Q81 A;  1BUD A;  1MD0 A;  2ZXJ A;  2O03 A;  2OU2 A;  4EJO A;  3H1C A;  4I3J A;  2R7F A;  4LFU A;  5B5P A;  5J47 A;  3N05 A;  1E17 A;  1R58 A;  5D1S A;  5DTK A;  2VBZ A;  4WF2 A;  3BQZ A;  3IXB A;  1UEA A;  4E7H A;  3W6K B;  1FBQ A;  2V4J C;  1FIA A;  2X01 A;  2USN A;  1XGS A;  3PBS A;  3KO6 A;  2V8F A;  3E4P A;  3R7W A;  1LVA A;  4L0Y B;  1FOW A;  3W6J B;  3M6B A;  1NYY A;  2PJR B;  3FXU A;  4D5C A;  1BSG A;  5M5Y J;  2LKS A;  1MKM A;  4JA1 A;  4I0A A;  4D9J A;  1B8I A;  2LMD A;  4LD5 A;  5F83 A;  3H3V K;  2F6C A;  2KHM A;  1MMS A;  3ZVT A;  4AC0 A;  4KT6 A;  1A31 A;  5LEJ A;  3CP2 A;  1CGL A;  3DPL C;  1T0F A;  4WBG A;  4DYQ A;  3CJR B;  5E17 F;  1IV8 A;  2WAQ N;  3MWM A;  3BT9 A;  3WV1 A;  2ACG A;  3GF2 A;  1TTY A;  1MMP A;  4HNV A;  1A86 A;  3AG3 H;  5HAQ A;  5DTS A;  1W5S A;  2XFT A;  4Y33 A;  2DT7 B;  4XLH A;  1J9I A;  1YW7 A;  4FD8 A;  3KEQ A;  1K54 A;  5DV5 A;  3PQK A;  4D2O A;  3DXJ F;  5IS1 A;  2WKI A;  2X6O A;  2NXN B;  1QMF A;  1T1B A;  3LI8 A;  2HTS A;  4IO9 F;  1WH7 A;  3ZXS A;  1ZAO A;  4JX4 A;  4BBT A;  1XUR A;  1J75 A;  3SEZ A;  4H6J B;  3GZN B;  5ILV A;  4HHD A;  3ZMV A;  1AST A;  3SZT A;  4BDZ A;  5EFW A;  4GKU A;  4XUZ A;  4P6B A;  3ZCO A;  1P9R A;  3LIC A;  4RYE A;  1IRG A;  1FLS A;  1FEX A;  3UB8 A;  3LIK A;  3GEZ A;  1RKT A;  1P7I A;  4K0X A;  1W5D A;  5GHY A;  1JIZ A;  4GR3 A;  1WJE A;  4HBL A;  3P7N A;  4JLF A;  1C8T A;  2NVX J;  4KMF A;  2HXI A;  3KSF A;  2XV4 S;  5FAS A;  4EQ1 A;  3ZYT A;  1ES3 A;  1J59 A;  4ZC3 A;  1VM1 A;  5HDD A;  4KZ9 A;  2E5Z A;  4ZYH A;  1IAW A;  4Y0O A;  2ZQ8 A;  5LGT A;  1GVJ A;  4E7S A;  3U1R A;  2R7W A;  2CU7 A;  2FQ4 A;  1WKM A;  3AFH A;  2P5L C;  4IJG A;  2JA8 J;  3T4Q A;  3DP7 A;  4FAS D;  2PJP A;  1I27 A;  5IT9 K;  1R7J A;  1D3Y A;  1JH1 A;  2KP6 A;  4BJ6 C;  3W4Q A;  2XF5 A;  3E0J B;  2QEX I;  2G2U A;  5U47 A;  3WHC A;  3IS2 A;  3ICY A;  3ASO H;  4BE0 A;  2VGL S;  3FMS A;  2Y2O A;  3ECH A;  1IN4 A;  3B3X A;  1BKC I;  1Z3X A;  2L9S A;  5EZH A;  5D3C A;  1NWZ A;  3MZF A;  4GRI A;  3UNW A;  2K85 A;  5CHJ A;  3OOV A;  4B44 A;  5TJJ A;  3EWK A;  5B5E C;  4CH7 A;  3S7P A;  3BJA A;  2ZOH A;  1ZK8 A;  4I2O A;  4MNU A;  3B47 A;  5J8C A;  4RS8 A;  4MTD A;  1C3I A;  5HNF A;  3OMY A;  4PJJ A;  4KG2 A;  2KOI A;  4GD8 A;  3EUA A;  5HOO A;  4OLG A;  3IV5 A;  3HRU A;  3EGD C;  1LL5 A;  2ZXH A;  2M4K A;  5GHX A;  2ZQA A;  2G2W A;  1XM5 A;  4Q4Z F;  2L02 A;  1LI9 A;  3BOQ A;  4KZB A;  4UUS A;  1W1W E;  2K2G A;  3B73 A;  2OW9 A;  2AXL A;  3RPU A;  5EEA A;  2XAJ A;  1OCO H;  4ON1 A;  1ETQ A;  2W3H A;  4LOC A;  4I38 A;  3K2N A;  3ABL H;  3U1D A;  4WLA A;  4IKF A;  2HYF A;  2K9C A;  2FU4 A;  2WKH A;  1ONG A;  4IVN A;  1OFC X;  4OPZ A;  4ZYA A;  1ZC2 A;  2GM4 A;  5D6E A;  3HBL A;  4PM5 A;  4DZP A;  2DDB A;  4E3M A;  3IF6 A;  2ESN A;  5KZH A;  3CKI A;  3BA0 A;  3OYK A;  2ZCW A;  3SQN A;  2OW0 A;  2E71 A;  2K9S A;  3OYN A;  4EGY A;  4ZDP A;  5AVF A;  2ZC5 B;  2EXA A;  5I94 A;  2LB5 A;  2L9N A;  3QYB A;  3KX2 A;  3PSI A;  4FX0 A;  2WGW A;  2OCE A;  3FM3 A;  1MBG A;  5EUA A;  2LY2 A;  4M73 A;  4G12 A;  3D5R C;  4OOY A;  4F94 A;  4EMS A;  1R1T A;  1W5T A;  1B59 A;  3FXR A;  2V6C A;  3KFW X;  4CLC B;  2P0W A;  5TIS C;  4AU7 A;  4ABZ A;  4HX8 A;  3M1C A;  5EYR A;  3H9G A;  2J0T A;  3BTC A;  1PZO A;  4XON A;  2WK0 A;  4BJ5 C;  1Q2Q A;  3PHY A;  2VLA A;  3TP0 A;  4RB2 C;  4IHS A;  5B1A H;  2LTP A;  2Y2M A;  3BY8 A;  5ERI A;  2HF6 A;  2OF7 A;  3NQO A;  3T50 A;  4EV0 A;  2CW0 F;  4M71 A;  5EG0 A;  3S7O A;  1I6H J;  4B3X A;  2HOE A;  5DTD A;  2CSO A;  2JUG A;  4XQF A;  2HJ9 C;  1ETW A;  2CO5 A;  3OPL A;  1ZG4 A;  2CJJ A;  4KZ3 A;  2E60 A;  5FKM A;  5DVA A;  4JBF A;  2Y75 A;  5CKT A;  4I7H A;  5F6A A;  1NRJ A;  2VOP A;  4KG6 A;  2DA2 A;  1YT4 A;  4JX5 A;  1D7X A;  1XA1 A;  4OIP F;  1XFZ A;  4S04 A;  2A5W A;  3MQO A;  4UA6 A;  3CCQ I;  4HQE A;  3M3Y J;  3BWG A;  2Y2N A;  2Y59 A;  4WZ4 A;  5L3D A;  2C6W B;  1VB6 A;  3FXM A;  2RNG A;  966C A;  4Y13 A;  1O3Q A;  4WF0 A;  2V2F F;  3L7H A;  3OPR A;  1D1C A;  3C8C A;  1PP7 U;  4F93 B;  3I64 A;  4MFE A;  4YFK F;  3FXL A;  3H7W B;  3DW0 A;  1Z6F A;  2WZX A;  3RQI A;  3H0G J;  3LCE A;  3N4M A;  1X1B A;  2EPF A;  2CV2 A;  3CMA I;  3KPH A;  3P09 A;  2MD0 A;  4CYC A;  3B02 A;  3B6A A;  1S6R A;  1IXC A;  1TNT A;  3DBR B;  4A12 A;  4ESF A;  2EK5 A;  3TVC A;  5B5O A;  1XC5 A;  2BW3 A;  2XRL A;  4KEN B;  3CF5 F;  2KMU A;  1U8B A;  1JHF A;  4FCY A;  1X3U A;  4UB8 C;  3IL2 A;  5FA7 A;  3FIS A;  3G2Y A;  1X3W B;  3WHB A;  4JGR A;  1K78 A;  1JJ6 C;  3Q82 A;  1MH4 A;  5H20 A;  1TEM A;  4R79 A;  4FIS A;  3RJP A;  3GTO J;  1I73 A;  1SD4 A;  4DGW B;  3S22 A;  2OW1 A;  2XGC A;  3L0V A;  3R61 A;  3V4G A;  1IAA A;  1YX3 A;  1PUF B;  2Z16 A;  3CZ6 A;  2GZW A;  3LIF A;  3K7L A;  2OZ6 A;  4BXF A;  2O6G E;  2G7U A;  2GQQ A;  2M1B A;  4YOF A;  4MFD A;  2QQB A;  3NUL A;  1VQP I;  3W6V A;  2PU2 A;  1XD7 A;  3G1L A;  2PX9 A;  4OLD A;  3BFG A;  2J9P A;  1D1A A;  1ZRE A;  3HOX J;  2VAS A;  1FSH A;  3CCR I;  5HS8 A;  3LY4 A;  4XBF A;  5JVT A;  2J80 A;  1G59 A;  1HD8 A;  3ABT A;  4M6Y A;  4YIN A;  1LJ9 A;  4ZJ3 A;  1TQI A;  1CGF A;  1ON1 A;  1XXM A;  3MCZ A;  2Y2G A;  1JTG A;  2Z2S B;  2OAQ 1;  2FV5 A;  4C3I J;  3HM5 A;  4XLN F;  2BHY A;  1LFU P;  2LF7 A;  5I0L A;  2Q2E A;  1W63 M;  3OV8 A;  2ZJQ F;  5E1X A;  2IT0 A;  4MQV A;  3SFI A;  4R3V A;  5FD5 A;  1QNT A;  4A5N A;  3KSG A;  1ZH5 A;  4E6X A;  1PRQ A;  1E3P A;  5KAF C;  1WNI A;  2DMN A;  2WOA A;  4LB5 A;  4I35 A;  4H4K C;  3IXG A;  1XKZ A;  3LIA A;  4HEA 2;  1LQ1 A;  4EXO A;  4E3K A;  1PWQ A;  3WTV C;  3OYA A;  4A5R A;  2H1K A;  1HA8 A;  3BWL A;  3WU0 A;  3I4M J;  2ZXW H;  3O64 A;  1R22 A;  4PFO A;  3IWZ A;  5CXW A;  2JZY A;  5HW3 A;  5JI6 A;  1HW5 A;  4OVD A;  4I3I A;  3A3I A;  2EQR A;  2JQ7 A;  3IAM 2;  3BG9 A;  2CUJ A;  5FQM A;  2K2N A;  3DTI A;  1W7F A;  1UHW A;  2W24 A;  1XUD A;  3MQQ A;  4DE1 A;  2F5C A;  2XPV A;  3F8C A;  3VOD A;  2R5Z A;  4CLC D;  1IAC A;  3ABK H;  1T56 A;  4LIV A;  1UST A;  3PL8 A;  4Y3I A;  5LLQ A;  5LBR A;  4RBO A;  1P97 A;  2CQX A;  2Y2Z A;  1MPL A;  5FFX A;  2GJ3 A;  2EXB A;  3V8L A;  3CUQ B;  4PUS A;  4B43 A;  4RB0 A;  3K4M A;  3HUM A;  2PRF A;  2FQ3 A;  2DW0 A;  2VKS A;  3H5A A;  3BR1 A;  5ILS A;  3BG3 A;  1KAP P;  3T12 B;  4U0V A;  3U21 A;  2Y6D A;  3BPX A;  5KNL A;  3GQZ A;  2DA3 A;  4NUB A;  1UEL B;  2OWH A;  2NUT C;  4RVA A;  3HUG B;  4PDK A;  2STW A;  1VND A;  3QHY A;  3A0H C;  3JRB A;  1K6Y A;  6PAX A;  2B0L A;  1QJJ A;  2LBF B;  4ZDX A;  5BPA A;  3S2H J;  1B9M A;  4DPE A;  1XMK A;  3BLM A;  3C7J A;  2HS5 A;  2WKE A;  3C4O A;  2I8D A;  1XTA A;  3DWL E;  3ZG7 B;  4D7M A;  3A1Y A;  1R49 A;  3I71 A;  2LSO A;  2VT2 A;  5F08 A;  2KFD A;  4IHY A;  4DOZ A;  1IEL A;  2K7S A;  2A05 A;  2WV1 A;  1LFB A;  2IVM A;  4G3K A;  1RUO A;  1I6X A;  3DBH B;  3KZY A;  2ISY A;  2VQG A;  4HNB A;  1MWS A;  1QVU A;  4I5S A;  3FZV A;  2DTZ A;  4YIR X;  5CRF A;  4FCF A;  2EWN A;  4S2K A;  3QYE A;  2GNX A;  4CLC E;  2G7H A;  2JVH A;  3KHI A;  1JKR C;  4D1Q A;  5DUK A;  2XPW A;  1G49 A;  1G12 A;  5E8G A;  3R7W B;  3BZC A;  4Y3O A;  2XS4 A;  3DWB A;  4QLC U;  3TW8 A;  3JRH A;  3E4O A;  1KUI A;  5EEH A;  3IF5 A;  1YKD A;  1ZGA A;  2A2L A;  3PFY A;  2NS7 A;  4X6A J;  2HPM A;  4ZTJ A;  2Y2I A;  4Z1W A;  1B8I B;  2DJI A;  2OXW A;  4P87 A;  1GA0 A;  4XRS G;  4QIW N;  3OZH A;  4G6Q A;  1IYQ A;  1HZO A;  2R9W A;  1XFY A;  4DNC A;  2XF6 A;  3HLC A;  3MR0 A;  2B95 A;  1WJA A;  3SS3 A;  1RR7 A;  2HDC A;  5L7F A;  1N4O A;  2MW8 A;  1MBE A;  4IVI A;  2Y6C A;  5E2E A;  5F0C A;  1FOX A;  1AA7 A;  2BG1 A;  2FBI A;  2DXI A;  2KRJ A;  2YUS A;  2EIJ H;  3KYZ A;  1UHM A;  3IX3 A;  2J3T D;  5IP7 J;  3O88 A;  1ZGJ A;  2K7L A;  1EV7 A;  4IQ4 A;  1QRY A;  5HAP A;  1AF0 A;  2RRE A;  3RXX A;  1ATL A;  3WG9 A;  5H8X A;  3AG4 H;  4G6T B;  3A01 A;  1D1J A;  3LIL A;  1LVK A;  5FKL A;  3S7N A;  2ZM0 A;  1Y8R B;  3N2U A;  4OU0 A;  2W3G A;  4DQ2 A;  1X1P A;  2C5W B;  2JKT M;  1L0G A;  5IU1 A;  4LV2 A;  1W0U A;  3VFF A;  3VEP A;  4GYG A;  2P04 A;  4HYE A;  3DTK A;  1X2M A;  2VXZ A;  4M74 A;  2M9H A;  2JKT I;  5D5X B;  4F7Z A;  2JN7 A;  3ZQQ A;  1MMA A;  2P8T A;  3GTM J;  2EX6 A;  2XUB A;  1Z67 A;  1TQM A;  1UCR A;  1FBL A;  2NAZ A;  4UXN A;  3IWF A;  2XB5 A;  2X9D A;  4R8H A;  2XC7 A;  4BJT A;  3OYB A;  1Z3Y A;  3G3Z A;  4R3J A;  3QOP A;  2VJJ A;  1Z09 A;  3U2R A;  1GCE A;  2JJ7 A;  1BLC A;  3ELK A;  4XOP A;  4IZZ A;  3M8E A;  2IGK A;  5FQK A;  4OQG A;  4HZF A;  5FDH A;  3H92 A;  3LA3 A;  4LV3 A;  4PKU A;  4KUM A;  4MEX F;  3ZQH A;  2NS0 A;  2DCF A;  2YKF A;  2VBW A;  3IS2 B;  3S1N J;  1PFL A;  5A2Q Z;  3HLF A;  4OP8 A;  1OTB A;  3GUD A;  1CGP A;  1I1G A;  5D7W A;  1IN7 A;  2A5Y B;  2P81 A;  3E3V A;  3J7Y J;  3MZE A;  1MC0 A;  1SFU A;  3NOT C;  2QJ7 A;  3IAS 2;  4Q47 A;  5HL6 A;  3ZG9 B;  4MMN A;  3ZGA B;  1O4X A;  1S4B P;  3LSI A;  4R1G A;  4WKE A;  3LSK A;  4IUK A;  2IRF G;  4L5I A;  3TE8 A;  2YU9 J;  4G6D A;  3JRC A;  3C18 A;  5F6F A;  4H76 A;  2EZK A;  3ABU A;  3MKF A;  3ZCZ A;  1KYZ A;  2XF7 A;  2XAQ A;  3U1K A;  3WTZ A;  1BTL A;  1ESU A;  2R7V A;  4IXA A;  1ZHH B;  4EFS A;  4CUG A;  3S4X A;  2Y2Q A;  4C30 A;  3WGI A;  1IAG A;  4P9F A;  2WKP A;  3LE9 A;  5DF8 A;  1R9T J;  5JMY A;  4HEF A;  2XRN A;  2QF7 A;  1K7G A;  1R5G A;  5F1J A;  1K4T A;  1K6O A;  5EVL A;  4UUS B;  4I02 A;  4S05 A;  2M7V A;  1MH3 A;  1ZR2 A;  4A3J J;  1Z6R A;  1H8Z A;  2K4J A;  2FSW A;  4DBQ A;  3GFI A;  1WRJ A;  2JRM A;  5HDN A;  3VOZ A;  2LYC A;  4Q0H A;  3N7W A;  2YIG A;  4AM3 A;  3FHN A;  3LA7 A;  2R78 A;  3IF6 B;  2VEA A;  1FC3 A;  2PDR A;  4NBQ A;  4Y52 J;  1JNU A;  1YLZ A;  4PKR A;  1CF0 A;  1D8K A;  2UUZ A;  4A0Y A;  2L7K A;  3BCB A;  2DBB A;  4GW9 A;  2Q1Z B;  2WGW B;  3E6M A;  3K10 A;  1G5U A;  3W4O A;  2LH9 A;  3BTI A;  3HHG A;  4IF4 A;  1R1V A;  1ORK A;  5AIP A;  3ZPL A;  3KYQ A;  1PW1 A;  4YFM A;  2P7V B;  3B2Z A;  1NLZ A;  2QSG X;  4PKQ A;  1NTC A;  1GKC A;  4OQ0 A;  3T0Y A;  2JBF A;  2EFU A;  4HSR A;  1SAN A;  2XR0 A;  2M7U A;  4YEL A;  2AO9 A;  3ELM A;  1NHA A;  2R7T A;  2NVY J;  4ENJ A;  3N4I A;  1NXY A;  1QVT A;  5D5V B;  4H82 A;  1X19 A;  3UE1 A;  2OC6 A;  3T1Q B;  4BL2 A;  2UXN A;  3VE4 A;  5EG0 B;  4E3N A;  1Q1V A;  2E1O A;  4AUO A;  2K9N A;  4F3Q A;  4S2L A;  5KVR A;  2ZQC A;  2JT1 A;  3TRC A;  4FTX A;  3G5C A;  5LHI A;  2B02 A;  1JWP A;  4PKY G;  1XJ2 A;  1BI0 A;  2NVT J;  3S7Q A;  4H1Q A;  4IEJ A;  5GLD A;  3OL3 A;  1U5T C;  2E8J A;  3Q0U A;  2H09 A;  1Y0V A;  5BOY A;  5DCF A;  3C2G A;  2BVL A;  2KLO A;  5HWT A;  2JSP A;  2F5F A;  5DKK A;  4OP5 A;  2E3X A;  3WE2 A;  5HLG A;  4R38 A;  1BUE A;  4RA2 A;  3A3E A;  1Z05 A;  1BW6 A;  3QP8 A;  3K1M A;  1O0Q A;  1SMT A;  4M9S A;  3DEU A;  2KJB A;  1KGE A;  5HLT A;  1XSX A;  5JLX A;  2V8C A;  1O7L A;  4NC8 A;  1EWZ A;  3PUF A;  2RQP A;  5ICF A;  3FMQ A;  5DEQ A;  3QPH A;  1WZ2 A;  1HVB A;  2J8Y A;  4L9E A;  1ZR4 A;  3OHO A;  2IWD A;  2HVS A;  4I01 A;  1R36 A;  4QU3 A;  2ZC3 B;  3OYD A;  1Q3A A;  3TL4 X;  3V7C A;  2QQA A;  3ZOB A;  1Z91 A;  4NC6 A;  3AGF A;  2HR3 A;  4CYC B;  1XGI A;  2QUF A;  2EIN H;  1JGS A;  4GB7 A;  4HP4 A;  1HDD C;  2ERQ A;  1FQG A;  3V96 B;  1SRP A;  2EA9 A;  3HYI A;  2D02 A;  2DJN A;  2BW3 B;  1M1E B;  3O3V A;  5FRO A;  1XFN A;  5CVR A;  2FOW A;  2K5C A;  3WS0 A;  2VJ4 A;  2H27 A;  3HRE A;  2DFI A;  2PEX A;  1W79 A;  2JA5 J;  4KIG A;  2CYY A;  4A3B J;  5EDN A;  1K78 B;  2IGN A;  2KIU A;  3LSM A;  4CIC A;  4W1U A;  3BG7 A;  2EV6 A;  2NS8 A;  4MLL A;  1JXS A;  4Q48 A;  4XKV A;  5IYD J;  1TT5 B;  5HLH A;  3DLL F;  2VKV A;  1OM8 A;  1BZA A;  1G3S A;  1P7J A;  1HXD A;  1K0K A;  3FKV A;  1S0W A;  2CG4 A;  2X1D A;  1DU0 A;  2XB0 X;  1PIO A;  2RAE A;  1SLM A;  5FL3 A;  3S16 J;  3K4C A;  2HDQ A;  2MGQ A;  1FTT A;  1USN A;  2EX2 A;  4B3A A;  2HGV A;  3G2Z A;  3CCV I;  1G05 A;  4BWI A;  3G1M A;  1XJ4 A;  3ZQL A;  4Q8I A;  2ZM2 A;  4OIO F;  4BY1 J;  3SDG A;  1YSP A;  2PR5 A;  2LK2 A;  1S66 L;  3BR0 A;  1HKT A;  1V9Y A;  2Z2M B;  1GE6 A;  1PWW A;  1PVE A;  4HX7 A;  5E2F A;  3OR2 C;  2QM3 A;  2X7M A;  4Z9Q A;  2L54 A;  3E1S A;  3UY6 A;  2Q2E B;  3MF0 A;  3ML6 A;  5D4R A;  2WKR A;  1BUL A;  4CYD A;  3DF8 A;  1JTD A;  4GD6 A;  2CRG A;  1FPQ A;  3H35 A;  4EM2 A;  3G71 I;  2ZMF A;  3FK6 A;  1Z7U A;  3RPU D;  1T38 A;  2IS2 A;  4MTE A;  2CQQ A;  3QPS A;  1QQI A;  3H3Z A;  4CLC C;  3DBL B;  1MJA A;  9ANT A;  2DN0 A;  4QPR A;  2R7X A;  1UJ8 A;  3DU5 A;  2LLK A;  2D1N A;  4JQG A;  1JTX A;  3C3W A;  2HP9 A;  1UHS A;  1XG1 A;  1Q1H A;  1RP5 A;  2IWC A;  2HU9 A;  5HFO A;  3LA2 A;  1D5Y A;  4BXU A;  3ISG A;  5E3N A;  4GO1 A;  1H8M A;  4RGX A;  3X2Q H;  5AVE A;  4ZJ2 A;  3BEB A;  2X0L A;  3IX4 A;  4KZ8 A;  3HOS A;  1MMD A;  2M45 A;  2GDN A;  1ZN2 A;  3M1E A;  1RUN A;  1GHC A;  1NZO A;  3KP2 A;  2R5Z B;  2NNY A;  4A2U A;  2V0U A;  3JTG A;  5HOD A;  1PI5 A;  3FG8 A;  3JSO A;  1P9Q C;  1MNC A;  5J3W A;  4PM9 A;  1FSE A;  2PT7 A;  3IRQ A;  4UQI S;  2PYP A;  1FR6 A;  4GDF A;  5GAE J;  3S14 J;  3HOU J;  5HSQ A;  2KLI A;  3TED A;  3CMM A;  1YLY A;  1A0K A;  4Q5S F;  3LYX A;  2ECB A;  3VP4 A;  2A07 F;  2L9V A;  4Y7P A;  1Y0N A;  3DEE A;  3HJI A;  1G3Y A;  2X71 A;  1K4E A;  1YJ9 I;  3V5M A;  1GHM A;  2JWT A;  1NH3 A;  3ITA A;  4KZ5 A;  2NVQ J;  4XUX A;  3P98 A;  2GIV A;  1F4K A;  1TVI A;  4KNY A;  4JIJ A;  2P5V A;  4H6J A;  4EBP A;  3Q7V A;  2BLS A;  4IX7 A;  4BDY A;  4OIQ F;  4X6T A;  5TRD A;  3BG6 A;  2L0R A;  1Z9C A;  4FTH A;  2W1O A;  1U5T A;  2D5V A;  3ZG8 B;  3VFH A;  1QHG A;  1PI4 A;  4NDL A;  1VQN I;  4KUK A;  4CA0 A;  5BPI A;  4E04 A;  4RAG A;  3CHW P;  3J7A O;  4U3T A;  4HI4 A;  4R4S A;  3UB7 A;  2ERO A;  3VP2 A;  1OPX A;  4LRX C;  4Y7N J;  1GXQ A;  4A3D J;  4F91 B;  3PUB A;  2PD7 A;  1VZ0 A;  4X68 A;  5TBM A;  3A03 A;  2KPM A;  2RC4 A;  1L0D A;  1ZEL A;  5IT5 A;  3TW7 A;  4EJU A;  4HAM A;  3LR3 A;  3PTE A;  5EEC A;  4U0X A;  5AQB A;  3PM1 A;  1J0R A;  4FSF A;  2FRH A;  3PNV A;  4HV6 A;  2DU9 A;  1SD7 A;  4DXB A;  3S8P A;  1D0Z A;  2PFB A;  3HLG A;  2HQN A;  3BR5 A;  4UUV A;  1ONV A;  1F5M A;  3CDI A;  2H0T A;  4N1X A;  2GLO A;  4TV7 A;  4Y5F A;  2KKO A;  3PBR A;  2BZT A;  3F15 A;  4L9F A;  2GX5 A;  4CSW A;  1VQ4 I;  5DF7 A;  1MBL A;  3D0S A;  2J3T C;  3KYE A;  1KE0 A;  3OCL A;  3GBG A;  2BGC A;  1WJB A;  3OPH A;  3I0T A;  2POJ A;  3WTS C;  2H8R A;  2JCH A;  2BY2 A;  3LAP A;  1OS2 A;  2CW8 A;  1SFE A;  4JGP A;  4EJW A;  1JUM A;  3LQ0 A;  3LQB A;  1W7P A;  4B4C A;  3KEC A;  4AYB A;  2KJC A;  1GSX A;  4P6Z M;  1CGE A;  1DUX C;  3ITB A;  3TQN A;  4AD9 A;  4A0Z A;  2V1D A;  1E25 A;  1APL C;  2WB1 N;  2VV8 A;  2HWV A;  3R0A A;  1U78 A;  3EUH A;  3BP8 A;  3G6E I;  3LMC A;  5LHH A;  1H5X A;  3L2Q A;  4KZA A;  3ASN H;  1R23 A;  2NUP C;  3HRM A;  1LL9 A;  1HKS A;  2JE5 A;  3A01 B;  4U0W A;  2JVG A;  5J1Y A;  4WX9 A;  2J9O A;  1G6A A;  4KJZ A;  1BA5 A;  3N6I A;  4G0D A;  4D5F A;  4DKI A;  4HF2 A;  2EBI A;  4MN5 A;  5EM1 A;  3LUM A;  2ECC A;  5FB2 A;  1IRZ A;  4CDG A;  3K2A A;  2X4H A;  4M3B A;  3KLN A;  4E3I A;  5FQQ A;  1DJB A;  4FVL A;  2IGM A;  4UUT A;  2WO9 A;  3EUK L;  4KQQ A;  2OJE D;  2XSJ C;  4PM6 A;  1OMJ A;  2OBP A;  2V9K A;  1V54 H;  5CTN A;  4P1W A;  4G7O F;  1W8Q A;  5CGS A;  4S2M A;  1HW2 A;  1XSV A;  4HNT A;  4WZ5 A;  4BKX A;  2KZV A;  5AQ9 A;  4R0Q A;  3DKW A;  1Y39 A;  4IL6 C;  2DPD A;  4QWQ A;  5I43 A;  2VJW A;  1R6R A;  4UY8 I;  4DBR A;  4H84 A;  4UV8 A;  4Q0J A;  2WV0 A;  1YQS A;  1WI3 A;  4HST A;  1AWC A;  2Y79 A;  1K7A A;  3CUQ C;  1SAX A;  4BQN A;  1XDS A;  1MWU A;  2OTL I;  5L10 A;  5I3M A;  1RI7 A;  2JA7 J;  1HDP A;  1KU2 A;  1DQU A;  3F9K A;  3QOD A;  1IW7 F;  3Q3S A;  4GOG A;  1DJA A;  2XSS A;  2A6T A;  1JJ9 A;  3WG7 H;  1I2W A;  2WAQ A;  4MIM A;  1A36 A;  5FJ8 J;  2XGD A;  2BY0 A;  1G8X A;  3IWQ A;  3MBZ A;  3S2W A;  3LQQ A;  2BY3 A;  2P74 A;  3JW4 A;  1F43 A;  5CVV A;  3SS5 A;  2R92 J;  5LHG A;  2PD8 A;  1ZTQ A;  3LFK A;  2DK5 A;  2M7B A;  3REO A;  1FYM A;  4RGR A;  3LUQ A;  3RZO J;  2HKX A;  4GZB A;  5HD3 A;  5J8F A;  3S3M A;  3G42 A;  4EU0 A;  4DIQ A;  5KIZ A;  3I59 A;  1KGF A;  3H9W A;  5IYB J;  3SDB A;  4UB6 C;  2ELJ A;  3OYJ A;  1LB2 A;  1HFC A;  3WGH A;  1BQQ M;  5C3E J;  1JE8 A;  3DWZ A;  4IED A;  1FT9 A;  2IS6 A;  2GXB A;  1PWU A;  3ERE D;  5A90 A;  3WS1 A;  1S7E A;  1FSY A;  3BZ6 A;  2RNJ A;  2PAV P;  1T18 A;  1GO8 P;  4DDS A;  4CCL A;  3FZC A;  2DMW A;  4HJ4 A;  4BD1 A;  4KG5 A;  4L7A A;  2MYS A;  2NYX A;  3CC2 I;  3ZG5 A;  2JSD A;  5FKK A;  2IWB A;  2DT6 A;  3ECO A;  4M3E A;  1I2S A;  3CPT A;  1XX5 A;  1XGO A;  4UA7 A;  4GLQ A;  1ALQ A;  2L4M A;  1PP8 F;  1QJI A;  3CMY A;  1U9O A;  4E70 A;  3ZMS A;  4AIJ A;  4PSX A;  2ISZ A;  2P6T A;  4OPQ A;  1STZ A;  2XPU A;  1SC7 A;  2INW A;  3LR4 A;  5FKO A;  3T5X A;  2VOD A;  5GL9 A;  3Q07 A;  3J81 K;  3HDA P;  3C5A A;  4OMY A;  4I76 A;  4MBH A;  3T4T A;  4F55 A;  1SFO J;  4XMY A;  3KRY A;  3DKY A;  5M3M J;  4V2F A;  1Z0X A;  2MLK A;  3C7U A;  3LSG A;  2YKH A;  3GTK J;  1UTZ A;  3JRG A;  4W97 A;  4PGH A;  2FV9 A;  4BL3 A;  3GFJ A;  3F21 A;  4PKS A;  2P08 A;  1K54 C;  3W2V A;  1JAQ A;  1IDY A;  1PWC A;  3D4F A;  1TWG J;  5JYP A;  2STT A;  4GXO A;  5E1Z B;  2V0W A;  2W3F A;  2OLV A;  2XRO A;  3FYZ A;  3MFX A;  3LNQ A;  3FX3 A;  4Z6Y A;  1CK3 A;  2A61 A;  5J8X A;  1AKL A;  3LSH A;  1IRX A;  3CO7 C;  3I53 A;  1G28 A;  1EH7 A;  1O3S A;  2W27 A;  2I9V A;  2WGI A;  3ZG0 A;  1N9L A;  4H49 A;  2V9V A;  1YJN I;  3A02 A;  2FUG 2;  1KDW A;  1PZP A;  4M9Z A;  2F5V A;  4FT8 A;  5HPF A;  2V1X A;  2DQL A;  2EV0 A;  2V1B A;  2OPT A;  4BBR J;  2ME0 A;  1D1B A;  2OY4 A;  2W12 A;  4AID A;  5K5R A;  4B48 A;  4A3M J;  3JYI A;  5FAT A;  4B4Z A;  4KYW A;  4JOM A;  4ETZ A;  1SAU A;  3VP0 A;  4H8R A;  5D1U A;  2JPC A;  2DDF A;  2M3A A;  3QP1 A;  1IKG A;  3NAU A;  2JT5 A;  4ZH4 F;  4N9L A;  2DOE A;  4WK7 A;  2VN2 A;  4QSH A;  5TR7 A;  2E1M B;  3KME A;  4AWX B;  2JIH A;  4R3A A;  5KMW A;  3VYU B;  4HBU A;  3I56 I;  4ARZ A;  1ERM A;  2D1H A;  3S1Q J;  1MKI A;  2FH5 A;  3VV4 A;  1H0M A;  1T08 B;  4LCL A;  3RIR A;  1K56 A;  3RCO A;  4QY5 A;  4PKW A;  4N1H A;  2IP2 A;  1BYW A;  4EQQ A;  2OW2 A;  1A6I A;  2A3S A;  1RPW A;  3BTL A;  5HDC A;  4JF4 A;  4A93 J;  2IA2 A;  1JTY A;  2V7F A;  4OIR F;  2GXG A;  2O9B A;  3I4N J;  2PMZ N;  2L1M A;  1YW8 A;  4ZTK A;  4BMW A;  2MLG A;  3OYI A;  1LT0 A;  1WVR A;  4XCT A;  3F1N A;  3HLD A;  3I7G A;  4CCN A;  1IN5 A;  1SLN A;  1DGW Y;  5H6R A;  3OSF A;  3ZGK A;  4IHQ A;  1I3Q J;  3WTW C;  1YOU A;  2XS3 A;  4XR6 A;  4LIT A;  1DP7 P;  2QLZ A;  4HOB A;  5IY5 H;  1OTD A;  4NG2 A;  2UXX A;  2E2D A;  5TFQ A;  3QP2 A;  2LKP A;  5J40 A;  4A6E A;  2QYO A;  3CES A;  4EM0 B;  4HQM A;  3T4K A;  3TKY A;  3E6C C;  2Y2H A;  3OIP A;  2QQ9 A;  2CV1 A;  2XA7 S;  2H10 A;  1YLP A;  1IXR C;  3DPU A;  4S2P A;  1HST A;  4UA9 A;  4FXY P;  1BM6 A;  3IP4 B;  5AJG A;  2V1N A;  3OYL A;  1E2X A;  5FQ9 A;  3OBF A;  1BL0 A;  2A68 F;  4JQF A;  3A2K A;  4WKI A;  4DE0 A;  1LDD A;  1WJC A;  4ZZD A;  4XRS A;  4BH9 A;  3G34 A;  4QD4 A;  2MFZ A;  5J6X A;  4M3D A;  4RQ9 A;  1K4F A;  3V67 A;  3ROU A;  1IGN A;  1FWZ A;  1WPK A;  2R7S A;  3PBO A;  3BR6 A;  5E2H A;  4B93 A;  4GGG A;  3QAH A;  1AHD P;  1KON A;  4ZJZ A;  3E0Y A;  3T8R A;  2VPR A;  4KIS A;  1W8Y A;  4D60 A;  1KQ0 A;  3O86 A;  2ZLY A;  3ONQ A;  3G73 A;  4E6K G;  1BOB A;  4HQA A;  4DJA A;  2W4S A;  1JGG A;  2RJP A;  1U9N A;  2V26 A;  3LJG A;  3WTT C;  1H3Q A;  2EFW A;  2M2E A;  3LY3 A;  1H8A C;  3J80 K;  2QHK A;  4N9I A;  4S2N A;  4JGO A;  5C4J J;  1R00 A;  4B9O A;  2VE8 A;  1S6L A;  3I7I A;  4IUW A;  3JPU A;  2VGL M;  2B7E A;  2WY7 Q;  2BOL A;  4GWN A;  5BOT A;  3JRI A;  1D0Y A;  2HTJ A;  3IHA A;  2AHQ A;  2PU4 A;  1OTI A;  5M3F J;  2G0E A;  1EJ9 A;  3ZMT A;  2MBF A;  3P9C A;  3OS2 A;  2XH9 A;  1BIB A;  5CJ9 A;  1R1H A;  3LUN A;  3V8J A;  4E7L A;  3NIA A;  5BPD A;  5CEC A;  1LDJ A;  3BJ6 A;  3Q2G A;  3CDH A;  1DP8 A;  3EEH A;  4I98 B;  5FAP A;  3TP3 A;  3NJA A;  2J5O A;  5LFA A;  1BI2 A;  4OAZ A;  1P0Z A;  3F72 A;  2UV1 A;  3OS1 A;  4MGR A;  3NC8 A;  1FIL A;  2EFN A;  2XDV A;  1MBJ A;  1TWC J;  2L4A A;  4XRF A;  2ZNZ A;  4E3L A;  2EZL A;  3LAJ A;  3MD2 A;  4HMA A;  2PBD P;  1MXO A;  3HUO A;  1E0E A;  1VQO I;  4FE7 A;  4N9K A;  1W0T A;  4ENN A;  4X69 A;  2CGP A;  1D06 A;  1Y1V J;  2K4B A;  2F2E A;  1YMS A;  4R1H A;  1ZLJ A;  1S7O A;  2W84 A;  2DMP A;  4M9X A;  5HDG A;  3D1N I;  4OKP A;  1IJW C;  4R70 A;  2GBY A;  4P5O A;  3Q7V B;  3HL2 A;  1YI2 I;  1MZB A;  2ZME C;  4A3K J;  1DDN A;  1BR4 A;  4IOA F;  3TJZ C;  4OMZ A;  2IS4 A;  1ZG5 A;  3BLY A;  2R5Y A;  3E2K A;  3BDD A;  1U5T B;  4G9L A;  4BD0 A;  3RKX A;  3BQ8 A;  4IRH A;  1ES5 A;  3GTL J;  4GR0 A;  4DN0 A;  3UDX A;  2I72 A;  3HC7 A;  4L5E A;  1NRF A;  1GA9 A;  1MNE A;  2L0K A;  1XFV A;  2QKL B;  4BEN A;  1K83 J;  1MND A;  1XMX A;  3U4L P;  4A0X A;  1HW1 A;  2Z9O A;  2E35 A;  2A6H F;  2B18 A;  1YSQ A;  2DRW A;  3CAX A;  4QWO A;  4DF9 A;  1RKW A;  5L8M A;  5TBM B;  1CQR A;  2L4R A;  1HCR A;  1VQ7 I;  1FZP B;  4UV9 A;  1HF0 A;  4ZZL A;  1VTN C;  1G2H A;  2TDX A;  2EX8 A;  2EFQ A;  1EAK A;  4HA8 A;  2BV6 A;  2HOS A;  3KEY A;  1GV2 A;  2R7Z J;  5EF6 A;  4M6V A;  3BRM A;  3EEA A;  1T33 A;  4L9G A;  2ZJR F;  3WV3 A;  4YWZ A;  1CF7 A;  2X6W A;  2JUC A;  1ETO A;  1VEU A;  1RES A;  1ITY A;  4BBS J;  3KMC A;  1X4P A;  1OIS A;  4P0M A;  1LHY A;  4X55 A;  5CUH A;  3WTX C;  1XPB A;  2QVO A;  3PNT A;  2GA2 A;  2WAF A;  2X51 A;  3F22 A;  5FGM A;  5JHF A;  4PKV A;  3SZP A;  2W14 A;  2UWM A;  5DUI A;  4AIG A;  2OY2 A;  5CPR B;  1UFM A;  3RSN A;  1UZC A;  2XEP A;  3O8H A;  1UMQ A;  2QBY A;  1HTZ A;  2JSC A;  4E7J A;  5D8K B;  3HBR A;  1W7P B;  3L2U A;  1WSU A;  1MJ9 A;  2E7W A;  4L5J A;  2R0Q C;  1YG2 A;  3S1R J;  3EDG A;  4KQD A;  4P9U A;  4CJN A;  5EPH A;  2WAD A;  1NG7 A;  5HL1 A;  3RKY A;  4WL9 A;  4PJ0 C;  4HX4 A;  3L09 A;  1XAX A;  2PYR A;  3DPT A;  1A35 A;  1D8M A;  2LR8 A;  4C3J J;  4HH3 A;  3FBI B;  2E19 A;  1K6S A;  1TVF A;  5J4E A;  4LLL A;  2XFS A;  1J5Y A;  1P4W A;  3EET A;  2X1C A;  4HF0 A;  3MAJ A;  2DQR A;  4HES A;  4NET A;  2BTF P;  3WV2 A;  3K7A J;  3FK7 A;  1S4R A;  1GHP A;  4N4O B;  5FFZ A;  2V1Z A;  4II3 A;  1SKO A;  1YLF A;  3HB9 A;  3JSP A;  4ZYE A;  1Y4O A;  4XKW A;  2QSH X;  5G18 A;  1U3E M;  3NOU C;  4GDB A;  1HKQ A;  3ZMU A;  1FBS A;  3K70 C;  4ZRR A;  4DMZ A;  4K2E A;  1VQQ A;  2WAE A;  2LD5 A;  3BTJ A;  4B8X A;  5IT3 A;  4DF6 A;  2M34 A;  1FBU A;  4UHU A;  1OT6 A;  1ZVX A;  4PKY A;  5LEK A;  4MLO A;  5HNH A;  1ZAR A;  5CVI A;  2BXZ A;  4MHG A;  2ZO4 A;  1LI0 A;  4BU2 A;  4GUY A;  4GWM A;  4ESP A;  3IWO A;  5HPI A;  2N8R A;  1IAD A;  2NOG A;  2Z1D A;  3BRO A;  5FEG A;  1ERO A;  4ANJ A;  3KWV C;  2OSU A;  4KT5 C;  4FX4 A;  4E3O A;  1UGU A;  2BEO A;  3O5Y A;  1JWV A;  2RV8 A;  3U9G A;  2XGX A;  4V19 K;  3PBQ A;  2A49 A;  2DA1 A;  3CCJ I;  3PAG A;  3KLO A;  3AG2 H;  2TRT A;  2R7Q A;  5DYM A;  3USN A;  1EW0 A;  1FLI A;  5A92 A;  2KT0 A;  3KIO A;  3LR0 A;  5J4Y A;  1XFW A;  1T98 A;  2LOO A;  5J4V A;  2CC1 A;  4ENK A;  1TDL A;  3IXH A;  4ZBE A;  1YS7 A;  1FP2 A;  1R71 A;  4QHC A;  4IJA A;  3I59 B;  3T4J A;  3TG9 A;  2O8K A;  2Y2P A;  4DE2 A;  4XIC A;  1IXS B;  3F0C A;  3FV7 A;  1TWF J;  2DOF A;  3ULQ B;  3PBN A;  4BHP A;  1R1J A;  5D8L B;  3NHQ A;  3UR3 C;  4IRG A;  2JKF A;  1N9N A;  2K02 A;  3F1O A;  2WTE A;  2HPI A;  2X1E A;  3I7J A;  1SVO A;  4A3G J;  2OWJ A;  4ON0 A;  4HNU A;  1H9G A;  3G35 A;  2V9A A;  1P92 A;  1HC8 A;  1YAX A;  4GR8 A;  2BYV E;  2O3F A;  4LG3 A;  2ZME A;  3LFU A;  2CUF A;  3NBL A;  4DJ2 A;  3E98 A;  1DRM A;  3UE3 A;  4OH0 A;  3S17 J;  3L9F A;  2XGN A;  1DTH A;  2CV0 A;  3CPT B;  1YLJ A;  1GDT A;  1EUB A;  1XGJ A;  2W1R A;  3C30 A;  1KUF A;  4GYI A;  5FAQ A;  1YCM A;  3VE3 A;  1Y8Q B;  5IHV A;  2W57 A;  4WWC A;  1CI9 A;  2HOA A;  3A0R A;  4M6X A;  2EWW A;  4PJN A;  2VBY A;  3B92 A;  5B3S H;  1BKC A;  2RN7 A;  3NX7 A;  3GFM A;  3AL0 B;  2DCE A;  1ETX A;  5D6F A;  3TDZ C;  4P6Z S;  2OQR A;  3RXW A;  1HOM A;  3HVF A;  3CC4 I;  2MG4 A;  1NJ4 A;  3HBU P;  1ZRC A;  3S3N A;  4ZJ1 A;  4RDU A;  2CW7 A;  1FJL A;  2M0C A;  4XBH A;  4LG0 A;  2MLR A;  2OV7 A;  1P4A A;  2COM A;  1G9K A;  2P7C B;  2ME6 A;  3UNG C;  1A5J A;  3K1N A;  3UPP A;  4HF1 A;  1OM7 A;  5M5X J;  4JBA A;  1PNE A;  5E2G A;  5FI6 A;  1O0T A;  3E97 A;  3UE6 A;  4GDN A;  1K7I A;  3TDU C;  4XM3 A;  1BLS A;  5M18 A;  2EIM H;  3FWE A;  4XLA A;  2YPR A;  3GVB A;  1YS6 A;  3F1P A;  2DPU A;  4O7D A;  4WEK A;  2XHK A;  5L07 A;  1IAE A;  2KX6 A;  1W7P D;  3PIO F;  2VON A;  1YW9 A;  3BLS A;  4DJ3 A;  3OIO A;  2JT6 A;  3OY9 A;  2PG4 A;  1YYV A;  3HY9 A;  4UVC A;  3HOY J;  4C6Y A;  2V4B A;  1K4S A;  2L2O A;  4BUP A;  3I5U A;  3SOI A;  4EET B;  4XM8 A;  2FA5 A;  1SKF A;  4U0Y A;  1OTE A;  1KUH A;  3EOI A;  2JC7 A;  2VIX A;  5FLX Z;  3UE0 A;  3KEK A;  4NK3 A;  1WJD A;  3WRZ A;  4Y4R A;  2Q8K A;  1IFQ A;  3BM6 A;  3KSH A;  2AYK A;  4HJ3 A;  5C4X J;  2VI6 A;  3HLE A;  1AXB A;  2Y31 A;  3GYH X;  3UDF A;  1EA3 A;  4II7 A;  4GHI A;  1N25 A;  3COA C;  1OCR H;  1L2S A;  2XAS A;  2IGO A;  5CX7 A;  3AYK A;  1YIO A;  1G3W A;  3CUO A;  1W36 D;  3HYG A;  1KU3 A;  2X6X A;  4ARZ B;  3G4P A;  4BY7 J;  1IC8 A;  2K86 A;  4F92 B;  2M1C A;  3R60 A;  2RKH A;  1QIB A;  3F18 A;  2I10 A;  4L63 A;  4BQA A;  3TOB A;  1M6K A;  4OWR B;  2IAI A;  5E18 F;  5IP6 A;  3N8S A;  2FX0 A;  2R7R A;  3V3S A;  4LB6 B;  4N4N B;  5CEB A;  3LI9 A;  1QIC A;  3P01 A;  5DS9 A;  1OLT A;  4Y0U A;  2EWV A;  2DYS H;  2Y48 A;  3E7L A;  2JA2 A;  3F6O A;  5DFY A;  2BY1 A;  2L7Z A;  2JK3 A;  2OVZ A;  3VOL A;  2OXU A;  4M3G A;  1F98 A;  3F1N B;  1GO7 P;  1TZL A;  1WI9 A;  2TCL A;  3BFE A;  2J3W A;  4XOR A;  1HFS A;  4RAY A;  2LDU A;  1MW7 A;  1S9H A;  1U8R A;  1O7E A;  3OYG A;  3TGN A;  4IJO A;  4A69 C;  2HKO A;  1UG0 A;  2E2I J;  5A8B A;  2LY9 A;  1DP6 A;  3BYD A;  2VQH A;  1IOU A;  1TT0 A;  2CMN A;  3FXO A;  4MQ9 F;  2LRE A;  3RTR A;  2DK8 A;  1N9B A;  3BFC A;  3TO9 A;  1S29 A;  2VKD A;  4BNC A;  2WY8 Q;  4LEN A;  3JRA A;  5FRN A;  4O5V A;  3HRT A;  2Y55 A;  5D4S A;  3F8M A;  4P96 A;  1XFQ A;  1WE4 A;  1OCT C;  3OPP A;  4LMY A;  5AQA A;  3DBA A;  2K40 A;  1PDN C;  3MA2 A;  2FEZ A;  3DPF A;  2EX9 A;  5GHZ A;  3HGG A;  1KVM A;  3LR5 A;  2A69 F;  2MA3 A;  3J7A Y;  1KUK A;  3UPN A;  2DW4 A;  2HDU A;  1VQ5 I;  3DEW A;  1LKX A;  4XSZ F;  3ISP A;  4EES A;  3F16 A;  3KE2 A;  4H2E A;  4R4R A;  1YOV B;  3GBO A;  4AYB N;  3BQA A;  2V9P A;  2OXZ A;  4D7N A;  2L7F P;  3BW6 A;  4OIN F;  4L0Z B;  2QJ5 A;  3CJQ B;  2VOO A;  3NI9 A;  2HDD A;  5GAH J;  2PLY A;  3CJT B;  3T1R A;  3GTG J;  3TS4 A;  1AOY A;  5D3O A;  2GZA A;  5DFX A;  3WOD F;  2ZFW A;  4L19 A;  1OJ5 A;  3HG9 A;  3OYM A;  3S93 A;  4E4H A;  2HQA A;  1J2X A;  1GLN A;  1MMQ A;  3GWZ A;  5E79 C;  3R4K A;  1JT6 A;  3LGP A;  1BLH A;  3SH9 A;  1LEB A;  4OQI A;  2RJQ A;  3VI1 A;  4BQQ A;  4JXW A;  2OAZ A;  1KQ8 A;  2K9Q A;  1BJZ A;  3MN2 A;  5K7F A;  2VX8 A;  1D8F A;  3MZH A;  1VET A;  5AON A;  1EI5 A;  1JJ8 C;  2JRT A;  2C6Y A;  3CUE A;  830C A;  1CEG A;  1T19 A;  1MBK A;  5E3L A;  2Y0S A;  1FYK A;  4NXE A;  3N8R A;  1YE9 A;  3BJN A;  1ENH A;  4EWF A;  2H6B A;  3M6H A;  2F4M B;  1NY0 A;  3QQA A;  1XMA A;  4HG2 A;  2XSD C;  4XN3 A;  2QMI A;  5GPA A;  1TC3 C;  1ERQ A;  1WCM J;  2HYJ A;  1BZ