3DTEA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords IrrE protein
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
total genus 70
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dteA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dteA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dteA01
3DTKA 3DTEA 3DTIA
chains in the Genus database with same CATH superfamily
3LJTA 3A03A 2Q8KA 1BKCE 3G1LA 5E1ZB 3OYGA 2R7VA 3A3DA 5GTHC 3Q5FA 1K7QA 2JHEA 3I5UA 3OOUA 1JJ6C 5FQQA 3LR0A 3EUAA 1DP9A 2WO9A 4H76A 3ZMDA 3HGYA 3OWTA 4J00A 1XJ4A 4MBKA 1K4TA 1NZOA 3B33A 2ZBBA 4LGWA 4RB1A 5GAHJ 1C7KA 1MMAA 1R9TJ 2E19A 1FLSA 2GA1A 1EWZA 2VPRA 3WG7H 1YLFA 4IXAA 4M3BA 2ZM8A 1RKTA 1O57A 2M9HA 1XP4A 5CKTA 1A85A 1FLIA 3TP3A 1R4NB 3PL8A 2RVCA 2JZYA 2NS8A 4CCKA 4E4HA 1K6YA 1DP3A 4L6TA 3HPHA 4R1GA 2QUFA 3L2RA 1JKYA 3LMCA 2Z6CA 3OIOA 1XFZA 4Y2FA 2EA4A 5DJTA 3WE3A 1XN7A 3QRFF 4KICA 3QYEA 2Y48A 1P7IA 5CJ9A 4KYWA 3T4JA 2XSJC 2E5NA 4MLLA 2JTVA 3CQZJ 1L2SA 2E3XA 3MSHA 5HWTA 1F9NA 5D5XB 4KG2A 3ZDJA 3DEEA 3K1PA 3ZQGA 2ZOIA 4R4SA 1IEMA 1WRJA 2IP2A 4PJ0C 3HOTA 4N4OB 2GIVA 2KIFA 4JP4A 2DDAA 5K5RA 1DDNA 5EG0B 2DJNA 1OT6A 2L5QA 4LRYC 3GZNB 2D01A 4PKYA 1GHMA 4IPAA 5EM0A 2HDWA 3PSFA 1SKOB 2AQEA 1IV6A 2JA7J 2PR5A 3G1MA 5TBMB 3H3UA 3FXJA 4U0TA 2RDPA 2X48A 1NG7A 3KZIC 2LBFB 4CCOA 5CECA 3R0JA 5E1XA 4GO1A 3LNQA 1REPC 2XFSA 4JQFA 1KDSA 4MMNA 3E6CC 1YCMA 4O3MA 1SD7A 1XTAA 4YINA 4O5VA 4BXXJ 3U21A 5L2FA 2H6BA 2P9VA 4XN0A 1PWCA 2VKVA 3DPEA 1ZN2A 1N78A 3RIRA 4HIAA 3TS4A 3FXUA 3BM6A 1E3HA 3FXRA 4L0LA 2I5UA 2DDYA 5CVUA 5HAPA 3M1EA 3UNGC 3ZQ5A 4YFKF 3WTWC 4I02A 4FH2A 2MG4A 5K5QA 3V67A 4HNUA 4EATA 3DBLB 1ZRCA 2FNAA 2ZNZA 3HTSB 2HYJA 4BEHB 4P9FA 4M73A 3BTLA 4GNUA 5A8BA 2I72A 3ZN0A 4II2A 4RS8A 5LGTA 1KONA 4PKTA 2DDFA 1Z3XA 1XC5A 3DLLF 4WX9A 5E2HA 1CF0A 1XFUA 2M8EA 2R78A 5HSQA 4A0ZA 5F1RA 2PMZA 2XKOA 1Z09A 4JF4A 1DJAA 1JE8A 2H27A 4E6KG 2FOKA 2KZGA 5IP7J 1WGXA 1ACIA 2KJBA 2XIGA 4HA8A 1SDNA 1QO0D 2XS4A 2A68F 4ARZB 5CLSA 2CSOA 3SZGA 4PKRA 3F6OA 4L9VA 2ZC6B 4S0HB 4PSWA 1CGLA 3LE9A 4S2JA 4DJ2A 1MSEC 1JHHA 5ILVA 2GOMA 2W25A 4FASD 4J01A 5LRRA 3F21A 4HV6A 4EW7A 4OAZA 4YIIA 1HC8A 5M19A 2QHKA 4IZZA 1AWIA 5EEGA 1H8MA 2XKPA 1ASTA 2OQGA 4E7SA 4KMFA 1JTDA 3N4IA 4ASNA 4NHJA 2I47A 4NUBA 1YW7A 2H1KA 5A90A 3BQZA 4JX6A 2JWTA 2K9SA 5K7ZA 3DSLA 4DBQA 4G94A 3MZDA 4FE7A 5DTTA 3FKVA 1MJ9A 1EROA 4JA1A 2CYYA 3WG9A 2FBHA 4KN4X 3Q82A 2W4SA 1PWPA 1XUDA 3CWFA 3F0CA 5JVGF 3FBIB 1JWZA 2VGJA 3B6CA 1Y8JA 1BIBA 3LCEA 3W4OA 4A5RA 2MH9A 4BAYA 4D5FA 2QPJA 3ROUA 2MLKA 2C6YA 2Y6DA 2WAQA 1PYYA 3K4NA 5B3SH 1SD5A 4HNVA 3CC7I 2H8RA 3TW7A 5D1TA 5JFRA 4G9YA 4MHGA 2VJWA 3MQOA 2STWA 1S8NA 4WZ4A 1IRGA 2YIGA 2W14A 3G30A 3IS2A 2OC6A 5FQ9A 1A36A 3KHIA 4BE1A 3H9GA 3KSHA 3OS1A 1CF7B 2DU9A 3RTTA 2JC7A 2RL3A 1EW0A 2PBYA 2OV7A 1NTCA 1FY7A 2CRGA 5DCMB 4MN7A 1PWVA 1G49A 1WCMJ 2EPFA 4F94A 3IP4B 4CCJA 5F6AA 1TWFJ 2UV0E 4I0BA 2ACJA 2VL8A 1KU9A 1X1DA 2O9AA 3CITA 2UXNA 4L18B 2MLSA 1T38A 2EZKA 2HDCA 2GXAA 4Y0TA 5LHGA 1VQMI 4OIRF 3WODF 3MR0A 2K2GA 5J4YA 3H82A 2K5CA 2MJ6A 3WE2A 1ZG4A 4O01A 3DF8A 3D4FA 4MBHA 4G7OF 1P9WA 2VKSA 4KZ9A 3CCEI 2VBXA 3LA7A 2P0WA 5CERA 5KZHA 3HB2P 2R3SA 4AIJA 5CVIA 4OVDA 4EM2A 3NULA 1LDKB 1X4PA 3EHXA 2DMWA 2M7VA 1YOUA 3CUEC 2M2EA 4KISA 4C3QA 3AKZA 1ZLKA 4F3LA 1WPKA 2HP9A 4XKBA 1A35A 1DMTA 4YFNF 1IZ1A 2MC3A 3EYIA 1RRJA 4U0XA 2BY0A 3ERED 5B5OA 2F4MB 5FI7A 2ZO4A 4U0WA 2WK0A 3HUGA 1MMSA 3P24A 1KOUA 3M8FA 3VYRB 3PBNA 1S29A 4G8XA 2M1BA 3DWLE 1W7FA 1SHVA 4HHDA 2YUFA 3Q0WA 1KUFA 3BJ6A 4EEUA 3GTLJ 2WY8Q 2HVRA 5GLBA 1B8IA 2OW1A 2ME0A 3CCVI 3GYHX 4LPZA 4AIHA 2A8HA 3NCKA 2PD8A 2HOAA 1USTA 2VLAA 1Y54A 4KZ5A 3GTOJ 1EV7A 5J1YA 4HLXA 2R4GA 3CI6A 3BFGA 3M6HA 4B9OA 5DM6F 5ILSA 2XGEA 4NNJA 2NRAC 1T0FA 2CH0A 2BW3A 2VBYA 3ZQFA 3JSPA 5MC7A 2WB1N 1OKRA 2QJ5A 1OLTA 4DJ3A 3P9CA 1EAKA 4BY7J 1O4XA 2WB1A 1MMGA 1HOVA 5K7FA 3V96B 1ZTRA 5HD5A 1T19A 2N8RA 3I4PA 3PIPF 2V1DA 4EGZA 3IL2A 2KRFA 4S2PA 2VC0A 1BTLA 1R55A 3UN7A 3OYEA 3GECA 5HVQC 3A0RA 1Q1VA 2HDQA 3AYUA 4BHCA 5FI6A 4M9XA 4BY1J 1TBXA 2AO9A 2P9VB 1MZBA 1UWNX 1FMVA 2ZJ2A 2Q9MA 1KUKA 1GE7A 4X69A 1QVTA 1KZHA 3FM5A 1WH5A 3E4QA 2FSWA 4G3WA 3ZMSA 1IAAA 2LY1A 4A3JJ 5HW3A 1LL8A 2XAGA 2N8GA 3I58A 2NUTC 3ICYA 3E5UA 3KYZA 1MBEA 5FLMJ 1E4DA 3S16J 3HBUP 4ZYDA 4X53A 2JPCA 3HBLA 4QPOA 4BL0B 3K4MA 3NRVA 2V0WA 1KUIA 1G9KA 2DJIA 2HR3A 4RAGA 3GTQJ 4JF6A 1P2FA 1JHFA 2L4AA 3VFFA 3BJOA 4N9KA 1SMPA 1VF9A 2ZQCA 1BN5A 3NHQA 3VMAA 2CW7A 3WS0A 3HY9A 2ID3A 3K10A 5LBRA 3L1PA 2Z2LB 4Q4ZF 2K4BA 1MMRA 4BQQA 3BP8A 3RKXA 3JW4A 1RETA 3G2ZA 1SATA 1QU3A 5F0CA 4WXDA 1UEAA 4QIWN 4MEYF 4IO9F 2VASA 4AM3A 3LSHA 1X1AA 1U9NA 4WUJA 2JSDA 3OYCA 3HTUA 4I35A 2LY2A 4II7A 5TFQA 3T1SA 4I3JA 1U3EM 1EUBA 2X02A 3G42A 1LVAA 1NRJA 4Y7PA 2Y6CA 4XKVA 3RYRA 4BQAA 4IHWA 5J7EA 1LVKA 3V50A 4NQWA 2W7NA 3CJNA 3HLEA 4LV3A 1NRFA 1Q2PA 3OYBA 2DQRA 1RM8A 4YNRA 1K4FA 4HOIA 1QZZA 3HBRA 2PR6A 5HPIA 2EFPA 3EGDC 4FE4A 4KQRA 4WZVA 3LMMA 1GE6A 4Q47A 2MZEA 2KFDA 3DCFA 2MA3A 1BW5A 1ZRFA 4XRMA 2M7AA 2B9SA 3RTSA 4XIDA 4KUKA 1FR6A 3K3DA 3C7VA 2L1MA 3O2PE 3BWGA 3OLOA 1W8QA 4FT8A 3IAM2 3G31A 2B63J 1VQNI 1FR1A 3S93A 5K5OA 3C8CA 2ZOHA 3KEJA 3IS2B 3USNA 2W13A 3CUQB 2Y4AA 1XFVA 2MZHA 3OZHA 1H89C 1UFMA 4BD1A 1V55H 2CO5A 1OCPA 2A6EF 5FQJA 4U87A 1XGOA 1WWXA 1XDSA 2H5SA 1D8JA 3PTEA 3VE3A 3G6OA 2VV6A 3IH9A 4ZJ1A 1F5MA 2W1TB 2GJ3A 1AKLA 1LDJA 5M5YJ 2VBWA 1W79A 3GF2A 3EHYA 1Z3JA 4ZJ2A 5HWVA 5JLWA 1Z0XA 3IKTA 3H82B 3GTPJ 3BROA 1W5TA 2QEXI 4Q0IA 3PFYA 1TDLA 4KQOA 5AVFA 4HEA2 3E3VA 2NVXJ 1GA9A 2ZLYA 1HFCA 4BBRJ 4RA2A 1XFNA 1DPRA 2HNHA 2LDUA 4GD8A 1QPIA 1M1EB 3D72A 1HW2A 5GAEJ 2ZL1A 1J7NA 1MXOA 2MD0A 4WK7A 3J7ZI 2M30A 4QPQA 1FBSA 2JNPA 4L63A 3T4KA 3B47A 3FPWA 3DL1A 4F3LB 5FD6A 2XHKA 2OY2A 4A3FJ 2FOWA 1LE8A 5LGUA 3W6KB 5FEFA 4D9JA 4S04A 4XQFA 3DV8A 5GLCA 1KE0A 2BHYA 4CA0A 1NY0A 3BYDA 2WKEA 1RC9A 2ISZA 4OWRB 4DF6A 3ONQA 1FP2A 1ERDA 2ZQ7A 5EVLA 4G9LA 4G7HF 4UA9A 5JHUA 5K7HA 3Q07A 3GFMA 2QZ8A 3HUGB 3V3RA 1O3SA 1NYYA 1SEUA 3AYKA 3MEXA 3LQ0A 3KP6A 3WS2A 2R7TA 3KO6A 4YOFA 2EIJH 1TC3C 2HJ9C 1VNDA 1W7PA 4NG2A 1B1BA 2Q2EA 4PZJA 1X1BA 2OVZA 1B8IB 5D5WB 3ZVSA 2ERQA 1AF0A 1KUHA 2M3AA 2J80A 1MH3A 1AYKA 3OHLA 3LJGA 3D9YA 3V8LA 3UE3A 1PZPA 1GE5A 2VUMJ 2XF7A 4EUVA 1OISA 4O6JA 2BW3B 3CMEI 1MW7A 1P0ZA 4DDSA 4WWCA 1P4XA 3BY6A 2R93J 5L3DA 2OBPA 1SFXA 2LYCA 1TS0A 3P9IA 5HLHA 4RMNA 2PBIA 4D5CA 1BR4A 3IHAA 5JMYA 1BKCI 2L9NA 3ZGKA 1A04A 4J4MA 4BDYA 3KX0X 3V39A 4HRIA 3A3IA 1R5GA 1R5HA 3O3VA 3C2WA 3UE6A 4FU4A 3TVCA 1U6GA 2HVQA 3MZ8A 2XFTA 4EQIA 3HDAP 3ABLH 4IHSA 1OCOH 2XVCA 1U8BA 2WUQA 2RCXA 5TGTA 3F6VA 2XGDA 3B2ZA 3TEDA 3MQ0A 4E3NA 2ZKZA 3L2WA 3W6JB 2O99A 5F0FA 1WH7A 3PHYA 2DODA 2GIZA 1MSFC 1VQQA 2ZQ8A 5F5YA 3MKEA 1RESA 2ZMFA 4X56A 2ESNA 3S22A 1D3YA 2O8XA 4XLEA 2OUMA 4YELA 4BBSJ 5HL1A 3CMMA 2XB0X 2MGQA 3S1RJ 3VOLA 4ZDOA 1O0QA 2IPQX 1HVBA 5IT3A 1SVMA 3SDGA 3QOEA 4V2GA 3UMEA 1W5SA 5EM1A 3O8GA 1YJNI 4HAMA 1IF1A 1RMZA 4BBTA 1XJ3A 1OT9A 3DFGA 1UZCA 3I53A 5E3MA 3I56I 3CCSI 3E97A 1ZR4A 2R92J 3F8MA 2XLNA 2Q9NA 4PCQA 2HP5A 3M8EA 4XUXA 5H6QA 1D5JA 1IV8A 5FKMA 2JSPA 4XSXF 3R60A 1IYQA 3LGPA 4A3BJ 4KMUX 3N8SA 1D8FA 1FCMA 1MBLA 2Y0SA 3B92A 1XSDA 1GLNA 1IN8A 1VQ4I 4QLCU 3HB9A 1FSHA 2R7DA 2HXIA 5AQBA 1S6LA 3BCBA 2V1XA 3BFFA 3Q9SA 1YW8A 2X1DA 3AFHA 2VJJA 1FOWA 5U47A 4OAYA 1LFBA 4HX3A 2QGUA 4GCVA 2W3DA 4EEPA 3MVPA 4MEZA 2WO8A 1BOBA 4YFMA 5D8LB 2O3FA 5BQTA 2VKHA 1FCOA 5KAIC 1O07A 5BOYA 4LB6B 1GV2A 5B5PA 5J40A 2HS5A 3C7JA 3FISA 3D5LA 3HRTA 4BBUA 1TQMA 5CHUA 2WAFA 2QCOA 4DJAA 3T5XA 5IP9J 2A5WA 1PUFA 3P1VA 4NQWB 1O3TA 2EA9A 1K55A 3KYQA 1FSWA 3VP0A 3RQ4A 2R9WA 2NOGA 3MXSA 3F15A 4MGRA 2D1VA 2YS9A 3I71A 1XB4A 1F1ZA 3P7NA 4JBAA 1Y8QB 2V1NA 4JXSA 4BMWA 2Z16A 2XQZA 1XFYA 4R3VA 2KKOA 3L09A 4N1HA 3BQAA 4RB2C 1BLHA 2PD7A 3LSGA 3DEWA 3AL0B 3ZPLA 5J3WA 3ABMH 5FRMA 3F3XA 2WAEA 3L2QA 3WRTA 1OCZH 1QHHD 2NS7A 3IXDA 2OAZA 5F64A 1AWCA 3EUHA 3MKWB 3HDBA 2IA1A 2F5DA 2IAIA 4EETB 2X1CA 1J09A 1R36A 2X3CA 2POJA 4Q8IA 4H30A 2XV4S 2ZQ9A 4HI4A 1R1VA 4S2KA 3ML6A 2A5YB 3FWLA 3HHHA 3O5YA 2HOTA 2BXYA 5E2GA 2OAP1 4LG3A 4YWZA 3LIDA 3FKIJ 4B88A 1C3IA 5FLXK 4EQ1A 1OJ5A 2M0MA 1JH1A 1MBGA 6PAXA 4DYRA 1T0FC 3PR6A 3WS5A 1SLMA 3ZRGA 4BENA 2ZJPF 1GHPA 2XDVA 4AYBN 4Y13A 5FO5A 1T56A 2P6TA 2FFYA 5E8GA 1ZTUA 1QZYA 4XBFA 5HLTA 4CPKA 2CG4A 1K7GA 5D7WA 3WV1A 2CFOA 2ZSIB 2FV9A 3RXXA 4EM0B 1F98A 5FDHA 1MJBA 4H4KC 3IWIA 2QYOA 4O8GA 2O36A 4KT6A 4HQEA 4R4RA 3D0SA 2ZL1B 4UV8A 2FV5A 3S2DJ 5DUIA 2ERPA 1B8YA 4DDYA 1RZ4A 1PNEA 1K79A 1HSTA 2Y2PA 1LE8B 1JXSA 3P01A 3PJRA 1CQAA 5G4YA 2X7MA 1CXVA 1K7IA 4M6YA 4QKZA 1Y8RB 2EILH 1MNCA 1XM5A 4YIRX 4LG0A 4KZBA 4PK4A 4ANJA 2H10A 2W15A 5CZMA 3CAXA 2FA5A 1P97A 4IVKA 2CV0A 4ZBEA 3K0LA 5GLAA 2V9KA 1LLBA 3ISPA 3ZQQA 1W7PB 1QMEA 3LSMA 3VTGA 5JI6A 3MJQA 4HX7A 4IF4A 2Q2EB 3TO9A 2XPWA 3FXOA 2XD5A 1F43A 1QVUA 3VYUB 1D8MA 1SFKA 2O61A 4F92B 5IT5A 5DF8A 2GAUA 2RNGA 3O64A 3U1KA 1XSVA 1XMXA 4EBPA 5K5BA 3TT4A 3FM3A 2R7WA 4FCYA 3BWLA 1LL5A 5FATA 1K6OA 5F1GA 2ZXWH 5J47A 4WL9A 1Z7LA 5FGMA 4RVAA 1S72I 2EB7A 4P5OA 2HI3A 4JX5A 4C2TA 4JQGA 2E71A 4WYYA 5EVEA 1KUGA 1TEMA 1ZK8A 3N8RA 3E0YA 3QHYA 5EE8A 1MMPA 1XPBA 4BHBA 1Y4OA 2PRFA 3OR2C 1X1PA 5L79A 2L4RA 3HOUJ 3FMRA 2QVOA 3IV5A 4O0PA 4QY6A 1WJFA 3OYDA 1W7PD 2Q0OA 2XF6A 1IN7A 4I76A 1D7EA 5HLIA 3ZVTA 3ZVWA 1JAOA 3PBRA 3OYAA 1DU0A 1MMBA 3GEZA 5HDCA 4XM6A 2TCTA 4KFCA 1BZAA 1YLJA 2LOOA 3I54A 4Q0JA 4ESPA 3IWZA 3O6BB 4HF1A 4UV9A 3M6BA 1G4DA 3JRHA 1FWZA 3JTHA 3H9WA 2FQ4A 1UMQA 3HLWA 1W0TA 1JI8A 4GWNA 4Y0UA 1Y28A 2QKLB 3PSIA 1GXPA 3KE2A 2JN6A 4FCFA 1W36D 3WTXC 5LRSA 4GR0A 2COBA 2OZ6A 1FT9A 1T8IA 1J9IA 1GSWA 5D6EA 3OOPA 5FA7A 1GDTA 2IS2A 4PFPA 1LEAA 3Q7VA 3F72A 3FG8A 1UAAA 1WJDA 1N77A 2EX2A 4HPQA 5IS1A 4FX0A 1DRMA 4H3XA 4JYKA 3U2AA 1ETYA 3T1RA 3OY9A 1OM6A 3NJAA 1ZHFA 4E3KA 1HQCA 1OYWA 2PEXA 3V8KA 2SRTA 2Y91A 1IG7A 2STTA 1UGUA 2EFQA 1RIOH 3IHUA 1Z7UA 3ZMUA 4U88A 3DBRB 3ZHHA 3L7HA 2FD5A 4MCWA 3IRQA 1IC8A 2LF7A 1HW5A 3V7CA 1K83J 3CJRB 1MDMA 4EESA 2MC4A 3H9JA 4EV0A 4X1MA 2HVSA 5HS8A 1BI0A 2MD5A 1G3YA 3OV8A 4H1QA 4ZC3A 3CHWP 1IYOA 3O87A 3I7GA 1QPMA 4U0YA 1QJJA 4CYDA 2NXNB 2WTEA 4FTXA 3LILA 2BYVE 1JIZA 2NVQJ 3RI4A 5J4EA 3RKQA 3TQNA 4AFIA 4ILWD 3M3YJ 3KFWX 4XLAA 4B4CA 2L7MP 1H8YA 1BC8C 3KMCA 1ZP5A 5D5UB 1QA6A 3G1OA 4Y3OA 2OD5A 4QJGA 3DWZA 5LABA 3U2RA 5E18F 1FX7A 3J80K 3DTKA 2NVTJ 2XGNA 5CHJA 5EEHA 3MD2A 1PZOA 1CEFA 3S1NJ 3QP1A 3W3CA 456CA 2OCCH 2YKHA 1TWCJ 2YU3A 2JBFA 3DTEA 2ZMEB 3S4XA 3F8NA 1R1UA 2HP6A 2K86A 4NKPA 3EQUA 4LV1A 1GKDA 2DA4A 4IEJA 3V42A 2Y8HA 2QQ9A 2LH9A 2ZXJA 2OXWA 3ZG0A 4ZYEA 4OP5A 3CCRI 3BPVA 5J8XA 2DAOA 2HGCA 3O8HA 3M4OJ 3H3ZA 1H9GA 2V2FF 2GM4A 4PKVA 3CP2A 4U0VA 3A02A 5KNLA 2P4WA 3PXPA 1JAPA 3P5JA 3GLXA 2VE8A 2LD5A 2JKRM 3E6BA 2CV1A 3EDZA 1HLUP 2XK1A 2DNSA 2RGVA 1V5FA 2HF6A 5F04A 2XD1A 1SFOJ 1JAQA 2M34A 2IBDA 2QBYA 3NOPC 2HDRA 4R6LA 1H9TA 1GVDA 5IT9Z 1X4OA 4KQDA 2A07F 4Q1LA 4E3JA 1T18A 5EVIA 3CDHA 2ZMAA 4GHIA 4XCTA 1P4WA 2JVGA 1OJGA 3HBVP 2VQHA 5AONA 2VJ5A 5L07A 3LY3A 2L9RA 2X3BA 3J80Z 1HKQA 4OMZA 1XJ2A 4CSWA 5LGNA 4DBRA 2CV2A 4RM3A 3H7WA 1WJ5A 4EJOA 1BIAA 4D2OA 4P6ZS 3LEAA 4ETSA 2NVUB 3S1YA 1WI3A 4LG0B 1I1SA 4I38A 3BOQA 2MSYA 3FPVA 2VGLM 4C3HJ 2IWCA 2R0QC 2JIHA 4AYKA 4PJJA 2W48A 4EU0A 5FKLA 2KOIA 3BEBA 2LTPA 4UQIM 1TW3A 1TWGJ 2WY7Q 2IXSA 4CLCA 4JPMA 3G34A 1FZPB 2E1MB 1TT5B 1SD6A 3NEUA 1YI2I 3TJZC 2K40A 2A69F 5J1UA 3EGXC 1B6AA 5JLXA 5FQIA 1LQ1A 3DWKA 1XURA 3FF5A 1RGZA 1BA5A 2JT5A 3HUNA 4MO7A 1TWHJ 1SAXA 2WZZA 4IKFA 5E43A 4XICA 3TL4X 2ZXIA 5EOEA 3N05A 3K69A 1SDEA 1KU2A 4B4ZA 2O5RA 1A86A 3FXQA 2JA6J 1YPRA 1ZG3A 5ERIA 1TVIA 1TDGA 1VQOI 2ACGA 1HZOA 2LB9A 4UEYA 1YS7A 2X0LA 4UVAA 1IAEA 4AXQA 4KA4A 2PQ8A 3A3EA 3G71I 3MZHA 4R23A 5L7FA 4R3BA 3ZCZA 3S3NA 4CZZA 2D1OA 5JHFA 3RZDJ 3JRAA 3W4QA 2FBKA 2M8GX 3LIRA 4ITVA 1HDDC 3K9TA 2K7SA 1ON1A 4FHTA 1FMWA 4RLFA 4WXCA 2Y2QA 3LR5A 1WHUA 4JXVA 1FSEA 2EZHA 1AXBA 1HA8A 1X2MA 3HRSA 3S3OA 3Q2HA 4F52A 3IKVA 5EG0A 1FJLA 1YMSA 2XAUA 4DE1A 3MKFA 4DE3A 1IKIA 1BJAA 3Q9VA 4ESBA 4H0EA 3FXKA 4P96A 2WA0A 5HLGA 1D5VA 3CLOA 2Y69H 1GKCA 4BJPA 3HOYJ 3FK7A 1ZG5A 3W6VA 3KRYA 2LBFA 4HZFA 1K6RA 4BDZA 5BPIA 3Q7VB 3LO7A 4XOPA 3W2WA 2ZJRF 4OPZA 3FBNB 1GSXA 5DD8A 4NB5A 4B8XA 3UMDA 3HIFA 4KNYA 1CGFA 4JXWA 1JNUA 3VSLA 5KCMA 2ECCA 3EUHC 1LSVA 1MNDA 2VLGA 1B9MA 1MWUA 2Y2KA 4GD6A 2FRHA 1YQAA 3K70D 3HZJA 2AXTC 4YFXF 3KPHA 3TOAA 1ZQ3P 2MYSA 3JTGA 3ZYTA 2ELJA 3S1QJ 5HAQA 3G2BA 3UO9A 4BBVA 4V19K 1SKFA 1MDMB 2F2EA 3OYIA 3L2UA 1ZR2A 2W0NA 3K3CA 3HYGA 3G73A 1D8KA 3GV9A 3OPHA 4LRZE 2WGVA 2J3TD 1UJ8A 1MMNA 4C2MJ 3U9GA 2AYKA 3SFIA 2JT1A 3G2YA 4ZDPA 2FUG2 5E17F 2DO7A 3F9KA 3EQVA 3BC8A 1D7XA 2JRMA 1XFXA 3JYIA 1S3JA 2XRNA 2XEPA 1OCCH 4LLGF 3M1CA 3QPSA 3RSNA 1KE4A 4IN9A 5IU1A 4G7ZF 3EDPA 2VPLA 4HDUA 3HJEA 1K25A 4RX2A 1XCVA 3HKZA 3LSPA 2WKQA 3HLGA 4IOCF 3GZ5A 3RKYA 2BLSA 4GW9A 2RV8A 3IBRA 2VXZA 3M07A 4PDKA 1I76A 1LSWA 4G6TB 2L9SA 2VQLA 3ZP5A 2GA2A 3LSTA 4A3GJ 2EROA 2I9VA 2V20A 3E5QA 4CCMA 2FJ1A 2W3EA 3KSIA 5F08A 2ZXHA 1YIOA 1YJWI 3COAC 4OIOF 1XSXA 4LLLA 4G3KA 4UA6A 3JRDA 1YTYA 3OYHA 3CJQB 4IHYA 2VQCA 3VYSB 1YSQA 4GKUA 2IWDA 3JRIA 5ILUA 4ZJ3A 3R0AA 5CGWA 4XLPF 4XMYA 1TS6A 3TP0A 1APLC 3OPRA 2IW5A 3F8CA 4KZ4A 1X3ZB 3G3ZA 3QP2A 5J4VA 2EX8A 3GUDA 3WGIA 3T4QA 2JT6A 2FZ0A 1JVJA 1YAXA 4GF1A 2BY3A 1O7EA 1MGTA 3KLNA 2OLVA 3PIOF 2VX8A 3WV2A 2HPBA 1PUEE 2HZ5A 1JGSA 4ZRRA 2OXUA 2DA3A 3DU6A 4KUMA 2PJPA 2EXBA 2JMWA 1PRQA 3IX4A 2H0YA 3L00A 4IUKA 1WJEA 1D1JA 3ZNTA 3JVVA 3CCJI 4Q48A 1VQ9I 4NXBA 4F55A 3BT9A 4N9HA 2QKMB 5LFAA 1K6SA 1PI4A 2AHQA 5EVIB 2ZFWA 1A0KA 4GHIB 4B44A 4M3GA 3HHGA 2LR8A 3TBIA 1IABA 4HX8A 3VP3A 4ZZDA 4HYEA 4AD9A 2WGWA 3DPLC 3V7SA 4DD8A 2J9OA 5FI2A 2RREA 5FRNA 3FMSA 2H09A 5GADJ 3ITBA 5KSCA 2IA2A 4IQ4A 1BYWA 1E2XA 1VTNC 1TQPA 3Q81A 2XGCA 3LAPA 3H7WB 1MZUA 3LQBA 4MTDA 5ICGA 3IXGA 4WF0A 3QWLA 2EFOA 1Y1WJ 4CZCA 4UA7A 1ND1A 1UG0A 5L3GA 4XKWA 3HRUA 3ZG8B 1VHMA 1FIPA 1XFWA 4AVZA 4LCLA 1QHGA 1GT0C 1AHDP 4CLCB 1RR8C 5FAOA 3EUKL 2J3TC 2JKRI 2HQNA 2OV5A 2IGKA 5HS9A 5CRFA 2ZM2A 2X01A 1ERQA 2JA8J 4FXYP 2NNYA 1F5TA 5L09A 5EVID 3F23A 3WGGA 1HTDA 4PJLA 1VB6A 5E3OA 2CW8A 5AJGA 1K7AA 2GLOA 4JGOA 4M9SA 3HREA 2ZD8A 3C5AA 1HY7A 3V4GA 1SD4A 1UTZA 4NC6A 4MFEA 3CF5F 5EF6A 2GXBA 2HV1A 4X0GA 2ZC3B 3GLLA 3QYBA 2BY2A 1H8AC 1I27A 4S2NC 2EFWA 1HTZA 1G05A 5AQAA 1BUVM 1U8RA 3CCQI 2PAVP 1MBHA 3SFZA 1IN4A 2G7HA 5D4RA 1P6RA 2PMUA 5HDDA 5F1FA 3S2HJ 2FU4A 2XS3A 4E7ZA 3S3MA 4CICA 1Z05A 3KYLA 4S2IA 3K2ZA 4BYYA 1LJ9A 5EZGA 2XUBA 2COMA 2AS5F 4CLCD 3FKJA 3NECA 3HLCA 1RR7A 1TQIA 3O88A 3JVUA 4KIGA 1XFQA 5FKOA 1XUCA 3VP4A 5FQKA 1C3BA 1JUPA 4L0YB 3OHOA 2FBIA 1N4OA 3F8BA 1BLSA 2QKPA 2V9PA 2XA7S 4Y15A 3QYFA 4EGYA 4EVIA 5EPHA 5HODA 2HQ5A 4M3EA 2L7KA 4E3IA 2V1UA 1IYSA 3HOXJ 4I39A 3PBOA 4ENJA 1ATLA 1XX2A 2YSRA 3VOYA 2GXGA 4AWXB 3VFHA 1LUJB 1QRYA 3H35A 2HYGD 4B43A 2K9MA 1K56D 2OAQ1 3WHCA 4NEED 3PO3J 3IXHA 4PKSA 4OIPF 2MH2A 3MZYA 3GFJA 3AGDA 3OBFA 4BL3A 3IH8A 2V7FA 1FBUA 1CIZA 3UB9A 1ONHA 1G2HA 3IQAA 2GNXA 2F5VA 4FSFA 4DKIA 2OI0A 1GSVA 3EOIA 3FX3A 4W97A 2E36A 3K4KA 1IW7F 2XPVA 5DV5A 3QP6A 1X19A 2ZC5B 3OYFA 5A2QZ 3IWQA 1SZVA 3NOUC 3J81K 1ZGAA 2J0TA 3E8RA 2O8KA 4E7LA 3HCYA 2QWSA 4UXNA 4A3DJ 3OIPA 2V9VA 3OR1C 4OLDA 2EZLA 3NQOA 1YRNB 3IX3A 3RTYA 2OW9A 2XF3A 4A3EJ 1HDPA 1YQYA 3RTRA 4L9GA 1BM9A 2VN2A 3NDEA 5HDKA 2W12A 2JPBA 2LKSA 3E4PA 2DBBA 4M4XA 1JK3A 4IHQA 1MBFA 2R7OA 3SZPA 3OSFA 1BM6A 4LD5A 5EVIC 2K85A 3F17A 3BZCA 2QQBA 3CESA 4EERA 1PIOA 4XLFA 1IDYA 4LIVA 1XAXA 3BLYA 4XL9A 2VEAA 1OO9A 1V9ZA 2R7QA 2O3EA 3A0HC 1OPXA 1RI7A 1WVRA 1S7EA 1UWPX 4LITA 2Y2MA 2Y59A 1PJRA 5HNFA 2W3HA 3TW8A 3K4JA 1LKXA 2P5VA 1BBYA 4DYCA 3I4NJ 3QODA 1O7LA 2L3DA 1K4SA 2D5VA 5CGXA 3GTJJ 1XXMA 1FM1A 3RYPA 1OPCA 2VBZA 2EIKH 3MKLA 2V1AA 1R1JA 1QGPA 3OYNA 4UNOA 4NETA 3J81Z 1D0YA 3KIOA 5EUAA 1DUXC 4DXBA 1E3PA 5HOOA 1SVLA 1TNSA 1TS7A 3PQJA 3DBAA 3OC2A 2XROA 2ZBKA 1YHQI 4WZ5A 2LNBA 3C7UA 1Z9CA 2DW4A 3HL9A 1MD0A 1XMAA 3UB6A 2DA7A 2P08A 4KG5A 4L5JA 1ONVA 3DBHB 2DOEA 2J8YA 1IRFA 1Y1VJ 3DPFA 3VEPA 2ESHA 5EFWA 3IWOA 3MCZA 3HY7A 2CFXA 5FKNA 4BQOA 3HG9A 5TRDA 2DN0A 4BGDA 1RKWA 5EYRA 1VEUA 1LFUP 2D1NA 3JRGA 1SMTA 1L0EA 4Y7NJ 2WGWB 3BR3A 2HQAA 3CUQA 3H36A 3M7GA 1Y93A 2A3UA 3L9KA 1JUMA 3UR3C 4XUZA 1CGEA 2BGCA 2X6WA 4EBLA 2BZTA 4OLGA 3OIQA 3SS3A 1E25A 3LQRA 2W1OA 1CJFA 3D1NI 4ETXA 3V5MA 4GJ4A 1BLCA 1LSXA 4CCLA 3JRBA 4C3IJ 2L9VA 2W1TA 1S6RA 2G2UA 2CLTA 3WV3A 3AAFA 3RJUA 3S7NA 3SS4A 4QSHA 4XK4A 4M6XA 2IRFG 1KGGA 4GR8A 5HDGA 4DZPA 2KISA 2Q1ZB 4UQIS 3MKZA 1GV5A 4PMAA 4WELA 3SS5A 2KIUA 3MKYB 4AIKA 1Y39A 2M7UA 1I3AA 4PAUA 4WK8F 4IHTA 4FX4A 1IXRC 5D6FA 3C2GA 4FQGA 4N9IA 3QU6A 2F6CA 2IWBA 1G6OA 3N6IA 2HKOA 2EX6A 3AIGA 2DW2A 4HEFA 1VQLI 3BQYA 2A6HF 1VQ8I 4MN6A 4GQLA 2L0RA 1BKCA 3AG2H 1N9LA 1GCEA 5DTKA 1XGJA 3LR4A 3CDLA 4C9YA 4FTHA 1XA1A 3LFVA 2HOSA 4KUOA 2PJTA 4Z1WA 1OJLA 4EJTA 2E2IJ 1K78A 1IJWC 1KQ0A 1XMKA 3BZKA 4U3TA 4XORA 1MC0A 4BKXA 3SYTA 5F82A 2W84A 1OMEA 1JANA 5GPAA 2ZJQF 4KENB 4QHCA 4UHUA 5CEDA 5FJ8J 1X3UA 4OOMA 5JVTA 1RUOA 2ZSHB 1NG6A 4N1XA 1D1BA 2F48A 4JKTA 1YQSA 3JSOA 4X68A 1D1AA 1YX5A 5DFYA 3ABUA 3HSFA 2ELKA 1KYWA 1BQOA 2RJPA 3BJAA 2PYPA 1ACFA 1TVFA 4I01A 2O03A 1QMFA 4KQQA 1WYCA 1YP1A 4A7BA 1Z91A 4HSTA 3RDIA 1BL0A 2HDUA 3F1PA 2JRTA 2Z3YA 3S8PA 4GOGA 3LIBA 4K0WA 1VI0A 4B3XA 2PBDP 4MNUA 3E6DA 4A3MJ 3PQKA 1NHAA 1F2KA 4OINF 1Z1DA 2QSGX 2EWWA 3B02A 4RQ9A 1Y56A 2W3GA 2QPNA 4YEJA 3R7WA 3LR3A 1XA7A 5D4SA 4IHVA 2UXXA 1HOMA 2HKXA 2WBMA 5M1AA 3LA3A 5M3FJ 2OZRA 4XONA 4PSXA 3TSGA 2K2NA 4PKQA 2OWJA 1KA8A 2JUCA 1GXQA 1BR2A 2JA2A 1P7JA 3BR2A 5IOYA 4HQMA 4FETA 3FK6A 5DKKA 1ALQA 3KP4A 2EFNA 3TG9A 3VYTB 1B3DA 2Y2NA 1MJAA 1GUUA 3TMOA 5FD5A 4TV7A 3B6AA 4GUYA 1UMTA 1G3TA 4O7DA 1PW1A 3H5RA 1AA7A 1LT0A 2DA1A 1WSUA 1WA9A 3PBQA 2LP0A 3H0GJ 2RKHA 1KDWA 3N8LA 4DW6A 5EV0A 3JAMK 4M6VA 4RYEA 3S15J 2GZWA 4P1WA 3F1AA 1D1CA 3WWXA 2FF4A 2L2OA 2FFFB 5L10A 2K9QA 1HW1A 1ZRDA 2OF7A 4E70A 2JN7A 1ZLJA 4L9TA 5C3EJ 4ENMA 2ICWG 4GYIA 4AC0A 1ZKGA 3S17J 2HU6A 4Y4RA 4JP0A 2NNNA 1KYZA 5BMZA 4HBLA 2CGPA 1R71A 3LEQA 5DD4A 1BUDA 2F5EA 1YYVA 1V4RA 2DOFA 5K1YA 4Q5SF 4BQMA 2UZKA 1I73A 4ZYGA 3T4LA 1LL9A 3UB8A 4MDZA 2RAEA 5LBQA 5I4OA 1CK7A 1FOYA 5FL3A 4ZDXA 3RPUA 2MLGA 1ZG6A 3EYYA 3LSJA 4PKYG 1NYMA 2M7BA 1G3WA 4KZ7A 2CUFA 2XSDC 2EXAA 2DCEA 2Y31A 1RPWA 1YS6A 4LMYA 1JWVA 5FSRA 5IPAA 3HL2A 3CMYA 3R4KA 1JKQC 1BLPA 3ZMZA 4B48A 4JK1X 4OPQA 3JAMZ 3BR0A 5G18A 4WLAA 1FOKA 5B1BH 3GR2A 2KT0A 3KETA 1MIJA 1V5GA 4QWOA 4BU2A 1I5ZA 3MF0A 3B3XA 1ZAOA 3U1DA 4Z9QA 4YRVA 1ZYRF 2CQKA 1ZKJA 1TW2A 3MMHA 4IRIA 5CQEA 4BXFA 1GA0A 2XDMA 2DMNA 3DAVA 5D2BA 3BPXA 3ABKH 1GO7P 4KN7X 1LEBA 4XLHA 3IWFA 4KZAA 2UUZA 4I99C 1JTGA 1Z21A 4S2MA 1Q2QA 1LB2A 5J8FA 5GHXA 3HSEA 1A6QA 3VDXA 4P55A 1R1HA 2VA0A 3M8JA 2A2LA 4JBFA 1BR1A 3QU3A 1NLYA 2Y2GA 4WMCA 2D02A 4GN2A 2W3FA 5KHDA 2P7CB 1MNMC 3C30A 3PYPA 3HOZJ 1N9BA 4PM7A 2VB6A 3KEYA 3C4PA 2ZFUA 1VEUB 4H8RA 2XGXA 2JKGA 3DQVC 1HFSA 1W1WE 3FZVA 1A6IA 3JRFA 4L9JA 1K0KA 2R9XA 1SLNA 1IGNA 3HDDA 5FAPA 4ESJA 1TZLA 4G6DA 2LLKA 1M40A 4JXGA 3VE4A 3F1OA 2IA0A 1I50J 1YE9A 3BR1A 3HVFA 2EINH 2RQPA 2HGVA 3C3WA 3N97A 2IS4A 1ZTQA 5D8KB 3OCLA 3RCOA 3PNVA 2ZMVA 3KECA 3DEUA 4IRGA 3LYXA 1MWTA 5CXAA 4M72A 3BR5A 3A0SA 2XR0A 3JRCA 3UDFA 2HTJA 2LKXA 3UPPA 1N9NA 2M87A 3DP7A 4A12A 3E0JB 1E0EA 1J59A 1ETKA 1ZGWA 3RKWA 4XKCA 2JE5A 3F1NA 3GDIA 2X6OA 4UB8C 4CQHA 4DXCA 5D1SA 4CXFA 3CCLI 2ZC4B 1W8YA 5FFZA 4AU7A 3IT9A 3Q1FA 3SXYA 3WTUC 4XBHA 1VQKI 1S9HA 2CQQA 2Z99A 2DPDA 3GMWA 1LDDA 3GW2A 3CKIA 3GTGJ 1I5QA 2J5OA 4X25A 1E3OC 2JSCA 1K78B 2J9PA 3BY8A 2JA5J 4GDFA 1ZG1A 3FDYA 2DYRH 3CCUI 5GTIC 5DVAA 1R1IA 2KP6A 1L3LA 2DFFA 4CGZA 2EFUA 1OTDA 3WTTC 2Y75A 5M5WJ 2HJEA 2Z9OA 3UDIA 1BZSA 2YB9A 2KRHA 5DEQA 4CJNA 4AUOA 1ES4A 1QBJA 2LY9A 4EBNA 1IN5A 3KZYA 1PFLA 2FEZA 4XM7A 4MQVA 4Y3IA 5CX7A 4M9ZA 5DJUA 4JGRA 4R1HA 1I2SA 4EJUA 4E7IA 3LIFA 2ZJ9A 4IBXA 4HJ4A 5H6RA 3ZG7B 5DF9A 1BI3A 1OQYA 1T39A 5E20A 1ETXA 4H49A 2HPIA 2OTJI 3F1PB 5CTNA 2FNPA 1WE4A 4ZTJA 2OLUA 5L8MA 4RA7A 1F4KA 4GR3A 3D3OA 3I59B 4LENA 4N4NB 4QB8A 2GX5A 3EWJA 1WKMA 4HX4A 3H3VK 3LWFA 3R6SA 3ZCOA 4EJWA 2WKHA 1Q3AA 3R7WB 1O3RA 3N4MA 3IHBA 2QYBA 1J0RA 3JR9A 3F8FA 5BS6A 2I10A 3KYDB 4W1UA 2P6SA 1R54A 3K1MA 3KEOA 2PFBA 3S7OA 3PNTA 5EGOA 1UB9A 2V1ZA 4LV0A 3GVAA 1XPXA 4RGSA 3O3KA 3I4MJ 2VJ4A 5H2FC 2WV0A 4XR6A 1YW9A 3BQ8A 3HUMA 2E1OA 2A05A 3E4OA 4LLOB 2DMQA 3A3FA 3VOEA 3H5AA 3E98A 4N92A 4KDPA 4M3DA 1C8TA 3CO6C 1I2WA 1L0OC 4M3FA 3B8ZA 1I3QJ 2CW0F 1OYIA 5E2FA 1AKHA 2KHMA 2JCHA 3ZG5A 3TKYA 1O0TA 1LI9A 4WZ5C 5KSHA 1IRXA 4G0DA 2NOJB 4NBQA 2VV7A 4I0AA 5G4ZA 3IC7A 5HD3A 2LVSA 4DRTA 1W0UA 1B72A 3IBJA 4IUWA 1VQPI 5H20A 2BBYA 4KITB 3ZUKA 4E3LA 2PMZN 3T8TA 5HL6A 3Q3SA 2P7VB 3VV4A 2BEOA 1OYYA 4NXGA 1L0FA 2K9CA 2P04A 2INWA 4K0XA 3SHFA 2PI0A 2X4HA 3JPUA 3CUQC 1O7FA 2LFBA 3U4LP 3ULFA 4B3AA 2CJJA 2QF7A 3DPUA 4EMSA 4HNTA 1S4BP 4R8HA 4HQAA 5EEAA 4RGUA 3LFUA 4CDGA 3WTZA 4I7HA 3Q7ZA 5CHMA 3GTMJ 5GLDA 3E6MA 4PJNA 2VE9A 4AVPA 1HD8A 4H6JA 3KZZA 3OYJA 2K02A 3PNYA 2WWYA 5I12A 2XAQA 5H8XA 4ZZLA 4A3IJ 4OOIA 4CHUA 2DFEA 1D5YA 3T4OA 1OS9A 4A3WA 2F5FA 5LHIA 4I3IA 2WGIA 5I5LA 2V6EA 2X85A 4A6EA 1P9RA 3RPUD 1D0ZA 1T1AA 5IYDJ 1ITYA 5CGSA 4FXQA 2E34A 4Y33A 4HMAA 4HP4A 2KJCA 4PKUA 2YKFA 5FDSA 2LG4A 3UPOA 3BFDA 3E5XA 4S05A 2L02A 3HLFA 2VT2A 1W63M 5HARA 3IXBA 2NVYJ 2QQAA 4XM8A 4EFSA 2V0UA 4NXEA 3SEQA 1OM7A 3RH8B 5M3MJ 3NWSA 2WAQN 1JKOC 1UHMA 1TF1A 2B18A 3J7AY 2ZMEA 3ZMVA 4KZ6A 1IO2A 3L7WA 2DT6A 5J6XA 2DRWA 3LUQA 1R22A 1W5CC 1J9MA 4EQQA 4RX3A 4NC7A 5BNGA 1SCWA 3KP2A 3F1OB 1HXDA 2OY4A 1FBQA 3ZG9B 4IL6C 4A2UA 1SANA 4OQHA 1LHYA 5TGFA 1A31A 3K1NA 3WS1A 1OMJA 3GFIA 2KDKA 2FXAA 2BY1A 2VONA 4L7AA 3IF6A 1DGRM 1OFCX 1FYMA 1BI2A 1YLPA 1FEXA 2V1BA 3BTIA 2L7ZA 2OTLI 4F7ZA 1ODDA 2XPUA 2CQNA 3FYZA 2OWHA 3GXOA 3F1NB 1YKDA 4BUPA 1TNTA 2CKIA 4AYBA 1S66L 5F27A 2CC1A 1HCRA 2OZUA 4P9UA 4WF2A 1ZHHB 4XRSA 4WMCD 1F36A 2Z2MB 4D60A 4XLCA 2EFXA 4Z2YA 4EUZA 1IDZA 1PDNC 4KIBA 1KE3A 3ZQLA 4PPRA 3CG5A 1YX3A 1DTHA 2VQGA 1ETQA 1UMSA 4D1QA 2ZQAA 3FV7A 4XSZF 1KGEA 3CMAI 1L6JA 1MMQA 1MY8A 4C3JJ 4JF5A 4QU3A 1FIAA 3QPLA 2DMUA 4MQ9F 1PVEA 5FKKA 1XJ6A 4K2EA 2ADUA 2H8WA 2Z6DA 3CMZA 3RPQA 4JGQA 4QPRA 2ZC7A 1YLYA 3PFIA 1T1CA 2VXDA 4EV4A 1FPQA 2RNJA 1NXYA 4OMYA 2J83A 5J3LA 5L3EA 4UVBA 4D7NA 4Z6YA 2EV5A 1L0GA 1Z6TA 2DTZA 2XF5A 3QNBA 3E7LA 2J5PA 3Q2GA 1SU3A 5HDNA 3S14J 1N25A 3O86A 3LUNA 2USNA 2DYSH 1JGGA 1ONGA 2P8TA 1V3FA 2KDOA 1KAPP 2RJQA 1KVLA 3G35A 3NARA 4HJ3A 2TCLA 2MABA 5BPAA 3A0BC 3T1QB 4IQJA 2W24A 3QOPA 1CAQA 3UY6A 4Q0HA 4EJVA 4ABZA 3KYEA 3FMQA 3GBOA 1QUAA 1K54A 2EA2A 3LSRA 3P98A 2X3AA 1P4AA 1V54H 2A3SA 3H9QA 2W0DA 1NWZA 2D2WA 3QPTA 3K7AJ 1JIWP 3ECHA 4UUTA 2Y79A 4EWFA 1OTEA 2P74A 2OXZA 4B1RA 3KP7A 4ZTFA 3LY4A 1PWWA 4UUSA 1Z67A 5EGOB 2NYXA 5HS7A 3I7JA 1HBXG 4C75A 4HG2A 3SDBA 4LFUA 5CXWA 5FAQA 1D0XA 3L2CA 2IS6A 3WU1B 3T1BA 3FIWA 1J7KA 2Y55A 4G3VA 1USNA 1HLVA 2M4KA 3SQNA 2H1LA 3GFLA 2DFHA 3P09A 2X9DA 5AQ9A 1NLZA 2Z33A 4XM3A 3VFZA 2DMTA 3SJMA 2ZM0A 4X55A 4DN0A 3IH2A 1STZA 5DFXA 1G8XA 2A24A 2Y2ZA 2Y30A 3K4LA 5DTSA 3OPPA 2O6GE 2M1CA 2WOAA 3VSKA 3ASOH 1AKHB 1YITI 4II3A 4LIUA 1PP8F 3GBGA 2PX9A 3EEAA 4U7BA 2EV6A 2LF8A 5HZHA 3T50A 4BE0A 1Y0NA 2KX6A 2XASA 3BR6A 2PYRA 1ZREA 3G32A 4WKEA 4UVCA 3HUOA 4A0XA 2DPUA 2FMYA 4IBRA 3AL0C 3F19A 3LICA 4A0YA 1B72B 3L0VA 2WZXA 3T12B 4CYCA 4RBOA 2P5KA 1CI9A 4RLQA 1R7JA 3MXRA 4BE2A 1YO5C 2JK3A 4E3OA 3LK8A 1BOAA 5AIPA 2I8DA 1SRPA 2Y2LA 1S7AA 3AG3H 4Y5FA 3AG1H 3FC7A 3OSGA 3U1RA 2PLYA 2OQRA 4HF0A 1ES2A 4A5MA 2L0WA 1SC7A 3AG4H 4H84A 3SW1A 5E2EA 4U7DA 1VQ5I 5L3FA 2Z2DA 3HYIA 5IOZA 2VK3A 4BH9A 2P5LC 4ENKA 3MFDA 2QJ7A 2C6WB 1YMXA 1KGFA 3A4CA 2DTRA 1QQIA 5JYOA 3KEKA 4H6JB 1TP4A 3MN2A 2ZB9A 3EWKA 2HDSA 2DFIA 1DQUA 4LCMA 2AQFA 2QENA 2KPMA 4L5EA 1FCNA 3K4CA 3K7NA 3KSGA 1J75A 4UB6C 5DCFA 3LAJA 5IT9K 3SEZA 4HBUA 4CTHA 2HZTA 3NDGA 1MH4A 4IX7A 1K57A 4FD8A 1Z6RA 2R7SA 4R70A 4F91B 5HAIA 3IH3A 4Y52J 5HPFA 2UWMA 1X58A 2RC4A 3PAGA 4GDBA 3C1DA 2HXOA 4UAAA 1WFXA 5I0LA 3P9KA 5GAGJ 1QNTA 3OCNA 4X1LA 2HZDA 2EJRA 3BJNA 4KG6A 2M4GA 4KZ3A 4E6WA 4C2UA 2CMPA 3F18A 1OTBA 1BT5A 4XN3A 4NDLA 3HOSA 3HOWJ 4G12A 1XG1A 3NBLA 2G0EA 2OW0A 4A69C 3T8RA 1Z3YA 1PP7U 3FWEA 4I98B 3IRRA 1HKTA 4HLYA 3BRMA 4BQNA 1H8ZA 2B02A 3ZN1A 1J5YA 1V9YA 1SAUA 4V2FA 2WC2A 1VZ0A 2AVXA 4HNBA 2Z2SB 1JT0A 3BFEA 2YX4A 3V3SA 1BSWA 1W4MA 3IF6B 5KMWA 4DQ2A 2D45A 2W00A 4Y17A 2EH3A 3OL4A 4OH0A 1U78A 3RJPA 5F68A 4XNFA 2KLOA 3NC8A 1ORKA 1R1TA 1W36C 1DPUA 4C30A 2ZQDA 3ECOA 1O3QA 5HFOA 3DNGA 3NX7A 1KU7A 5D3OA 1PWQA 3ZXSA 3H92A 1QZEA 2W85A 2ME6A 3UDXA 2YR2A 1T98A 2EZIA 5DM7F 1B4AA 3TO6A 5CUHA 2DA5A 2G7UA 4MBFA 1KVMA 4BWIA 3CDIA 5A91A 5AIQA 1ES5A 1T1BA 4XLNF 1ON2A 2A6TA 2BHZA 3W2VA 3UNWA 4RAYA 5ICEA 1JJ8C 3UE1A 1KGSA 3TOBA 2B7EA 3DKWA 3IAS2 4HF2A 1AOYA 3DW0A 2K4JA 4AUXA 2O0YA 2R7ZJ 3VB2A 4P6ZM 1Z77A 4J19A 4PM6A 1ETOA 4PKWA 4DF9A 3DTMA 1EH8A 2R5YA 2EK5A 4RGRA 3PUFA 3ZQIA 3H0DA 1ZGJA 5D1UA 2ECBA 1ETWA 3FZCA 3QQAA 3EEHA 2PHYA 3I7IA 1ZXVA 1G6NA 3J7AO 4LK0F 4IOAF 1G4KA 1BIWA 1TS8A 4KZ8A 3OYMA 2B5RA 1PYVA 3IX8A 2M45A 3QP5A 1YG2A 2L01A 1B9NA 1WZ2A 5HNHA 4ME4A 3ULQB 4XRSG 3IUOA 4E3MA 4FUWA 3GVBA 5DDGA 3BTCA 1XKZA 1FP1D 2WV1A 2O9LA 5DKLA 4HSRA 3NY4A 1FILA 4QD4A 4UUSB 1K56A 3BY9A 1GVJA 1XGSA 4DZJA 1H71P 3L2VA 1S7OA 2GQQA 1YLTA 4IJGA 4AIGA 4GS9A 4NXFA 4OPYA 4YIFA 1H5XA 1IFQA 2PMHA 5F0HA 5A92A 1I1IP 1HV5A 4DE0A 3NWTA 1GO8P 2DOAA 1MBKA 2EQRA 2TRTA 4OQ0A 4A93J 1FNNA 4CCNA 5KAFC 3BZ6A 4WXHA 1QIAA 1YM1A 2V26A 3GRJA 2R5ZA 2A24B 1E3UA 3MBZA 1K55C 4HP9A 4LOCA 1XGNA 2L4MA 4L0ZB 1YSPA 3NAUA 4E7KA 2Y9ZA 4GCZA 4MFDA 3WS4A 9ANTA 2DLLA 4WEKA 4BJTA 2OW2A 1YLWA 2BASA 4JOMA 4WBGA 1G12A 3MXQA 2H0TA 3NOTC 2XAJA 1IRZA 3BG9A 4CYCB 2KLIA 1MPLA 2L7FP 4IJAA 5F1JA 4AIDA 3CCMI 1C0WA 5ICFA 4DNCA 2Y0SN 4GB7A 4PM8A 3QP8A 2ZMEC 3LSKA 3C4OA 2CMNA 3LI9A 1OR7A 3HRMA 4PJMA 2E8JA 1S1ZA 3DKXA 1EF4A 3ZQCA 2CUJA 3T4TA 3KLOA 4Y0OA 3FKWA 3TE8A 2DXIA 3PBSA 4HV5A 2Z1DA 2DMPA 5D3CA 2R7RA 1EJ9A 4OOLA 4KT5C 4EXOA 1YLZA 4OU0A 2QLZA 4ENNA 3BTJA 1MKMA 1DJCA 4RGXA 1E17A 1YRNA 2HEOA 5CQGA 2TDXA 2OPTA 1JTYA 2E5ZA 3OMYA 3IF6C 3LEZA 5GP9A 1NJ4A 3Q0UA 3GO5A 1YT4A 1FYKA 1P92A 2M5WA 4R3AA 4CH7A 2E1CA 1RP5A 1D06A 5GHYA 4OP8A 3CUOA 2W82A 2PU2A 1FTZA 4HW0A 2V79A 5EZHA 1CQTA 2Y2JA 3ZFZA 2YX7A 2A61A 3EDGA 3KEQA 2MLRA 4GZBA 4OONA 4M71A 5IY5H 3V8JA 3LGOA 3L0TA 2RQQA 2LK2A 3ZNYA 3C18A 1LI0A 2C5WB 1R58A 3CZDA 2RN7A 1ERMA 3ZOBA 5AVEA 4XT2A 2V8CA 2DDBA 4NK3A 3ELMA 4ZJZA 3LIKA 2VV8A 1S0WA 3BG3A 5E8IA 2A49A 1H3QA 2V8FA 3Q0VA 1W5DA 4BJ5C 2VC1A 3H5NA 1ESIA 1X0OA 1OTIA 2E1MC 4DMZA 4M3KA 1H0MA 1GHIA 1IELA 4B09A 5F69A 3CC2I 4S2LA 1VETA 3WTYC 2ELHA 4HESA 3WGHA 3T1XA 2V4BA 4RDUA 1ETVA 2E2JJ 4BACA 2VKEA 1ZELA 1K38A 1XX5A 2EX9A 4LJZF 1K54C 1X3WB 2HWVA 4H2EA 3K4BA 2P81A 4WM9A 3VI1A 1IXCA 3HGGA 1ODVA 4RAZA 4R79A 2V6CA 5IYBJ 1PWGA 3VPRA 5BOXA 2DA2A 2WADA 3RZOJ 3GZ6A 5E3NA 1BUEA 3SH9A 2DCFA 3TW6A 4D7MA 2YPRA 4L5IA 4ZAMA 1ES3A 1LFPA 3V7RA 1CK3A 1L0DA 3A1YA 5CPRB 3WRZA 1R23A 4QY5A 2E8IA 5FFXA 4GXOA 5HDSA 2E2HJ 3G6EI 3CC4I 1ZS0A 1XGMA 4F3QA 4IEDA 2W57A 1MWSA 1U2WA 4BS9A 2KZVA 5CTMA 3ZQ7A 4FH4A 3K70C 2EBIA 2XAFA 2JKTM 2LSOA 1USSA 5C4JJ 2GOXB 4P87A 1BC7C 2H6CA 1VFCA 3K2NA 1TT0A 2VOPA 3DWBA 1Y0UA 2LREA 4BNCA 4WCGA 4JGPA 3DXJF 1XDUA 1TTYA 2Y2IA 4OKPA 2ID6A 1U60A 1SFEA 4CLCE 2KIQA 2GBYA 1ULYA 2BVMA 3SHIA 2HPMA 4BLMA 3MAJA 2QWWA 1JWPA 1KBCA 2E2DA 3E1SA 2R5YB 2IT0A 5E3LA 3FXLA 1N75A 4PUSA 4L9EA 5A93A 1M6KA 2BE5F 2LRDA 2W1RA 2KL4A 5FLXZ 3FHNA 3A01A 3QP4A 3DPTA 4GFBA 4HBTA 1DP8A 3MA2A 1G6AA 1VQ7I 5IP6A 4JX4A 5DYMA 1HSJA 4I09A 2CWEA 2K9NA 2JKFA 3G4SI 3VP2A 4UUVA 3ZR8X 5LEJA 2E1NA 2X6YA 2QZ6A 2DT7B 2HU9A 4HY8A 4LRXC 4A3KJ 2UV1A 5KIZA 4IJOA 5I3MA 1FC3A 2VIXA 1ZVXA 3JCUC 2EV0A 4I6ZA 1XGIA 1OMIA 4GGGA 3SH7A 3LKAA 2OJED 1F9IA 5I2ZA 3EDHA 1U5TA 5CVVA 5A2QK 3VODA 1IKGA 5CEBA 1OCTC 4GS9B 1IOUA 3MQQA 1ZH5A 2MZIA 4B4XA 4WEJA 3KSFA 5E1WA 4ZYHA 3MFXA 5TR7A 3H1CA 4N0BA 1DJBA 1MKIA 2XC7A 3ISGA 1YFHA 5EDNA 3TOIA 2R5ZB 3OS0A 1CGPA 1T6SA 2DT5A 2PJRA 3JREA 3UPNA 1WJBA 5DS9A 1UHWA 2EIMH 1K57C 4IVNA 3BW6A 3TO7A 2XA7M 2NUPC 2IS1A 3OPLA 1X1CA 2DI3A 5LHHA 2G9WA 2VZWA 3N2VA 2GZAA 2B0LA 2LC2A 4ZH4F 4OQIA 4DE2A 2OOLA 3C2HA 4LK1F 2F5CA 3S7QA 3PAEA 1PI5A 4KIFA 1I6HJ 3S1MJ 4P85A 2H28A 3BG6A 1FYLA 4HH3A 1JKPC 2MBFA 1EH6A 3I9V2 4I5SA 3N7WA 2HQRA 2BG1A 1KU3A 4GWMA 4S2NA 3KMEA 3KP3A 2HTSA 2K9LA 3RQIA 1E3UD 3CPTA 3HEFA 4ZDLA 1J2XA 1ZARA 3RXWA 3UE0A 4OQGA 5FLVA 2M0CA 1GHCA 2XB5A 2KRJA 2L54A 2OSUA 4GDNA 4ZTKA 5LEKA 1JKRC 4N9LA 1T2KA 2NS0A 3W2ZA 3ERMA 1S67L 1NH3A 4JLFA 1WJCA 2E35A 1FTTA 2LB5A 1UCRA 2GDNA 2P7JA 1MMDA 2QA4I 2ETHA 1IAGA 1HF0A 3HM5A 2IVMA 3D5SC 4M74A 4B93A 4GYGA 5ED4A 5JYPA 5JR3A 4PM5A 4I03A 1OZ9A 4MLOA 1PUFB 5IHVA 3CLQA 4FOFA 1EI5A 2K31A 3KYCB 3LUMA 4FVLA 4FISA 1ROSA 3CP8A 4ZYAA 3K6GA 4HJ6A 1FIKA 2QQ8A 1WJAA 3CCYA 1TLHB 4DV8A 2K7LA 2PG4A 4MN5A 1YJ9I 3N2UA 1YIJI 3CO7C 3B42A 3ZXHA 2ISYA 3HJIA 4PFOA 1I1GA 3D5RC 2JVHA 4B47A 2V9AA 5FROA 4RB3C 1DP6A 3R61A 4XT2B 2IGOA 2X1EA 4OOYA 1DP7P 3BLMA 3QAHA 1QICA 4MNRA 1ZXCA 2Y2OA 1G5UA 4E7HA 2V4JC 3ASNH 3EDIA 2KQRA 3OS2A 3BLSA 4MIMA 1VM1A 2F4OB 5F6FA 2XH9A 1K4EA 4CLCC 3C38A 4R0QA 1UELB 3CD6I 2Z5UA 1Q1HA 1UHSA 3ELKA 2OA4A 5EECA 1VETB 3K2AA 3SZTA 3T4SA 1B59A 1XCBA 3OYLA 1R49A 4WKIA 3TDZC 4DOZA 3UVCA 1BSGA 2L0KA 3ZGAB 3W2AA 3DTIA 3HC7A 5I43A 4EM1A 3MFKA 2WKIA 2VKDA 1X2NA 2LKPA 4GRIA 1IACA 4L9FA 2HYFA 3E2LA 2XRLA 2ZCWA 1DGWY 3LIAA 2AXLA 2UWXA 830CA 1PW8A 5FQMA 3S2WA 1IAWA 2KDZA 4IVIA 3O2XA 2DW1A 5AQ7A 3M2JA 2K3PA 1I6XA 2R7UA 3BA0A 1WQ2A 1JJ9A 2CUEA 4QWQA 2JJ7A 4OIQF 2KRCA 4ID4A 3ZQHA 5TISC 3MWMA 1Y6IA 2VGLS 2O9CA 3E2KA 1JTXA 2E7WA 3HJKA 3VOZA 1NK2P 1R6RA 3EQLF 1ESUA 1Z6FA 2CU7A 3PUBA 3B73A 3TSKA 3GCMA 3WHBA 3RFBA 3TRCA 2DA6A 1RCJA 3A2KA 3A3JA 4DPEA 1IYPA 4I3AA 4ON1A 3ITAA 2CS3A 2FX0A 5D5VB 3BCAA 5J1RA 1CQRA 5L3BA 2OVXA 3FHZA 2JQ7A 1MBJA 5IYCJ 1BJZA 4IRHA 3LL7A 3I0TA 4S2OA 1TD5A 2WKPA 3A01B 3GSGA 4X1EA 2HFHA 3BG5A 1NK3P 4BJ6C 1PWUA 3FXMA 1BQQM 5HWWA 2IEKA 1EB6A 1POGA 2Y9YA 2R7XA 2X6XA 4EEFG 2JUGA 4LB5A 5CVJA 5C44J 1U9OA 4HDVA 4IUHA 4E7JA 4R38A 4IHXA 3F16A 5GPCA 5B66C 3AGEA 3UKGA 4NC8A 1OR7C 3QPHA 1LNWA 2NAZA 3HOVJ 3HLDA 3J7YJ 3NI9A 3HXLA 2JKTI 2QMIA 4A6DA 4L9NA 1WYBA 2YU9J 1U5TB 4KJZA 3OL3A 2R7FA 3KWVC 2BOLA 1RUNA 2J7VA 3TGNA 2BTFP 3BFCA 3LOCA 2MW8A 3I64A 5B1AH 2H94A 2IGNA 4BL2A 1MNEA 5J8CA 4WN5A 4WF6A 2CUZA 4PGHA 4PGGA 4QTRA 1IUFA 3I59A 4ZR5A 3BDDA 3LSIA 4CO8A 1T33A 2PJRB 5CVRA 2VOOA 2VT3A 1JUSA 2DK8A 1S5LC 1KQ9A 3MZEA 4LV2A 5EOOA 3HLBA 1OCRH 4ESFA 1AU7A 4HH2A 2VJIA 3EETA 1SFUA 2ZC2A 2VGKA 1EH7A 3WU2C 5CYVA 4RB0A 5C4XJ 5C5KA 3MZFA 3CJTB 1LPQA 2FE3A 1OTAA 1QJIA 5GHZA 2OU2A 1FOXA 4BXUA 3WU0A 4K08A 1TL8A 2FH5A 1T95A 1SKOA 2E7XA 1CI8A 5DUKA 1S1YA 2EWVA 5ICCA 5TBMA 2GWRA 4F93B 5L3CA 3AGFA 3LIEA 5M18A 3PBTA 3OOVA 4K91A 3M9AA 3CUEA 3GWZA 1OM8A 1SVOA 3X2QH 2VODA 3GMEA 4MEXF 2EWNA 1EA3A 3EPZA 3ZMTA 1W63Q 1A5JA 1DY6A 1YOVB 3K7LA 2QSFX 3PM1A 4UY8I 1IXSB 4ETZA 2WKRA 3L9FA 3GTKJ 2KIMA 3BECA 966CA 1WNIA 5FB2A 1UTTA 3KCCA 1S4RA 3CPTB 2O9BA 3G5CA 3ESWB 5EJCA 1CEGA 2W27A 3A0VA 3CTAA 5FASA 3GX4X 1GXDA 3G4PA 1Y0VA 1FBLA 2CQXA 4H82A 4BEHA 1G3SA 2FMLA 4E6XA 1BI1A 1R4MB 4XXRA 4P6BA 4A5NA 4JIJA 3LQQA 1G68A 1HKSA 2Y0MA 4X6AJ 3LJZA 3QNCA 5LLQA 5GL9A 3GTCA 2IGMA 4UHTA 3GQZA 4DYQA 4GLQA 1KQ8A 1I39A 2PN6A 1G59A 4X6TA 2QM3A 2X71A 1ZC2A 1R00A 2Y2HA 1NZUA 3HKZN 2MFZA 4ARZA 2BV6A 4A3CJ 1FSYA 2PT7A 3CJMA 1S4SA 1WI9A 2HDDA 1DU6A 1IN6A 4D0PA 4XOTA 4R3JA 2VI6A 3F22A 2LMDA 1H88C 2IJLA 5HX9A 5BOHA 4E04A 4BHPA 3IF5A 1R5ID 4P0MA 1PWDA 3BG7A 2B95A 5I94A 2E60A 5TJJA 2CQ7A 4MTEA 3PO2J 4G6QA 2DK5A 1N9OA 2AIGP 3S7PA 5DTDA 3M2KA 3CF2A 3I3LA 1G28A 5DF7A 3HSRA 4JPAA 1OS2A 4YG2F 2ZNYA 2J3WA 3OYKA 1FOFA 2XSSA 3HPGA 3SOIA 1J3WA 3T0YA 2BVLA 3WTVC 3C2BA 3W8KA 3TDUC 3WTSC 3KX2A 4DIQA 4L19A 5KVRA 2X51A 1BW6A 4RM2A 4PM9A 3KP5A 4C6YA 4BD0A 3LA2A 4CUGA 1IADA 4LLNA 3UB5P 1V5EA 3MS6A 2K3FA 1U0JA 4XRFA 3DLAA 1TWAJ 3MMYB 1XS9A 2QBYB 1SMYF 3S32A 4RAFA 2O7OA 4PHTA 3ABTA 1RNLA 1MWRA 3CZ6A 4I2OA 1IUYA 3VWBA 3LI8A 2F4IA 2YUSA 1ENHA 4ON0A 1K61A 1VQ6I 5KK1A 2BXZA 1U5TC 5E79C 3LFKA 1FQGA 4DGWB 2DQLA 5LD2C 1EKEA 2XAHA 1JT6A 1XD7A 3UB7A 5BPDA 1P9QC 2FQ3A 2PDRA 5M5XJ 3DKYA 2PU4A 2OCEA 1CF7A 2G2WA 2DW0A 5DCMA 5B5EC 3REOA 1QIBA 3W4PA 4A3LJ 4HOBA 2HOEA 1RGYA 4OPRA 2KMUA 1T08B 3NIAA 1UG2A 2WYXA 5BOTA 3VP1A 2D1HA 2K27A 2QSHX 3DU5A 5F83A 3IH4A 3I55I 5FEGA 1BULA 3SH8A
chains in the Genus database with same CATH topology
4ZTFA 3LJTA 3G2BA 3ZGKA 4BJ5C 1Z21A 3OHOA 456CA 4J4MA 3PJRA 1PWWA 3C2GA 2KRJA 4BDYA 1BKCE 3LSIA 3DTEA 4JA1A 3OYIA 4HRIA 1SMPA 3H5NA 3L2UA 2PJRB 3HYGA 3OYGA 2R7VA 2F6CA 2A6TA 2W4SA 2E1MC 3VDXA 1PWPA 1XUDA 2X7MA 2CW7A 4HG2A 3SDBA 1R1HA 3HY9A 3M8JA 2K9CA 3QYFA 3AIGA 4FU4A 2DW2A 3K10A 1CXVA 1GKDA 3FBIB 1MMNA 3W2VA 1K7IA 3TVCA 1D0XA 2AYKA 4QKZA 2HVQA 3V42A 1K7QA 1BR1A 2IS6A 3OOUA 1MNCA 2LH9A 4ZDPA 1Y8JA 3HDAP 3EUAA 2L0RA 2FUG2 4GQLA 3IAS2 1BKCA 2OXWA 3F9KA 2WO9A 4H76A 1WJCA 5KHDA 4PK4A 2VJIA 2L7KA 5TGTA 3OWTA 3BC8A 1MMRA 4BQQA 4ANJA 1D7XA 3B2ZA 4C9YA 4J00A 1USNA 1XFXA 4PKVA 2PJTA 3CP2A 3L2WA 2QPJA 2M4KA 2V4BA 1MMDA 1BKCI 2W15A 5CZMA 2Y6DA 1SATA 2WAQA 1QU3A 3K4NA 2VB6A 1IAGA 1ATLA 3DPUA 3KEYA 3M1CA 5KNLA 2CV0A 1UEAA 2ZFUA 4HNTA 4XORA 3RSNA 1S4BP 2V9KA 2VASA 1C7KA 1MMAA 3D5SC 1QJIA 3ZQQA 4AYKA 3LSHA 1X1AA 3DQVC 1JAPA 3LSMA 1FLSA 1HFSA 4IN9A 4PKWA 3VTGA 3SYTA 2JSDA 4DF9A 3OYCA 4XM3A 5D1TA 4BACA 4I03A 1T95A 2Q2EB 3LFUA 1ZELA 4MLOA 4I35A 4XLEA 2OUMA 2VPLA 1G8XA 2YIGA 2LY2A 2W14A 3H0DA 4YELA 1SLNA 4H2EA 3K4BA 3K4LA 3CMMA 1JANA 2CV1A 3EDZA 3VI1A 3H35A 3VYUB 4F93B 5D1UA 2WOAA 4PJNA 1D8MA 1SFKA 1V5FA 2OC6A 4B43A 3LUMA 2K9MA 4FVLA 1ROSA 4R79A 4F92B 3HKZA 1TZLA 4ZDOA 3CP8A 3KHIA 3I7IA 4BE1A 1JAQA 1O0QA 4ZYAA 3H9GA 3K6GA 5CKTA 3VSKA 1A85A 1ZXVA 3OYJA 1OM8A 2RNGA 1WJAA 5D7WA 3PNYA 1EUBA 4DV8A 3O64A 3OS1A 4PKSA 3RTTA 1YE9A 4II3A 2WADA 3G42A 4LIUA 3TT4A 1EA3A 1NG6A 2ZSHB 2VXZA 5I12A 2OV7A 3GBGA 5H8XA 1D1BA 2R7WA 1X4OA 3EPZA 3QOEA 4U7BA 3N2UA 3PL8A 1I76A 2V7FA 1PWVA 4G6TB 1G4KA 2L9SA 4Q1LA 2VQLA 4BE0A 1CIZA 4CCKA 1BIWA 4E4HA 1G49A 2Y6CA 3OYMA 2IS4A 1K6YA 4XKVA 1ZTQA 1DP3A 1RMZA 4L6TA 3ZXHA 4XCTA 2EROA 1PYVA 1D1AA 1Z7LA 3HPHA 2JVGA 3HBVP 3IP4B 1LFPA 4CCJA 3RCOA 1YX5A 4PFOA 1LVKA 4CCMA 3K7LA 4WKEA 3A1YA 3D5RC 2JVHA 3PNVA 3KECA 4B47A 3L2RA 2VQHA 4P5OA 2VJ5A 2VL8A 2F5VA 2W7NA 1BQOA 5FROA 1JKYA 1OS9A 2RJPA 2OI0A 1X1DA 2ZXHA 5HNHA 3AL0C 3F19A 5CXAA 4A3WA 1XFZA 2MLSA 3OYBA 1YP1A 3IUOA 5CPRB 2V6EA 2X85A 4C2TA 4A7BA 2IGOA 1RM8A 3L0VA 3K4KA 4JQGA 966CA 1WNIA 1X19A 2X1EA 4HSTA 3QYEA 3E0JB 3RPUD 1E0EA 1UTTA 1D5JA 1ZS0A 3OYFA 4RLQA 1D0ZA 1KUGA 2X3BA 2JSPA 4F3QA 1QICA 4XKCA 3LGPA 4FXQA 3G5CA 2XSJC 3S8PA 2E5NA 1MMPA 4BE2A 1ZXCA 4BS9A 2K2GA 2KZVA 4CSWA 4B3XA 4HSRA 4DBRA 2CV2A 4RM3A 4E7HA 2K5CA 2V4JC 4Y33A 2J0TA 3K70C 1D8FA 4HMAA 3LK8A 5D1SA 3EDIA 3E8RA 4PKUA 4WZVA 2E3XA 2KQRA 3OS2A 3OYHA 4E7LA 3LMMA 2Y0SA 3B92A 2LG4A 3CJQB 2GOXB 3OR2C 1WJ5A 3DEEA 1GLNA 2VQCA 3VYSB 2I8DA 5L79A 1H71P 1Y56A 3L2VA 1GE6A 4AU7A 2MZEA 1SRPA 3OIPA 1TT0A 1GXDA 3HOTA 1UELB 3LEAA 3OR1C 4YEJA 3DWBA 2M7AA 4XBHA 2LREA 4N4OB 4XMYA 1Y0VA 3RTSA 2OW9A 1WJFA 1FBLA 4XM8A 4EFSA 3U1RA 4H82A 2P0WA 1S9HA 3OYDA 4JP4A 3BCBA 3SEQA 4BEHA 3HB2P 1YQYA 3RTRA 4AIGA 2XF6A 4JIJA 1OM7A 2X1DA 2W12A 3AFHA 2WBMA 1I1IP 3CKIA 2VJJA 1HV5A 1LDKB 2OZRA 1X4PA 3NWTA 3NWSA 4XONA 1GO8P 3EHXA 4PSXA 2DOAA 3OYLA 1YOUA 2L5QA 4OAYA 2JIHA 2BVMA 4PJJA 1JK3A 2HPMA 2JT6A 4H84A 4KISA 4PKQA 3SHIA 3LJZA 4HX3A 3AKZA 1BR2A 4WKIA 2JA2A 3IAM2 4CCNA 3J7AY 4GF1A 2WO8A 2IGMA 1JAOA 3FDYA 2Z2DA 1KBCA 2E2DA 4DOZA 1BOBA 2WY7Q 4XKBA 3E1SA 3UVCA 4FETA 2IXSA 2R7OA 1DMTA 1QIAA 1R1IA 3OYAA 2HDWA 2KP6A 2V26A 2E1MB 1N75A 3PSFA 3WV2A 1MMBA 4PUSA 1BM6A 3W2AA 2AQEA 2VKHA 1G59A 2DT6A 3DTIA 3HC7A 3S93A 3F17A 5I43A 3A4CA 4XM6A 2LRDA 3CESA 3KEJA 2OXUA 3DU6A 3VYTB 3KEKA 3USNA 2W13A 2KL4A 2LOOA 1B3DA 5BOYA 4XLFA 4E7KA 4NC7A 3FHNA 3TMOA 1BZSA 1WJEA 1XFVA 2MZHA 2YB9A 5B5OA 1NG7A 2KRHA 3DPTA 4LIVA 2LBFB 5B5PA 2MFZA 1XURA 4GUYA 1UMTA 2VKDA 3BLYA 4XL9A 4CCOA 3MA2A 1OO9A 4AUOA 2JT5A 4GRIA 3H5RA 1IACA 2OY4A 1AA7A 4U87A 2R7QA 3D5LA 4F55A 3P24A 2O3EA 4JQFA 1DGWY 4BJTA 2WAFA 2QKMB 5LFAA 4IKFA 1DQUA 3VYRB 3TL4X 2ZXIA 2AQFA 830CA 4DJAA 1YCMA 4XM7A 3N05A 2OW2A 1JI8A 4XOTA 2KPMA 4GWNA 3DWLE 4LITA 4B44A 2A5WA 1OMJA 4P1WA 1PJRA 1D1CA 2O5RA 3TBIA 3U21A 5HNFA 2QKLB 3PSIA 1A86A 3K4CA 1IABA 2YUFA 3K7NA 4JOMA 3P1VA 1AKLA 4L7AA 2L2OA 3K4JA 4NQWB 1DGRM 1KUFA 4E7IA 1W36D 4XN0A 1LKXA 3ZR8X 4GR0A 1G12A 3O2XA 3DPLC 2DW1A 2WY8Q 2HVRA 3DPEA 1N78A 4DD8A 3SEZA 2OW1A 3BG7A 2K3PA 2RREA 3RQ4A 2X6YA 3QODA 2R7UA 5FRNA 2E60A 3BA0A 3TS4A 4H49A 2HPIA 4CTHA 2DT7B 2HU9A 1IAEA 1JJ9A 4IX7A 2UV1A 3EHYA 4IJOA 2IS2A 3F15A 4AXQA 5I3MA 1Z3JA 2A8HA 4PFPA 2KRCA 4IQ4A 1FM1A 2VIXA 4BUPA 1ZVXA 2CKIA 4AYBA 2AIGP 2VLAA 1UAAA 4ZTJA 2R7SA 4Y4RA 2DDYA 2HU6A 1WJDA 4F91B 3CF2A 1N77A 3I3LA 5L7FA 2R4GA 4HPQA 1Y6IA 2V1NA 3LQBA 3LKAA 4GR3A 2Z16A 3UNGC 3S3NA 1XFYA 3PFYA 4R3VA 4N4NB 4XLCA 5I2ZA 4HEA2 4H3XA 2D1OA 3EDHA 1R6RA 4HNUA 4EATA 5JHFA 4NNJA 2UWMA 1R1JA 3EWJA 4JPAA 3OY9A 1OM6A 2CH0A 3OYNA 3ZCOA 1HFCA 3LSKA 3LSGA 1OS2A 1D0YA 1YX3A 1DTHA 3AL0B 1BUDA 1WFXA 2VQGA 4CZCA 2BW3A 3PUBA 4D1QA 4PJMA 5HOOA 3OYKA 1UMSA 1Q3AA 1ND1A 3LIRA 2HNHA 5I0LA 4BEHB 4ITVA 2SRTA 3HPGA 1UG0A 3DKXA 3TSKA 1L6JA 2MZIA 2CUJA 1MMQA 5FRMA 2HZDA 1I73A 4XKWA 2WAEA 3L2QA 2BVLA 1J7NA 2MD0A 4WK7A 1OLTA 1QHHD 4II2A 2DXIA 1KONA 2M4GA 1FMWA 4RLFA 4PKTA 2DDFA 3A2KA 1Z3XA 4C2UA 1EAKA 4DPEA 2Z1DA 1XFUA 4QPQA 2WB1A 4ON1A 2CMPA 3F18A 1MMGA 2JNPA 3KX2A 4DIQA 1R54A 1XFWA 5D3CA 2CS3A 4AVZA 2R7RA 4L63A 1HOVA 4L19A 3DL1A 2X51A 2OY2A 3LMCA 2XC7A 3MKWB 5I4OA 3V96B 3BCAA 1QHGA 2PMZA 4RM2A 1CQRA 1CK7A 4D9JA 3HDBA 4XN3A 3CJRB 3HOSA 4XQFA 2VXDA 3EUKL 2OVXA 3OS0A 2IGKA 1HA8A 2X1CA 1J09A 3PNTA 2MC4A 2OW0A 1Z3YA 3H9JA 2N8RA 5CQGA 2PJRA 4E6KG 4CA0A 2X3CA 2POJA 4CUGA 2E5ZA 2HVSA 1IADA 4FXYP 3OMYA 4OWRB 3LL7A 3S3OA 4H30A 3ONQA 2J83A 1ERDA 4G9LA 3Q2HA 1V5EA 2M7BA 4F52A 1WJBA 3DPFA 4BQNA 2XS4A 1HTDA 1R55A 4H1QA 3OYEA 5HVQC 4BJ6C 4PJLA 4ZC3A 3HY7A 1PWUA 1U0JA 3I7GA 2DCEA 2XAUA 1BQQM 2XF5A 3SZGA 4PKRA 2CW8A 4BQOA 3HUGB 1EB6A 3DLAA 3AYUA 2VJ4A 2R7XA 1QJJA 4XR6A 3HG9A 1SAUA 3MMYB 4PSWA 3S32A 3AYKA 4LG3A 3LQ0A 3LILA 4CH7A 2X6XA 3HL2A 1CGLA 1JIZA 1SU3A 3LE9A 3Q2GA 3ZUKA 2R7TA 1VZ0A 3CZ6A 4BGDA 3LUNA 2JUGA 2Z2SB 1C3IA 3VWBA 1HY7A 2IS1A 1X1CA 2USNA 2F4IA 3N2VA 4ILWD 2WA0A 1BSWA 2D1NA 2GOMA 1GKCA 1UTZA 4FASD 4E7JA 4J01A 2M0MA 1JH1A 2KDOA 1KAPP 2RJQA 1FMVA 4XLAA 1X1BA 2OVZA 3H5AA 4B48A 2TCLA 2LC2A 2W00A 2HQAA 1T0FC 2W82A 4DGWB 2MABA 4X0GA 3F16A 3ZVSA 3C2HA 3QYBA 1C8TA 1Y93A 2ERQA 5BPAA 1AF0A 3OL4A 4OAZA 3UR3C 2M3AA 1KUHA 1KUKA 1SLMA 1GE7A 4NC8A 3KRYA 3B8ZA 1OR7C 3ZRGA 2LBFA 4IQJA 1AYKA 3F1AA 5LD2C 1CGEA 3OHLA 3KMCA 4BDZA 1G05A 1BUVM 2X6WA 4XOPA 1ZP5A 1P9QC 4IZZA 1V5GA 3W2WA 2XDVA 3LJGA 3OIQA 4XNFA 2KLOA 4BU2A 3DKYA 3FBNB 1CAQA 2KHMA 2W1OA 3HXLA 3EDGA 1W36C 1GE5A 1O0TA 2DW0A 2MLRA 4Y3OA 4CCLA 1CGFA 2XF7A 1IAAA 5HLTA 4YRVA 2LY1A 3BG6A 3VSLA 1K7GA 4C30A 1QIBA 1QUAA 5KCMA 1ASTA 4KJZA 3GBOA 2XS3A 3OL3A 3EUHC 1IRXA 4E7ZA 2CLTA 4G0DA 3WV1A 3WV3A 3KWVC 2CFOA 2NOJB 2BOLA 3I9V2 4E7SA 2RQQA 2ZSIB 3DNGA 3L0TA 1MNDA 2FV9A 3S3MA 3NX7A 5LABA 2KMUA 2BW3B 2X3AA 1PWQA 1MW7A 4H4KC 3ZXSA 2IGNA 5CQEA 3KYLA 3K70D 4BXFA 4GR8A 2I47A 3H9QA 2O36A 3DTKA 4NUBA 4KT6A 1MNEA 2W0DA 2Q1ZB 5BOTA 4GWMA 2LYCA 3MKZA 3KMEA 3HBUP 3FKJA 3DU5A 2FV5A 2K9LA 2ERPA 4IUWA 1B8YA 1JIWP 3MD2A 2MYSA 4RMNA 3MKYB 3ELMA 4ZJZA 4QPOA 4ZDLA 4WF6A 5D2BA 3LIKA 2ELJA 4BL0B 3DSLA 3K4MA 2CUZA 1KUIA 1XUCA 4DBQA 5CUHA 1GO7P 4XLHA 4KITB 1G9KA 2OXZA 3W3CA 2UUZA 1BR4A 5JMYA 2DJIA 4ZR5A 2L9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTE A;  3DTI A; 
#chains in the Genus database with same CATH topology
 3LJT A;  3A03 A;  2Q8K A;  1BKC E;  3G1L A;  5E1Z B;  3OYG A;  2R7V A;  3A3D A;  5GTH C;  3Q5F A;  1K7Q A;  2JHE A;  3I5U A;  3OOU A;  1JJ6 C;  5FQQ A;  3LR0 A;  3EUA A;  1DP9 A;  2WO9 A;  4H76 A;  3ZMD A;  3HGY A;  3OWT A;  4J00 A;  1XJ4 A;  4MBK A;  1K4T A;  1NZO A;  3B33 A;  2ZBB A;  4LGW A;  4RB1 A;  5GAH J;  1C7K A;  1MMA A;  1R9T J;  2E19 A;  1FLS A;  2GA1 A;  1EWZ A;  2VPR A;  3WG7 H;  1YLF A;  4IXA A;  4M3B A;  2ZM8 A;  1RKT A;  1O57 A;  2M9H A;  1XP4 A;  5CKT A;  1A85 A;  1FLI A;  3TP3 A;  1R4N B;  3PL8 A;  2RVC A;  2JZY A;  2NS8 A;  4CCK A;  4E4H A;  1K6Y A;  1DP3 A;  4L6T A;  3HPH A;  4R1G A;  2QUF A;  3L2R A;  1JKY A;  3LMC A;  2Z6C A;  3OIO A;  1XFZ A;  4Y2F A;  2EA4 A;  5DJT A;  3WE3 A;  1XN7 A;  3QRF F;  4KIC A;  3QYE A;  2Y48 A;  1P7I A;  5CJ9 A;  4KYW A;  3T4J A;  2XSJ C;  2E5N A;  4MLL A;  2JTV A;  3CQZ J;  1L2S A;  2E3X A;  3MSH A;  5HWT A;  1F9N A;  5D5X B;  4KG2 A;  3ZDJ A;  3DEE A;  3K1P A;  3ZQG A;  2ZOI A;  4R4S A;  1IEM A;  1WRJ A;  2IP2 A;  4PJ0 C;  3HOT A;  4N4O B;  2GIV A;  2KIF A;  4JP4 A;  2DDA A;  5K5R A;  1DDN A;  5EG0 B;  2DJN A;  1OT6 A;  2L5Q A;  4LRY C;  3GZN B;  2D01 A;  4PKY A;  1GHM A;  4IPA A;  5EM0 A;  2HDW A;  3PSF A;  1SKO B;  2AQE A;  1IV6 A;  2JA7 J;  2PR5 A;  3G1M A;  5TBM B;  3H3U A;  3FXJ A;  4U0T A;  2RDP A;  2X48 A;  1NG7 A;  3KZI C;  2LBF B;  4CCO A;  5CEC A;  3R0J A;  5E1X A;  4GO1 A;  3LNQ A;  1REP C;  2XFS A;  4JQF A;  1KDS A;  4MMN A;  3E6C C;  1YCM A;  4O3M A;  1SD7 A;  1XTA A;  4YIN A;  4O5V A;  4BXX J;  3U21 A;  5L2F A;  2H6B A;  2P9V A;  4XN0 A;  1PWC A;  2VKV A;  3DPE A;  1ZN2 A;  1N78 A;  3RIR A;  4HIA A;  3TS4 A;  3FXU A;  3BM6 A;  1E3H A;  3FXR A;  4L0L A;  2I5U A;  2DDY A;  5CVU A;  5HAP A;  3M1E A;  3UNG C;  3ZQ5 A;  4YFK F;  3WTW C;  4I02 A;  4FH2 A;  2MG4 A;  5K5Q A;  3V67 A;  4HNU A;  4EAT A;  3DBL B;  1ZRC A;  2FNA A;  2ZNZ A;  3HTS B;  2HYJ A;  4BEH B;  4P9F A;  4M73 A;  3BTL A;  4GNU A;  5A8B A;  2I72 A;  3ZN0 A;  4II2 A;  4RS8 A;  5LGT A;  1KON A;  4PKT A;  2DDF A;  1Z3X A;  1XC5 A;  3DLL F;  4WX9 A;  5E2H A;  1CF0 A;  1XFU A;  2M8E A;  2R78 A;  5HSQ A;  4A0Z A;  5F1R A;  2PMZ A;  2XKO A;  1Z09 A;  4JF4 A;  1DJA A;  1JE8 A;  2H27 A;  4E6K G;  2FOK A;  2KZG A;  5IP7 J;  1WGX A;  1ACI A;  2KJB A;  2XIG A;  4HA8 A;  1SDN A;  1QO0 D;  2XS4 A;  2A68 F;  4ARZ B;  5CLS A;  2CSO A;  3SZG A;  4PKR A;  3F6O A;  4L9V A;  2ZC6 B;  4S0H B;  4PSW A;  1CGL A;  3LE9 A;  4S2J A;  4DJ2 A;  1MSE C;  1JHH A;  5ILV A;  2GOM A;  2W25 A;  4FAS D;  4J01 A;  5LRR A;  3F21 A;  4HV6 A;  4EW7 A;  4OAZ A;  4YII A;  1HC8 A;  5M19 A;  2QHK A;  4IZZ A;  1AWI A;  5EEG A;  1H8M A;  2XKP A;  1AST A;  2OQG A;  4E7S A;  4KMF A;  1JTD A;  3N4I A;  4ASN A;  4NHJ A;  2I47 A;  4NUB A;  1YW7 A;  2H1K A;  5A90 A;  3BQZ A;  4JX6 A;  2JWT A;  2K9S A;  5K7Z A;  3DSL A;  4DBQ A;  4G94 A;  3MZD A;  4FE7 A;  5DTT A;  3FKV A;  1MJ9 A;  1ERO A;  4JA1 A;  2CYY A;  3WG9 A;  2FBH A;  4KN4 X;  3Q82 A;  2W4S A;  1PWP A;  1XUD A;  3CWF A;  3F0C A;  5JVG F;  3FBI B;  1JWZ A;  2VGJ A;  3B6C A;  1Y8J A;  1BIB A;  3LCE A;  3W4O A;  4A5R A;  2MH9 A;  4BAY A;  4D5F A;  2QPJ A;  3ROU A;  2MLK A;  2C6Y A;  2Y6D A;  2WAQ A;  1PYY A;  3K4N A;  5B3S H;  1SD5 A;  4HNV A;  3CC7 I;  2H8R A;  3TW7 A;  5D1T A;  5JFR A;  4G9Y A;  4MHG A;  2VJW A;  3MQO A;  2STW A;  1S8N A;  4WZ4 A;  1IRG A;  2YIG A;  2W14 A;  3G30 A;  3IS2 A;  2OC6 A;  5FQ9 A;  1A36 A;  3KHI A;  4BE1 A;  3H9G A;  3KSH A;  3OS1 A;  1CF7 B;  2DU9 A;  3RTT A;  2JC7 A;  2RL3 A;  1EW0 A;  2PBY A;  2OV7 A;  1NTC A;  1FY7 A;  2CRG A;  5DCM B;  4MN7 A;  1PWV A;  1G49 A;  1WCM J;  2EPF A;  4F94 A;  3IP4 B;  4CCJ A;  5F6A A;  1TWF J;  2UV0 E;  4I0B A;  2ACJ A;  2VL8 A;  1KU9 A;  1X1D A;  2O9A A;  3CIT A;  2UXN A;  4L18 B;  2MLS A;  1T38 A;  2EZK A;  2HDC A;  2GXA A;  4Y0T A;  5LHG A;  1VQM I;  4OIR F;  3WOD F;  3MR0 A;  2K2G A;  5J4Y A;  3H82 A;  2K5C A;  2MJ6 A;  3WE2 A;  1ZG4 A;  4O01 A;  3DF8 A;  3D4F A;  4MBH A;  4G7O F;  1P9W A;  2VKS A;  4KZ9 A;  3CCE I;  2VBX A;  3LA7 A;  2P0W A;  5CER A;  5KZH A;  3HB2 P;  2R3S A;  4AIJ A;  5CVI A;  4OVD A;  4EM2 A;  3NUL A;  1LDK B;  1X4P A;  3EHX A;  2DMW A;  2M7V A;  1YOU A;  3CUE C;  2M2E A;  4KIS A;  4C3Q A;  3AKZ A;  1ZLK A;  4F3L A;  1WPK A;  2HP9 A;  4XKB A;  1A35 A;  1DMT A;  4YFN F;  1IZ1 A;  2MC3 A;  3EYI A;  1RRJ A;  4U0X A;  2BY0 A;  3ERE D;  5B5O A;  2F4M B;  5FI7 A;  2ZO4 A;  4U0W A;  2WK0 A;  3HUG A;  1MMS A;  3P24 A;  1KOU A;  3M8F A;  3VYR B;  3PBN A;  1S29 A;  4G8X A;  2M1B A;  3DWL E;  1W7F A;  1SHV A;  4HHD A;  2YUF A;  3Q0W A;  1KUF A;  3BJ6 A;  4EEU A;  3GTL J;  2WY8 Q;  2HVR A;  5GLB A;  1B8I A;  2OW1 A;  2ME0 A;  3CCV I;  3GYH X;  4LPZ A;  4AIH A;  2A8H A;  3NCK A;  2PD8 A;  2HOA A;  1UST A;  2VLA A;  1Y54 A;  4KZ5 A;  3GTO J;  1EV7 A;  5J1Y A;  4HLX A;  2R4G A;  3CI6 A;  3BFG A;  3M6H A;  4B9O A;  5DM6 F;  5ILS A;  2XGE A;  4NNJ A;  2NRA C;  1T0F A;  2CH0 A;  2BW3 A;  2VBY A;  3ZQF A;  3JSP A;  5MC7 A;  2WB1 N;  1OKR A;  2QJ5 A;  1OLT A;  4DJ3 A;  3P9C A;  1EAK A;  4BY7 J;  1O4X A;  2WB1 A;  1MMG A;  1HOV A;  5K7F A;  3V96 B;  1ZTR A;  5HD5 A;  1T19 A;  2N8R A;  3I4P A;  3PIP F;  2V1D A;  4EGZ A;  3IL2 A;  2KRF A;  4S2P A;  2VC0 A;  1BTL A;  1R55 A;  3UN7 A;  3OYE A;  3GEC A;  5HVQ C;  3A0R A;  1Q1V A;  2HDQ A;  3AYU A;  4BHC A;  5FI6 A;  4M9X A;  4BY1 J;  1TBX A;  2AO9 A;  2P9V B;  1MZB A;  1UWN X;  1FMV A;  2ZJ2 A;  2Q9M A;  1KUK A;  1GE7 A;  4X69 A;  1QVT A;  1KZH A;  3FM5 A;  1WH5 A;  3E4Q A;  2FSW A;  4G3W A;  3ZMS A;  1IAA A;  2LY1 A;  4A3J J;  5HW3 A;  1LL8 A;  2XAG A;  2N8G A;  3I58 A;  2NUT C;  3ICY A;  3E5U A;  3KYZ A;  1MBE A;  5FLM J;  1E4D A;  3S16 J;  3HBU P;  4ZYD A;  4X53 A;  2JPC A;  3HBL A;  4QPO A;  4BL0 B;  3K4M A;  3NRV A;  2V0W A;  1KUI A;  1G9K A;  2DJI A;  2HR3 A;  4RAG A;  3GTQ J;  4JF6 A;  1P2F A;  1JHF A;  2L4A A;  3VFF A;  3BJO A;  4N9K A;  1SMP A;  1VF9 A;  2ZQC A;  1BN5 A;  3NHQ A;  3VMA A;  2CW7 A;  3WS0 A;  3HY9 A;  2ID3 A;  3K10 A;  5LBR A;  3L1P A;  2Z2L B;  4Q4Z F;  2K4B A;  1MMR A;  4BQQ A;  3BP8 A;  3RKX A;  3JW4 A;  1RET A;  3G2Z A;  1SAT A;  1QU3 A;  5F0C A;  4WXD A;  1UEA A;  4QIW N;  4MEY F;  4IO9 F;  2VAS A;  4AM3 A;  3LSH A;  1X1A A;  1U9N A;  4WUJ A;  2JSD A;  3OYC A;  3HTU A;  4I35 A;  2LY2 A;  4II7 A;  5TFQ A;  3T1S A;  4I3J A;  1U3E M;  1EUB A;  2X02 A;  3G42 A;  1LVA A;  1NRJ A;  4Y7P A;  2Y6C A;  4XKV A;  3RYR A;  4BQA A;  4IHW A;  5J7E A;  1LVK A;  3V50 A;  4NQW A;  2W7N A;  3CJN A;  3HLE A;  4LV3 A;  1NRF A;  1Q2P A;  3OYB A;  2DQR A;  1RM8 A;  4YNR A;  1K4F A;  4HOI A;  1QZZ A;  3HBR A;  2PR6 A;  5HPI A;  2EFP A;  3EGD C;  4FE4 A;  4KQR A;  4WZV A;  3LMM A;  1GE6 A;  4Q47 A;  2MZE A;  2KFD A;  3DCF A;  2MA3 A;  1BW5 A;  1ZRF A;  4XRM A;  2M7A A;  2B9S A;  3RTS A;  4XID A;  4KUK A;  1FR6 A;  3K3D A;  3C7V A;  2L1M A;  3O2P E;  3BWG A;  3OLO A;  1W8Q A;  4FT8 A;  3IAM 2;  3G31 A;  2B63 J;  1VQN I;  1FR1 A;  3S93 A;  5K5O A;  3C8C A;  2ZOH A;  3KEJ A;  3IS2 B;  3USN A;  2W13 A;  3CUQ B;  2Y4A A;  1XFV A;  2MZH A;  3OZH A;  1H89 C;  1UFM A;  4BD1 A;  1V55 H;  2CO5 A;  1OCP A;  2A6E F;  5FQJ A;  4U87 A;  1XGO A;  1WWX A;  1XDS A;  2H5S A;  1D8J A;  3PTE A;  3VE3 A;  3G6O A;  2VV6 A;  3IH9 A;  4ZJ1 A;  1F5M A;  2W1T B;  2GJ3 A;  1AKL A;  1LDJ A;  5M5Y J;  2VBW A;  1W79 A;  3GF2 A;  3EHY A;  1Z3J A;  4ZJ2 A;  5HWV A;  5JLW A;  1Z0X A;  3IKT A;  3H82 B;  3GTP J;  3BRO A;  1W5T A;  2QEX I;  4Q0I A;  3PFY A;  1TDL A;  4KQO A;  5AVF A;  4HEA 2;  3E3V A;  2NVX J;  1GA9 A;  2ZLY A;  1HFC A;  4BBR J;  4RA2 A;  1XFN A;  1DPR A;  2HNH A;  2LDU A;  4GD8 A;  1QPI A;  1M1E B;  3D72 A;  1HW2 A;  5GAE J;  2ZL1 A;  1J7N A;  1MXO A;  2MD0 A;  4WK7 A;  3J7Z I;  2M30 A;  4QPQ A;  1FBS A;  2JNP A;  4L63 A;  3T4K A;  3B47 A;  3FPW A;  3DL1 A;  4F3L B;  5FD6 A;  2XHK A;  2OY2 A;  4A3F J;  2FOW A;  1LE8 A;  5LGU A;  3W6K B;  5FEF A;  4D9J A;  4S04 A;  4XQF A;  3DV8 A;  5GLC A;  1KE0 A;  2BHY A;  4CA0 A;  1NY0 A;  3BYD A;  2WKE A;  1RC9 A;  2ISZ A;  4OWR B;  4DF6 A;  3ONQ A;  1FP2 A;  1ERD A;  2ZQ7 A;  5EVL A;  4G9L A;  4G7H F;  4UA9 A;  5JHU A;  5K7H A;  3Q07 A;  3GFM A;  2QZ8 A;  3HUG B;  3V3R A;  1O3S A;  1NYY A;  1SEU A;  3AYK A;  3MEX A;  3LQ0 A;  3KP6 A;  3WS2 A;  2R7T A;  3KO6 A;  4YOF A;  2EIJ H;  1TC3 C;  2HJ9 C;  1VND A;  1W7P A;  4NG2 A;  1B1B A;  2Q2E A;  4PZJ A;  1X1B A;  2OVZ A;  1B8I B;  5D5W B;  3ZVS A;  2ERQ A;  1AF0 A;  1KUH A;  2M3A A;  2J80 A;  1MH3 A;  1AYK A;  3OHL A;  3LJG A;  3D9Y A;  3V8L A;  3UE3 A;  1PZP A;  1GE5 A;  2VUM J;  2XF7 A;  4EUV A;  1OIS A;  4O6J A;  2BW3 B;  3CME I;  1MW7 A;  1P0Z A;  4DDS A;  4WWC A;  1P4X A;  3BY6 A;  2R93 J;  5L3D A;  2OBP A;  1SFX A;  2LYC A;  1TS0 A;  3P9I A;  5HLH A;  4RMN A;  2PBI A;  4D5C A;  1BR4 A;  3IHA A;  5JMY A;  1BKC I;  2L9N A;  3ZGK A;  1A04 A;  4J4M A;  4BDY A;  3KX0 X;  3V39 A;  4HRI A;  3A3I A;  1R5G A;  1R5H A;  3O3V A;  3C2W A;  3UE6 A;  4FU4 A;  3TVC A;  1U6G A;  2HVQ A;  3MZ8 A;  2XFT A;  4EQI A;  3HDA P;  3ABL H;  4IHS A;  1OCO H;  2XVC A;  1U8B A;  2WUQ A;  2RCX A;  5TGT A;  3F6V A;  2XGD A;  3B2Z A;  3TED A;  3MQ0 A;  4E3N A;  2ZKZ A;  3L2W A;  3W6J B;  2O99 A;  5F0F A;  1WH7 A;  3PHY A;  2DOD A;  2GIZ A;  1MSF C;  1VQQ A;  2ZQ8 A;  5F5Y A;  3MKE A;  1RES A;  2ZMF A;  4X56 A;  2ESN A;  3S22 A;  1D3Y A;  2O8X A;  4XLE A;  2OUM A;  4YEL A;  4BBS J;  5HL1 A;  3CMM A;  2XB0 X;  2MGQ A;  3S1R J;  3VOL A;  4ZDO A;  1O0Q A;  2IPQ X;  1HVB A;  5IT3 A;  1SVM A;  3SDG A;  3QOE A;  4V2G A;  3UME A;  1W5S A;  5EM1 A;  3O8G A;  1YJN I;  4HAM A;  1IF1 A;  1RMZ A;  4BBT A;  1XJ3 A;  1OT9 A;  3DFG A;  1UZC A;  3I53 A;  5E3M A;  3I56 I;  3CCS I;  3E97 A;  1ZR4 A;  2R92 J;  3F8M A;  2XLN A;  2Q9N A;  4PCQ A;  2HP5 A;  3M8E A;  4XUX A;  5H6Q A;  1D5J A;  1IV8 A;  5FKM A;  2JSP A;  4XSX F;  3R60 A;  1IYQ A;  3LGP A;  4A3B J;  4KMU X;  3N8S A;  1D8F A;  1FCM A;  1MBL A;  2Y0S A;  3B92 A;  1XSD A;  1GLN A;  1IN8 A;  1VQ4 I;  4QLC U;  3HB9 A;  1FSH A;  2R7D A;  2HXI A;  5AQB A;  1S6L A;  3BCB A;  2V1X A;  3BFF A;  3Q9S A;  1YW8 A;  2X1D A;  3AFH A;  2VJJ A;  1FOW A;  5U47 A;  4OAY A;  1LFB A;  4HX3 A;  2QGU A;  4GCV A;  2W3D A;  4EEP A;  3MVP A;  4MEZ A;  2WO8 A;  1BOB A;  4YFM A;  5D8L B;  2O3F A;  5BQT A;  2VKH A;  1FCO A;  5KAI C;  1O07 A;  5BOY A;  4LB6 B;  1GV2 A;  5B5P A;  5J40 A;  2HS5 A;  3C7J A;  3FIS A;  3D5L A;  3HRT A;  4BBU A;  1TQM A;  5CHU A;  2WAF A;  2QCO A;  4DJA A;  3T5X A;  5IP9 J;  2A5W A;  1PUF A;  3P1V A;  4NQW B;  1O3T A;  2EA9 A;  1K55 A;  3KYQ A;  1FSW A;  3VP0 A;  3RQ4 A;  2R9W A;  2NOG A;  3MXS A;  3F15 A;  4MGR A;  2D1V A;  2YS9 A;  3I71 A;  1XB4 A;  1F1Z A;  3P7N A;  4JBA A;  1Y8Q B;  2V1N A;  4JXS A;  4BMW A;  2Z16 A;  2XQZ A;  1XFY A;  4R3V A;  2KKO A;  3L09 A;  4N1H A;  3BQA A;  4RB2 C;  1BLH A;  2PD7 A;  3LSG A;  3DEW A;  3AL0 B;  3ZPL A;  5J3W A;  3ABM H;  5FRM A;  3F3X A;  2WAE A;  3L2Q A;  3WRT A;  1OCZ H;  1QHH D;  2NS7 A;  3IXD A;  2OAZ A;  5F64 A;  1AWC A;  3EUH A;  3MKW B;  3HDB A;  2IA1 A;  2F5D A;  2IAI A;  4EET B;  2X1C A;  1J09 A;  1R36 A;  2X3C A;  2POJ A;  4Q8I A;  4H30 A;  2XV4 S;  2ZQ9 A;  4HI4 A;  1R1V A;  4S2K A;  3ML6 A;  2A5Y B;  3FWL A;  3HHH A;  3O5Y A;  2HOT A;  2BXY A;  5E2G A;  2OAP 1;  4LG3 A;  4YWZ A;  3LID A;  3FKI J;  4B88 A;  1C3I A;  5FLX K;  4EQ1 A;  1OJ5 A;  2M0M A;  1JH1 A;  1MBG A;  6PAX A;  4DYR A;  1T0F C;  3PR6 A;  3WS5 A;  1SLM A;  3ZRG A;  4BEN A;  2ZJP F;  1GHP A;  2XDV A;  4AYB N;  4Y13 A;  5FO5 A;  1T56 A;  2P6T A;  2FFY A;  5E8G A;  1ZTU A;  1QZY A;  4XBF A;  5HLT A;  4CPK A;  2CG4 A;  1K7G A;  5D7W A;  3WV1 A;  2CFO A;  2ZSI B;  2FV9 A;  3RXX A;  4EM0 B;  1F98 A;  5FDH A;  1MJB A;  4H4K C;  3IWI A;  2QYO A;  4O8G A;  2O36 A;  4KT6 A;  4HQE A;  4R4R A;  3D0S A;  2ZL1 B;  4UV8 A;  2FV5 A;  3S2D J;  5DUI A;  2ERP A;  1B8Y A;  4DDY A;  1RZ4 A;  1PNE A;  1K79 A;  1HST A;  2Y2P A;  1LE8 B;  1JXS A;  3P01 A;  3PJR A;  1CQA A;  5G4Y A;  2X7M A;  1CXV A;  1K7I A;  4M6Y A;  4QKZ A;  1Y8R B;  2EIL H;  1MNC A;  1XM5 A;  4YIR X;  4LG0 A;  4KZB A;  4PK4 A;  4ANJ A;  2H10 A;  2W15 A;  5CZM A;  3CAX A;  2FA5 A;  1P97 A;  4IVK A;  2CV0 A;  4ZBE A;  3K0L A;  5GLA A;  2V9K A;  1LLB A;  3ISP A;  3ZQQ A;  1W7P B;  1QME A;  3LSM A;  3VTG A;  5JI6 A;  3MJQ A;  4HX7 A;  4IF4 A;  2Q2E B;  3TO9 A;  2XPW A;  3FXO A;  2XD5 A;  1F43 A;  1QVU A;  3VYU B;  1D8M A;  1SFK A;  2O61 A;  4F92 B;  5IT5 A;  5DF8 A;  2GAU A;  2RNG A;  3O64 A;  3U1K A;  1XSV A;  1XMX A;  4EBP A;  5K5B A;  3TT4 A;  3FM3 A;  2R7W A;  4FCY A;  3BWL A;  1LL5 A;  5FAT A;  1K6O A;  5F1G A;  2ZXW H;  5J47 A;  4WL9 A;  1Z7L A;  5FGM A;  4RVA A;  1S72 I;  2EB7 A;  4P5O A;  2HI3 A;  4JX5 A;  4C2T A;  4JQG A;  2E71 A;  4WYY A;  5EVE A;  1KUG A;  1TEM A;  1ZK8 A;  3N8R A;  3E0Y A;  3QHY A;  5EE8 A;  1MMP A;  1XPB A;  4BHB A;  1Y4O A;  2PRF A;  3OR2 C;  1X1P A;  5L79 A;  2L4R A;  3HOU J;  3FMR A;  2QVO A;  3IV5 A;  4O0P A;  4QY6 A;  1WJF A;  3OYD A;  1W7P D;  2Q0O A;  2XF6 A;  1IN7 A;  4I76 A;  1D7E A;  5HLI A;  3ZVT A;  3ZVW A;  1JAO A;  3PBR A;  3OYA A;  1DU0 A;  1MMB A;  3GEZ A;  5HDC A;  4XM6 A;  2TCT A;  4KFC A;  1BZA A;  1YLJ A;  2LOO A;  3I54 A;  4Q0J A;  4ESP A;  3IWZ A;  3O6B B;  4HF1 A;  4UV9 A;  3M6B A;  1G4D A;  3JRH A;  1FWZ A;  3JTH A;  3H9W A;  2FQ4 A;  1UMQ A;  3HLW A;  1W0T A;  1JI8 A;  4GWN A;  4Y0U A;  1Y28 A;  2QKL B;  3PSI A;  1GXP A;  3KE2 A;  2JN6 A;  4FCF A;  1W36 D;  3WTX C;  5LRS A;  4GR0 A;  2COB A;  2OZ6 A;  1FT9 A;  1T8I A;  1J9I A;  1GSW A;  5D6E A;  3OOP A;  5FA7 A;  1GDT A;  2IS2 A;  4PFP A;  1LEA A;  3Q7V A;  3F72 A;  3FG8 A;  1UAA A;  1WJD A;  1N77 A;  2EX2 A;  4HPQ A;  5IS1 A;  4FX0 A;  1DRM A;  4H3X A;  4JYK A;  3U2A A;  1ETY A;  3T1R A;  3OY9 A;  1OM6 A;  3NJA A;  1ZHF A;  4E3K A;  1HQC A;  1OYW A;  2PEX A;  3V8K A;  2SRT A;  2Y91 A;  1IG7 A;  2STT A;  1UGU A;  2EFQ A;  1RIO H;  3IHU A;  1Z7U A;  3ZMU A;  4U88 A;  3DBR B;  3ZHH A;  3L7H A;  2FD5 A;  4MCW A;  3IRQ A;  1IC8 A;  2LF7 A;  1HW5 A;  3V7C A;  1K83 J;  3CJR B;  1MDM A;  4EES A;  2MC4 A;  3H9J A;  4EV0 A;  4X1M A;  2HVS A;  5HS8 A;  1BI0 A;  2MD5 A;  1G3Y A;  3OV8 A;  4H1Q A;  4ZC3 A;  3CHW P;  1IYO A;  3O87 A;  3I7G A;  1QPM A;  4U0Y A;  1QJJ A;  4CYD A;  2NXN B;  2WTE A;  4FTX A;  3LIL A;  2BYV E;  1JIZ A;  2NVQ J;  3RI4 A;  5J4E A;  3RKQ A;  3TQN A;  4AFI A;  4ILW D;  3M3Y J;  3KFW X;  4XLA A;  4B4C A;  2L7M P;  1H8Y A;  1BC8 C;  3KMC A;  1ZP5 A;  5D5U B;  1QA6 A;  3G1O A;  4Y3O A;  2OD5 A;  4QJG A;  3DWZ A;  5LAB A;  3U2R A;  5E18 F;  1FX7 A;  3J80 K;  3DTK A;  2NVT J;  2XGN A;  5CHJ A;  5EEH A;  3MD2 A;  1PZO A;  1CEF A;  3S1N J;  3QP1 A;  3W3C A;  456C A;  2OCC H;  2YKH A;  1TWC J;  2YU3 A;  2JBF A;  3DTE A;  2ZME B;  3S4X A;  3F8N A;  1R1U A;  2HP6 A;  2K86 A;  4NKP A;  3EQU A;  4LV1 A;  1GKD A;  2DA4 A;  4IEJ A;  3V42 A;  2Y8H A;  2QQ9 A;  2LH9 A;  2ZXJ A;  2OXW A;  3ZG0 A;  4ZYE A;  4OP5 A;  3CCR I;  3BPV A;  5J8X A;  2DAO A;  2HGC A;  3O8H A;  3M4O J;  3H3Z A;  1H9G A;  2V2F F;  2GM4 A;  4PKV A;  3CP2 A;  4U0V A;  3A02 A;  5KNL A;  2P4W A;  3PXP A;  1JAP A;  3P5J A;  3GLX A;  2VE8 A;  2LD5 A;  2JKR M;  3E6B A;  2CV1 A;  3EDZ A;  1HLU P;  2XK1 A;  2DNS A;  2RGV A;  1V5F A;  2HF6 A;  5F04 A;  2XD1 A;  1SFO J;  1JAQ A;  2M34 A;  2IBD A;  2QBY A;  3NOP C;  2HDR A;  4R6L A;  1H9T A;  1GVD A;  5IT9 Z;  1X4O A;  4KQD A;  2A07 F;  4Q1L A;  4E3J A;  1T18 A;  5EVI A;  3CDH A;  2ZMA A;  4GHI A;  4XCT A;  1P4W A;  2JVG A;  1OJG A;  3HBV P;  2VQH A;  5AON A;  2VJ5 A;  5L07 A;  3LY3 A;  2L9R A;  2X3B A;  3J80 Z;  1HKQ A;  4OMZ A;  1XJ2 A;  4CSW A;  5LGN A;  4DBR A;  2CV2 A;  4RM3 A;  3H7W A;  1WJ5 A;  4EJO A;  1BIA A;  4D2O A;  4P6Z S;  3LEA A;  4ETS A;  2NVU B;  3S1Y A;  1WI3 A;  4LG0 B;  1I1S A;  4I38 A;  3BOQ A;  2MSY A;  3FPV A;  2VGL M;  4C3H J;  2IWC A;  2R0Q C;  2JIH A;  4AYK A;  4PJJ A;  2W48 A;  4EU0 A;  5FKL A;  2KOI A;  3BEB A;  2LTP A;  4UQI M;  1TW3 A;  1TWG J;  2WY7 Q;  2IXS A;  4CLC A;  4JPM A;  3G34 A;  1FZP B;  2E1M B;  1TT5 B;  1SD6 A;  3NEU A;  1YI2 I;  3TJZ C;  2K40 A;  2A69 F;  5J1U A;  3EGX C;  1B6A A;  5JLX A;  5FQI A;  1LQ1 A;  3DWK A;  1XUR A;  3FF5 A;  1RGZ A;  1BA5 A;  2JT5 A;  3HUN A;  4MO7 A;  1TWH J;  1SAX A;  2WZZ A;  4IKF A;  5E43 A;  4XIC A;  3TL4 X;  2ZXI A;  5EOE A;  3N05 A;  3K69 A;  1SDE A;  1KU2 A;  4B4Z A;  2O5R A;  1A86 A;  3FXQ A;  2JA6 J;  1YPR A;  1ZG3 A;  5ERI A;  1TVI A;  1TDG A;  1VQO I;  2ACG A;  1HZO A;  2LB9 A;  4UEY A;  1YS7 A;  2X0L A;  4UVA A;  1IAE A;  4AXQ A;  4KA4 A;  2PQ8 A;  3A3E A;  3G71 I;  3MZH A;  4R23 A;  5L7F A;  4R3B A;  3ZCZ A;  3S3N A;  4CZZ A;  2D1O A;  5JHF A;  3RZD J;  3JRA A;  3W4Q A;  2FBK A;  2M8G X;  3LIR A;  4ITV A;  1HDD C;  3K9T A;  2K7S A;  1ON1 A;  4FHT A;  1FMW A;  4RLF A;  4WXC A;  2Y2Q A;  3LR5 A;  1WHU A;  4JXV A;  1FSE A;  2EZH A;  1AXB A;  1HA8 A;  1X2M A;  3HRS A;  3S3O A;  3Q2H A;  4F52 A;  3IKV A;  5EG0 A;  1FJL A;  1YMS A;  2XAU A;  4DE1 A;  3MKF A;  4DE3 A;  1IKI A;  1BJA A;  3Q9V A;  4ESB A;  4H0E A;  3FXK A;  4P96 A;  2WA0 A;  5HLG A;  1D5V A;  3CLO A;  2Y69 H;  1GKC A;  4BJP A;  3HOY J;  3FK7 A;  1ZG5 A;  3W6V A;  3KRY A;  2LBF A;  4HZF A;  1K6R A;  4BDZ A;  5BPI A;  3Q7V B;  3LO7 A;  4XOP A;  3W2W A;  2ZJR F;  4OPZ A;  3FBN B;  1GSX A;  5DD8 A;  4NB5 A;  4B8X A;  3UMD A;  3HIF A;  4KNY A;  1CGF A;  4JXW A;  1JNU A;  3VSL A;  5KCM A;  2ECC A;  3EUH C;  1LSV A;  1MND A;  2VLG A;  1B9M A;  1MWU A;  2Y2K A;  4GD6 A;  2FRH A;  1YQA A;  3K70 D;  3HZJ A;  2AXT C;  4YFX F;  3KPH A;  3TOA A;  1ZQ3 P;  2MYS A;  3JTG A;  3ZYT A;  2ELJ A;  3S1Q J;  5HAQ A;  3G2B A;  3UO9 A;  4BBV A;  4V19 K;  1SKF A;  1MDM B;  2F2E A;  3OYI A;  3L2U A;  1ZR2 A;  2W0N A;  3K3C A;  3HYG A;  3G73 A;  1D8K A;  3GV9 A;  3OPH A;  4LRZ E;  2WGV A;  2J3T D;  1UJ8 A;  1MMN A;  4C2M J;  3U9G A;  2AYK A;  3SFI A;  2JT1 A;  3G2Y A;  4ZDP A;  2FUG 2;  5E17 F;  2DO7 A;  3F9K A;  3EQV A;  3BC8 A;  1D7X A;  2JRM A;  1XFX A;  3JYI A;  1S3J A;  2XRN A;  2XEP A;  1OCC H;  4LLG F;  3M1C A;  3QPS A;  3RSN A;  1KE4 A;  4IN9 A;  5IU1 A;  4G7Z F;  3EDP A;  2VPL A;  4HDU A;  3HJE A;  1K25 A;  4RX2 A;  1XCV A;  3HKZ A;  3LSP A;  2WKQ A;  3HLG A;  4IOC F;  3GZ5 A;  3RKY A;  2BLS A;  4GW9 A;  2RV8 A;  3IBR A;  2VXZ A;  3M07 A;  4PDK A;  1I76 A;  1LSW A;  4G6T B;  2L9S A;  2VQL A;  3ZP5 A;  2GA2 A;  3LST A;  4A3G J;  2ERO A;  2I9V A;  2V20 A;  3E5Q A;  4CCM A;  2FJ1 A;  2W3E A;  3KSI A;  5F08 A;  2ZXH A;  1YIO A;  1YJW I;  3COA C;  4OIO F;  1XSX A;  4LLL A;  4G3K A;  4UA6 A;  3JRD A;  1YTY A;  3OYH A;  3CJQ B;  4IHY A;  2VQC A;  3VYS B;  1YSQ A;  4GKU A;  2IWD A;  3JRI A;  5ILU A;  4ZJ3 A;  3R0A A;  5CGW A;  4XLP F;  4XMY A;  1TS6 A;  3TP0 A;  1APL C;  3OPR A;  2IW5 A;  3F8C A;  4KZ4 A;  1X3Z B;  3G3Z A;  3QP2 A;  5J4V A;  2EX8 A;  3GUD A;  3WGI A;  3T4Q A;  2JT6 A;  2FZ0 A;  1JVJ A;  1YAX A;  4GF1 A;  2BY3 A;  1O7E A;  1MGT A;  3KLN A;  2OLV A;  3PIO F;  2VX8 A;  3WV2 A;  2HPB A;  1PUE E;  2HZ5 A;  1JGS A;  4ZRR A;  2OXU A;  2DA3 A;  3DU6 A;  4KUM A;  2PJP A;  2EXB A;  2JMW A;  1PRQ A;  3IX4 A;  2H0Y A;  3L00 A;  4IUK A;  1WJE A;  1D1J A;  3ZNT A;  3JVV A;  3CCJ I;  4Q48 A;  1VQ9 I;  4NXB A;  4F55 A;  3BT9 A;  4N9H A;  2QKM B;  5LFA A;  1K6S A;  1PI4 A;  2AHQ A;  5EVI B;  2ZFW A;  1A0K A;  4GHI B;  4B44 A;  4M3G A;  3HHG A;  2LR8 A;  3TBI A;  1IAB A;  4HX8 A;  3VP3 A;  4ZZD A;  4HYE A;  4AD9 A;  2WGW A;  3DPL C;  3V7S A;  4DD8 A;  2J9O A;  5FI2 A;  2RRE A;  5FRN A;  3FMS A;  2H09 A;  5GAD J;  3ITB A;  5KSC A;  2IA2 A;  4IQ4 A;  1BYW A;  1E2X A;  1VTN C;  1TQP A;  3Q81 A;  2XGC A;  3LAP A;  3H7W B;  1MZU A;  3LQB A;  4MTD A;  5ICG A;  3IXG A;  4WF0 A;  3QWL A;  2EFO A;  1Y1W J;  4CZC A;  4UA7 A;  1ND1 A;  1UG0 A;  5L3G A;  4XKW A;  3HRU A;  3ZG8 B;  1VHM A;  1FIP A;  1XFW A;  4AVZ A;  4LCL A;  1QHG A;  1GT0 C;  1AHD P;  4CLC B;  1RR8 C;  5FAO A;  3EUK L;  2J3T C;  2JKR I;  2HQN A;  2OV5 A;  2IGK A;  5HS9 A;  5CRF A;  2ZM2 A;  2X01 A;  1ERQ A;  2JA8 J;  4FXY P;  2NNY A;  1F5T A;  5L09 A;  5EVI D;  3F23 A;  3WGG A;  1HTD A;  4PJL A;  1VB6 A;  5E3O A;  2CW8 A;  5AJG A;  1K7A A;  2GLO A;  4JGO A;  4M9S A;  3HRE A;  2ZD8 A;  3C5A A;  1HY7 A;  3V4G A;  1SD4 A;  1UTZ A;  4NC6 A;  4MFE A;  3CF5 F;  5EF6 A;  2GXB A;  2HV1 A;  4X0G A;  2ZC3 B;  3GLL A;  3QYB A;  2BY2 A;  1H8A C;  1I27 A;  4S2N C;  2EFW A;  1HTZ A;  1G05 A;  5AQA A;  1BUV M;  1U8R A;  3CCQ I;  2PAV P;  1MBH A;  3SFZ A;  1IN4 A;  2G7H A;  5D4R A;  1P6R A;  2PMU A;  5HDD A;  5F1F A;  3S2H J;  2FU4 A;  2XS3 A;  4E7Z A;  3S3M A;  4CIC A;  1Z05 A;  3KYL A;  4S2I A;  3K2Z A;  4BYY A;  1LJ9 A;  5EZG A;  2XUB A;  2COM A;  2AS5 F;  4CLC D;  3FKJ A;  3NEC A;  3HLC A;  1RR7 A;  1TQI A;  3O88 A;  3JVU A;  4KIG A;  1XFQ A;  5FKO A;  1XUC A;  3VP4 A;  5FQK A;  1C3B A;  1JUP A;  4L0Y B;  3OHO A;  2FBI A;  1N4O A;  3F8B A;  1BLS A;  2QKP A;  2V9P A;  2XA7 S;  4Y15 A;  3QYF A;  4EGY A;  4EVI A;  5EPH A;  5HOD A;  2HQ5 A;  4M3E A;  2L7K A;  4E3I A;  2V1U A;  1IYS A;  3HOX J;  4I39 A;  3PBO A;  4ENJ A;  1ATL A;  1XX2 A;  2YSR A;  3VOY A;  2GXG A;  4AWX B;  3VFH A;  1LUJ B;  1QRY A;  3H35 A;  2HYG D;  4B43 A;  2K9M A;  1K56 D;  2OAQ 1;  3WHC A;  4NEE D;  3PO3 J;  3IXH A;  4PKS A;  4OIP F;  2MH2 A;  3MZY A;  3GFJ A;  3AGD A;  3OBF A;  4BL3 A;  3IH8 A;  2V7F A;  1FBU A;  1CIZ A;  3UB9 A;  1ONH A;  1G2H A;  3IQA A;  2GNX A;  2F5V A;  4FSF A;  4DKI A;  2OI0 A;  1GSV A;  3EOI A;  3FX3 A;  4W97 A;  2E36 A;  3K4K A;  1IW7 F;  2XPV A;  5DV5 A;  3QP6 A;  1X19 A;  2ZC5 B;  3OYF A;  5A2Q Z;  3IWQ A;  1SZV A;  3NOU C;  3J81 K;  1ZGA A;  2J0T A;  3E8R A;  2O8K A;  4E7L A;  3HCY A;  2QWS A;  4UXN A;  4A3D J;  3OIP A;  2V9V A;  3OR1 C;  4OLD A;  2EZL A;  3NQO A;  1YRN B;  3IX3 A;  3RTY A;  2OW9 A;  2XF3 A;  4A3E J;  1HDP A;  1YQY A;  3RTR A;  4L9G A;  1BM9 A;  2VN2 A;  3NDE A;  5HDK A;  2W12 A;  2JPB A;  2LKS A;  3E4P A;  2DBB A;  4M4X A;  1JK3 A;  4IHQ A;  1MBF A;  2R7O A;  3SZP A;  3OSF A;  1BM6 A;  4LD5 A;  5EVI C;  2K85 A;  3F17 A;  3BZC A;  2QQB A;  3CES A;  4EER A;  1PIO A;  4XLF A;  1IDY A;  4LIV A;  1XAX A;  3BLY A;  4XL9 A;  2VEA A;  1OO9 A;  1V9Z A;  2R7Q A;  2O3E A;  3A0H C;  1OPX A;  1RI7 A;  1WVR A;  1S7E A;  1UWP X;  4LIT A;  2Y2M A;  2Y59 A;  1PJR A;  5HNF A;  2W3H A;  3TW8 A;  3K4J A;  1LKX A;  2P5V A;  1BBY A;  4DYC A;  3I4N J;  3QOD A;  1O7L A;  2L3D A;  1K4S A;  2D5V A;  5CGX A;  3GTJ J;  1XXM A;  1FM1 A;  3RYP A;  1OPC A;  2VBZ A;  2EIK H;  3MKL A;  2V1A A;  1R1J A;  1QGP A;  3OYN A;  4UNO A;  4NET A;  3J81 Z;  1D0Y A;  3KIO A;  5EUA A;  1DUX C;  4DXB A;  1E3P A;  5HOO A;  1SVL A;  1TNS A;  1TS7 A;  3PQJ A;  3DBA A;  3OC2 A;  2XRO A;  2ZBK A;  1YHQ I;  4WZ5 A;  2LNB A;  3C7U A;  1Z9C A;  2DW4 A;  3HL9 A;  1MD0 A;  1XMA A;  3UB6 A;  2DA7 A;  2P08 A;  4KG5 A;  4L5J A;  1ONV A;  3DBH B;  2DOE A;  2J8Y A;  1IRF A;  1Y1V J;  3DPF A;  3VEP A;  2ESH A;  5EFW A;  3IWO A;  3MCZ A;  3HY7 A;  2CFX A;  5FKN A;  4BQO A;  3HG9 A;  5TRD A;  2DN0 A;  4BGD A;  1RKW A;  5EYR A;  1VEU A;  1LFU P;  2D1N A;  3JRG A;  1SMT A;  1L0E A;  4Y7N J;  2WGW B;  3BR3 A;  2HQA A;  3CUQ A;  3H36 A;  3M7G A;  1Y93 A;  2A3U A;  3L9K A;  1JUM A;  3UR3 C;  4XUZ A;  1CGE A;  2BGC A;  2X6W A;  4EBL A;  2BZT A;  4OLG A;  3OIQ A;  3SS3 A;  1E25 A;  3LQR A;  2W1O A;  1CJF A;  3D1N I;  4ETX A;  3V5M A;  4GJ4 A;  1BLC A;  1LSX A;  4CCL A;  3JRB A;  4C3I J;  2L9V A;  2W1T A;  1S6R A;  2G2U A;  2CLT A;  3WV3 A;  3AAF A;  3RJU A;  3S7N A;  3SS4 A;  4QSH A;  4XK4 A;  4M6X A;  2IRF G;  1KGG A;  4GR8 A;  5HDG A;  4DZP A;  2KIS A;  2Q1Z B;  4UQI S;  3MKZ A;  1GV5 A;  4PMA A;  4WEL A;  3SS5 A;  2KIU A;  3MKY B;  4AIK A;  1Y39 A;  2M7U A;  1I3A A;  4PAU A;  4WK8 F;  4IHT A;  4FX4 A;  1IXR C;  5D6F A;  3C2G A;  4FQG A;  4N9I A;  3QU6 A;  2F6C A;  2IWB A;  1G6O A;  3N6I A;  2HKO A;  2EX6 A;  3AIG A;  2DW2 A;  4HEF A;  1VQL I;  3BQY A;  2A6H F;  1VQ8 I;  4MN6 A;  4GQL A;  2L0R A;  1BKC A;  3AG2 H;  1N9L A;  1GCE A;  5DTK A;  1XGJ A;  3LR4 A;  3CDL A;  4C9Y A;  4FTH A;  1XA1 A;  3LFV A;  2HOS A;  4KUO A;  2PJT A;  4Z1W A;  1OJL A;  4EJT A;  2E2I J;  1K78 A;  1IJW C;  1KQ0 A;  1XMK A;  3BZK A;  4U3T A;  4XOR A;  1MC0 A;  4BKX A;  3SYT A;  5F82 A;  2W84 A;  1OME A;  1JAN A;  5GPA A;  2ZJQ F;  4KEN B;  4QHC A;  4UHU A;  5CED A;  5FJ8 J;  1X3U A;  4OOM A;  5JVT A;  1RUO A;  2ZSH B;  1NG6 A;  4N1X A;  1D1B A;  2F48 A;  4JKT A;  1YQS A;  3JSO A;  4X68 A;  1D1A A;  1YX5 A;  5DFY A;  3ABU A;  3HSF A;  2ELK A;  1KYW A;  1BQO A;  2RJP A;  3BJA A;  2PYP A;  1ACF A;  1TVF A;  4I01 A;  2O03 A;  1QMF A;  4KQQ A;  1WYC A;  1YP1 A;  4A7B A;  1Z91 A;  4HST A;  3RDI A;  1BL0 A;  2HDU A;  3F1P A;  2JRT A;  2Z3Y A;  3S8P A;  4GOG A;  3LIB A;  4K0W A;  1VI0 A;  4B3X A;  2PBD P;  4MNU A;  3E6D A;  4A3M J;  3PQK A;  1NHA A;  1F2K A;  4OIN F;  1Z1D A;  2QSG X;  2EWW A;  3B02 A;  4RQ9 A;  1Y56 A;  2W3G A;  2QPN A;  4YEJ A;  3R7W A;  3LR3 A;  1XA7 A;  5D4S A;  4IHV A;  2UXX A;  1HOM A;  2HKX A;  2WBM A;  5M1A A;  3LA3 A;  5M3F J;  2OZR A;  4XON A;  4PSX A;  3TSG A;  2K2N A;  4PKQ A;  2OWJ A;  1KA8 A;  2JUC A;  1GXQ A;  1BR2 A;  2JA2 A;  1P7J A;  3BR2 A;  5IOY A;  4HQM A;  4FET A;  3FK6 A;  5DKK A;  1ALQ A;  3KP4 A;  2EFN A;  3TG9 A;  3VYT B;  1B3D A;  2Y2N A;  1MJA A;  1GUU A;  3TMO A;  5FD5 A;  4TV7 A;  3B6A A;  4GUY A;  1UMT A;  1G3T A;  4O7D A;  1PW1 A;  3H5R A;  1AA7 A;  1LT0 A;  2DA1 A;  1WSU A;  1WA9 A;  3PBQ A;  2LP0 A;  3H0G J;  2RKH A;  1KDW A;  3N8L A;  4DW6 A;  5EV0 A;  3JAM K;  4M6V A;  4RYE A;  3S15 J;  2GZW A;  4P1W A;  3F1A A;  1D1C A;  3WWX A;  2FF4 A;  2L2O A;  2FFF B;  5L10 A;  2K9Q A;  1HW1 A;  1ZRD A;  2OF7 A;  4E70 A;  2JN7 A;  1ZLJ A;  4L9T A;  5C3E J;  4ENM A;  2ICW G;  4GYI A;  4AC0 A;  1ZKG A;  3S17 J;  2HU6 A;  4Y4R A;  4JP0 A;  2NNN A;  1KYZ A;  5BMZ A;  4HBL A;  2CGP A;  1R71 A;  3LEQ A;  5DD4 A;  1BUD A;  2F5E A;  1YYV A;  1V4R A;  2DOF A;  5K1Y A;  4Q5S F;  4BQM A;  2UZK A;  1I73 A;  4ZYG A;  3T4L A;  1LL9 A;  3UB8 A;  4MDZ A;  2RAE A;  5LBQ A;  5I4O A;  1CK7 A;  1FOY A;  5FL3 A;  4ZDX A;  3RPU A;  2MLG A;  1ZG6 A;  3EYY A;  3LSJ A;  4PKY G;  1NYM A;  2M7B A;  1G3W A;  4KZ7 A;  2CUF A;  2XSD C;  2EXA A;  2DCE A;  2Y31 A;  1RPW A;  1YS6 A;  4LMY A;  1JWV A;  5FSR A;  5IPA A;  3HL2 A;  3CMY A;  3R4K A;  1JKQ C;  1BLP A;  3ZMZ A;  4B48 A;  4JK1 X;  4OPQ A;  3JAM Z;  3BR0 A;  5G18 A;  4WLA A;  1FOK A;  5B1B H;  3GR2 A;  2KT0 A;  3KET A;  1MIJ A;  1V5G A;  4QWO A;  4BU2 A;  1I5Z A;  3MF0 A;  3B3X A;  1ZAO A;  3U1D A;  4Z9Q A;  4YRV A;  1ZYR F;  2CQK A;  1ZKJ A;  1TW2 A;  3MMH A;  4IRI A;  5CQE A;  4BXF A;  1GA0 A;  2XDM A;  2DMN A;  3DAV A;  5D2B A;  3BPX A;  3ABK H;  1GO7 P;  4KN7 X;  1LEB A;  4XLH A;  3IWF A;  4KZA A;  2UUZ A;  4I99 C;  1JTG A;  1Z21 A;  4S2M A;  1Q2Q A;  1LB2 A;  5J8F A;  5GHX A;  3HSE A;  1A6Q A;  3VDX A;  4P55 A;  1R1H A;  2VA0 A;  3M8J A;  2A2L A;  4JBF A;  1BR1 A;  3QU3 A;  1NLY A;  2Y2G A;  4WMC A;  2D02 A;  4GN2 A;  2W3F A;  5KHD A;  2P7C B;  1MNM C;  3C30 A;  3PYP A;  3HOZ J;  1N9B A;  4PM7 A;  2VB6 A;  3KEY A;  3C4P A;  2ZFU A;  1VEU B;  4H8R A;  2XGX A;  2JKG A;  3DQV C;  1HFS A;  1W1W E;  3FZV A;  1A6I A;  3JRF A;  4L9J A;  1K0K A;  2R9X A;  1SLN A;  1IGN A;  3HDD A;  5FAP A;  4ESJ A;  1TZL A;  4G6D A;  2LLK A;  1M40 A;  4JXG A;  3VE4 A;  3F1O A;  2IA0 A;  1I50 J;  1YE9 A;  3BR1 A;  3HVF A;  2EIN H;  2RQP