3AYUA

Crystal structure of mmp-2 active site mutant in complex with app-drived decapeptide inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGKGVGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 72 kDa type IV collagenase
publication title Structural basis for matrix metalloproteinase-2 (MMP-2)-selective inhibitory action of {beta}-amyloid precursor protein-derived inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ayuA00
3AYUA 2OVZA 4GUYA 1SATA 3TT4A 3KECA 4AXQA 1DMTA 4PKVA 5I4OA 1KUFA 4GQLA 1XFWA 1QIBA 2MZHA 3AYKA 4GR8A 1JK3A 2MLSA 1XFXA 4L19A 2AYKA 1JAOA 3DL1A 2W0DA 1KUKA 1K7QA 2OVXA 1GO8P 456CA 4PKSA 1USNA 3LQBA 2FV9A 1MNCA 3TS4A 2WO9A 1BQQM 4L6TA 1GE7A 2J0TA 3KEKA 1D8FA 1ZXCA 1BUVM 2W14A 1JJ9A 2KRJA 5I12A 1C8TA 3B8ZA 1FLSA 2K9CA 1OM8A 1ZXVA 1KAPP 1D5JA 4JPAA 4GR0A 3P1VA 3LK8A 1GE6A 2DW0A 2ERQA 4WKEA 3F15A 2L0RA 2W15A 1JAQA 2X3CA 5LABA 3DPEA 1JAPA 1PWWA 1ZS0A 3K7NA 2Y6CA 2X3BA 1CGFA 2PJTA 4IUWA 2OW0A 2POJA 3P24A 1PWPA 4H82A 2Z2DA 1IACA 3UVCA 5CUHA 2N8RA 3WV2A 5D3CA 3RTTA 3KHIA 3HBVP 1OS9A 5BOYA 1PWUA 4A3WA 4XM7A 1AF0A 4H3XA 3U1RA 3ZXHA 2OXZA 1QICA 4H84A 4XBHA 3V96B 4DF9A 1HTDA 3OHOA 4FXYP 1MMPA 4DPEA 4H76A 3EDGA 1G49A 1HY7A 3NX7A 3DPFA 3HB2P 3K7LA 2W13A 2JNPA 3AIGA 3B2ZA 1AYKA 2A8HA 1YQYA 1BIWA 4FXQA 4I35A 1JH1A 3KMEA 5B5PA 1SLNA 1D8MA 1Y93A 3LGPA 3WV3A 2XS3A 4H2EA 3F16A 4GF1A 4WK7A 1B8YA 1Y8JA 1I73A 5D1TA 1A86A 3EWJA 4XCTA 1QJJA 1DTHA 1G9KA 1Q3AA 2OW9A 1GKCA 1O0TA 1D7XA 966CA 1KBCA 1BKCA 1CQRA 1XURA 5B5OA 4J4MA 1IAGA 4Q1LA 1MMBA 1RM8A 4IJOA 1A85A 2D1OA 1BQOA 4R3VA 2J83A 3OHLA 1R1HA 2E2DA 2OXUA 4PKUA 1PWVA 3B92A 1XUCA 2X7MA 1CK7A 3HBUP 1ND1A 2JIHA 3HYGA 1QIAA 2RJQA 2HU6A 1BM6A 2Y6DA 1OM6A 1RMZA 1YCMA 3KWVC 1KUGA 1FBLA 1IADA 3CKIA 3LIKA 5L7FA 4JA1A 1EB6A 1HFCA 2AIGP 5I2ZA 4H49A 5I3MA 1XFYA 3LKAA 4AUOA 1ZP5A 1ROSA 4L63A 2OW1A 3LJTA 4JIJA 1L6JA 5D7WA 3F17A 4G9LA 1B3DA 1G12A 2CLTA 3LMCA 3EHYA 1GE5A 2WO8A 4HX3A 3F19A 5H8XA 3SHIA 1SRPA 1JANA 2SRTA 3N2VA 4G0DA 3DSLA 2DDFA 5D1SA 1JKYA 3E8RA 1GXDA 3BA0A 5L79A 3LUMA 4AIGA 1ATLA 1O0QA 1S4BP 1ZTQA 2YIGA 3EDIA 3LJZA 3O64A 1KUHA 4FVLA 3USNA 2K2GA 3O2XA 1UEAA 2DW2A 5D1UA 1J7NA 5D2BA 4GWMA 1IABA 1XFZA 3LQ0A 4ILWD 3LJGA 2O36A 1XFUA 4GR3A 2XS4A 1R54A 1K7IA 1R1JA 4I03A 1CXVA 4ON1A 1SLMA 4JP4A 4IN9A 2MZEA 5CZMA 2OY2A 3HDBA 4PKTA 4XM8A 4JQGA 4PKRA 1BKCE 1BKCI 1WNIA 1HV5A 2OZRA 1G05A 1AKLA 2D1NA 3EDHA 4H30A 2RJPA 4CTHA 5BPAA 3RTSA 5BOTA 1R1IA 1CIZA 1PWQA 2JT5A 5CXAA 1GKDA 3LUNA 2JSDA 4ZR5A 1HOVA 3F18A 4AYKA 3EHXA 1QUAA 1UTZA 2OW2A 3LEAA 3L0TA 2ERPA 2EROA 2WOAA 3LILA 1G4KA 4QKZA 1FM1A 3KEJA 3DWBA 3TSKA 3F1AA 2OXWA 3VTGA 3WV1A 1K7GA 1C7KA 3ZUKA 5I43A 1Z3JA 4WZVA 4PKWA 2MZIA 3Q2GA 2CKIA 3LE9A 4DV8A 1CAQA 1IAEA 4H1QA 1I1IP 2V4BA 1UMTA 3I7GA 3KMCA 2YB9A 2E3XA 4WKIA 3N2UA 2JT6A 1XUDA 2MLRA 1BSWA 3HDAP 1SMPA 4DD8A 3LIRA 5I0LA 1ASTA 1EAKA 1GO7P 4FU4A 2DW1A 2QPJA 3I7IA 3KRYA 1OM7A 1IAAA 1JIWP 1BZSA 2FV5A 4GWNA 3HY7A 1R55A 2USNA 3G5CA 1HFSA 1UTTA 1OMJA 1CGEA 1I76A 1YOUA 1KUIA 2I47A 1ZVXA 4HMAA 1OS2A 4WF6A 2OY4A 3GBOA 3ZVSA 2TCLA 3G42A 1H71P 1EUBA 3VI1A 4XM6A 2W12A 3MA2A 3TVCA 5JMYA 1QJIA 1Y0VA 2DDYA 1UMSA 830CA 1XFVA 2X3AA 1YP1A 4PKQA 3L0VA 3EDZA 3DNGA 1MMRA 1OO9A 4A7BA 1BUDA 1CGLA 2O3EA 1SU3A 1C3IA 4EFSA 2OI0A 1JIZA 3ELMA 1MMQA 3HY9A 3Q2HA
chains in the Genus database with same CATH superfamily
3AYUA 2OVZA 3DTIA 4GUYA 1SATA 3TT4A 3KECA 4AXQA 1DMTA 4PKVA 5I4OA 1KUFA 4GQLA 1XFWA 1QIBA 2MZHA 3AYKA 4GR8A 1JK3A 2MLSA 1XFXA 4L19A 2AYKA 1JAOA 3DL1A 2W0DA 1KUKA 1K7QA 2OVXA 1GO8P 456CA 4PKSA 1USNA 3LQBA 2FV9A 1MNCA 3TS4A 2WO9A 1BQQM 4L6TA 1GE7A 2J0TA 3KEKA 1D8FA 1ZXCA 1BUVM 2W14A 1JJ9A 2KRJA 5I12A 1C8TA 3B8ZA 1FLSA 2K9CA 1OM8A 1ZXVA 1KAPP 1D5JA 4JPAA 4GR0A 3P1VA 3LK8A 1GE6A 2DW0A 2ERQA 4WKEA 3F15A 2L0RA 2W15A 1JAQA 2X3CA 5LABA 3DPEA 1JAPA 1PWWA 1ZS0A 3K7NA 4L7AA 2Y6CA 2X3BA 1CGFA 2PJTA 4IUWA 2OW0A 2POJA 3P24A 1PWPA 4H82A 2Z2DA 1IACA 3UVCA 5CUHA 2N8RA 3WV2A 5D3CA 3RTTA 3KHIA 3HBVP 1OS9A 5BOYA 1PWUA 4A3WA 4XM7A 1AF0A 4H3XA 3U1RA 3ZXHA 2OXZA 1QICA 4H84A 4XBHA 3V96B 4DF9A 1HTDA 3OHOA 4FXYP 1MMPA 4DPEA 4H76A 3EDGA 1G49A 1HY7A 3NX7A 3DPFA 1TVIA 3HB2P 3K7LA 2W13A 2JNPA 3AIGA 3B2ZA 1AYKA 2A8HA 1YQYA 1BIWA 4FXQA 4I35A 1JH1A 3KMEA 5B5PA 1SLNA 1D8MA 1Y93A 3LGPA 3WV3A 2XS3A 4H2EA 3F16A 4GF1A 4WK7A 1B8YA 1Y8JA 1I73A 5D1TA 1A86A 3EWJA 4XCTA 1QJJA 1DTHA 1G9KA 1Q3AA 2OW9A 1GKCA 1O0TA 1D7XA 966CA 1KBCA 1BKCA 1CQRA 1XURA 5B5OA 4J4MA 1IAGA 4Q1LA 1MMBA 1RM8A 4IJOA 1A85A 2D1OA 1BQOA 4R3VA 2J83A 3OHLA 1R1HA 2E2DA 2OXUA 4PKUA 1PWVA 3B92A 1XUCA 2X7MA 1CK7A 3HBUP 1ND1A 2JIHA 3HYGA 1QIAA 2RJQA 2HU6A 1BM6A 2Y6DA 1OM6A 1RMZA 1YCMA 3KWVC 1KUGA 1FBLA 1XM5A 1IADA 3CKIA 3LIKA 5L7FA 4JA1A 1EB6A 1HFCA 2AIGP 5I2ZA 4H49A 5I3MA 1XFYA 3LKAA 4AUOA 1ZP5A 1ROSA 4L63A 2OW1A 3LJTA 4JIJA 1L6JA 3DTEA 5D7WA 3F17A 4G9LA 1B3DA 1G12A 2CLTA 3LMCA 3EHYA 1GE5A 2WO8A 4HX3A 3F19A 5H8XA 3SHIA 1SRPA 1JANA 2SRTA 3N2VA 4G0DA 3DSLA 2DDFA 5D1SA 1JKYA 3E8RA 1GXDA 3BA0A 5L79A 3LUMA 4AIGA 1ATLA 1O0QA 1S4BP 1ZTQA 2YIGA 3EDIA 3LJZA 3O64A 1KUHA 4FVLA 3USNA 2K2GA 3O2XA 1UEAA 2DW2A 5D1UA 1J7NA 5D2BA 4GWMA 1IABA 1XFZA 3LQ0A 4ILWD 3LJGA 2O36A 1XFUA 4GR3A 2XS4A 1R54A 1K7IA 1R1JA 4I03A 1CXVA 4ON1A 1SLMA 4JP4A 4IN9A 3DTKA 2MZEA 5CZMA 2OY2A 3HDBA 4PKTA 4XM8A 4JQGA 4PKRA 1BKCE 1BKCI 1WNIA 1HV5A 2OZRA 1G05A 1AKLA 2D1NA 3EDHA 4H30A 2YUFA 2RJPA 4CTHA 5BPAA 3RTSA 5BOTA 1R1IA 1CIZA 1PWQA 2JT5A 5CXAA 1GKDA 3LUNA 2JSDA 4ZR5A 1HOVA 3F18A 4AYKA 3EHXA 1QUAA 1UTZA 2OW2A 3LEAA 3L0TA 2ERPA 2EROA 2WOAA 3LILA 1G4KA 4QKZA 1FM1A 3KEJA 3DWBA 3TSKA 3F1AA 2OXWA 3VTGA 3WV1A 1K7GA 1C7KA 3ZUKA 1XAXA 5I43A 1Z3JA 4WZVA 4PKWA 2MZIA 3Q2GA 2CKIA 3LE9A 4DV8A 1CAQA 1IAEA 4H1QA 1I1IP 2V4BA 1UMTA 3I7GA 3KMCA 2YB9A 2E3XA 4WKIA 3N2UA 2JT6A 1XUDA 2MLRA 1BSWA 3HDAP 1SMPA 4DD8A 3LIRA 5I0LA 1ASTA 1EAKA 1GO7P 4FU4A 2DW1A 2QPJA 3I7IA 3KRYA 1OM7A 1IAAA 1JIWP 1BZSA 2FV5A 4GWNA 3HY7A 1R55A 2USNA 3G5CA 1HFSA 1UTTA 1OMJA 1CGEA 1I76A 1YOUA 1KUIA 2I47A 1ZVXA 4HMAA 1OS2A 4WF6A 2OY4A 3GBOA 3ZVSA 2TCLA 3G42A 1H71P 1EUBA 3VI1A 4XM6A 2W12A 3MA2A 3TVCA 5JMYA 1QJIA 1Y0VA 2DDYA 1UMSA 830CA 1XFVA 2X3AA 1YP1A 4PKQA 3L0VA 3EDZA 3DNGA 1MMRA 1OO9A 4A7BA 1BUDA 1CGLA 2O3EA 1SU3A 1C3IA 4EFSA 2OI0A 1JIZA 1OZ9A 3ELMA 1MMQA 3HY9A 3Q2HA
chains in the Genus database with same CATH topology
3AYUA 2OVZA 3DTIA 4GUYA 1SATA 3TT4A 3KECA 4AXQA 1DMTA 4PKVA 5I4OA 1KUFA 4GQLA 1XFWA 1QIBA 2MZHA 3AYKA 4GR8A 1JK3A 2MLSA 1XFXA 4L19A 2AYKA 1JAOA 3DL1A 2W0DA 1KUKA 1K7QA 2OVXA 1GO8P 456CA 4PKSA 1USNA 3LQBA 2FV9A 1MNCA 3TS4A 2WO9A 1BQQM 4L6TA 1GE7A 2J0TA 3KEKA 1D8FA 1ZXCA 1BUVM 2W14A 1JJ9A 2KRJA 5I12A 1C8TA 3B8ZA 1FLSA 2K9CA 1OM8A 1ZXVA 1KAPP 1D5JA 4JPAA 4GR0A 3P1VA 3LK8A 1GE6A 2DW0A 2ERQA 4WKEA 3F15A 2L0RA 2W15A 1JAQA 2X3CA 5LABA 3DPEA 1JAPA 1PWWA 1ZS0A 3K7NA 4L7AA 2Y6CA 2X3BA 1CGFA 2PJTA 4IUWA 2OW0A 2POJA 3P24A 1PWPA 4H82A 2Z2DA 1IACA 3UVCA 5CUHA 2N8RA 3WV2A 5D3CA 3RTTA 3KHIA 3HBVP 1OS9A 5BOYA 1PWUA 4A3WA 4XM7A 1AF0A 4H3XA 3U1RA 3ZXHA 2OXZA 1QICA 4H84A 4XBHA 3V96B 4DF9A 1HTDA 3OHOA 4FXYP 1MMPA 4DPEA 4H76A 3EDGA 1G49A 1HY7A 3NX7A 3DPFA 3HB2P 3K7LA 2W13A 2JNPA 3AIGA 3B2ZA 1AYKA 2A8HA 1YQYA 1BIWA 4FXQA 4I35A 1JH1A 3KMEA 5B5PA 1SLNA 1D8MA 1Y93A 3LGPA 3WV3A 2XS3A 4H2EA 3F16A 4GF1A 4WK7A 1B8YA 1Y8JA 1I73A 5D1TA 1A86A 3EWJA 4XCTA 1QJJA 1DTHA 1G9KA 1Q3AA 2OW9A 1GKCA 1O0TA 1D7XA 966CA 1KBCA 1BKCA 1CQRA 1XURA 5B5OA 4J4MA 1IAGA 4Q1LA 1MMBA 1RM8A 4IJOA 1A85A 2D1OA 1BQOA 4R3VA 2J83A 3OHLA 1R1HA 2E2DA 2OXUA 4PKUA 1PWVA 3B92A 1XUCA 2X7MA 1CK7A 3HBUP 1ND1A 2JIHA 3HYGA 1QIAA 2RJQA 2HU6A 1BM6A 2Y6DA 1OM6A 1RMZA 1YCMA 3KWVC 1KUGA 1FBLA 1IADA 3CKIA 3LIKA 5L7FA 4JA1A 1EB6A 1HFCA 2AIGP 5I2ZA 4H49A 5I3MA 1XFYA 3LKAA 4AUOA 1ZP5A 1ROSA 4L63A 2OW1A 3LJTA 4JIJA 1L6JA 3DTEA 5D7WA 3F17A 4G9LA 1B3DA 1G12A 2CLTA 3LMCA 3EHYA 1GE5A 2WO8A 4HX3A 3F19A 5H8XA 3SHIA 1SRPA 1JANA 2SRTA 3N2VA 4G0DA 3DSLA 2DDFA 5D1SA 1JKYA 3E8RA 1GXDA 3BA0A 5L79A 3LUMA 4AIGA 1ATLA 1O0QA 1S4BP 1ZTQA 2YIGA 3EDIA 3LJZA 3O64A 1KUHA 4FVLA 3USNA 2K2GA 3O2XA 1UEAA 2DW2A 5D1UA 1J7NA 5D2BA 4GWMA 1IABA 1XFZA 3LQ0A 4ILWD 3LJGA 2O36A 1XFUA 4GR3A 2XS4A 1R54A 1K7IA 1R1JA 4I03A 1CXVA 4ON1A 1SLMA 4JP4A 4IN9A 3DTKA 2MZEA 5CZMA 2OY2A 3HDBA 4PKTA 4XM8A 4JQGA 4PKRA 1BKCE 1BKCI 1WNIA 1HV5A 2OZRA 1G05A 1AKLA 2D1NA 3EDHA 4H30A 2YUFA 2RJPA 4CTHA 5BPAA 3RTSA 5BOTA 1R1IA 1CIZA 1PWQA 2JT5A 5CXAA 1GKDA 3LUNA 2JSDA 4ZR5A 1HOVA 3F18A 4AYKA 3EHXA 1QUAA 1UTZA 2OW2A 3LEAA 3L0TA 2ERPA 2EROA 2WOAA 3LILA 1G4KA 4QKZA 1FM1A 3KEJA 3DWBA 3TSKA 3F1AA 2OXWA 3VTGA 3WV1A 1K7GA 1C7KA 3ZUKA 5I43A 1Z3JA 4WZVA 4PKWA 2MZIA 3Q2GA 2CKIA 3LE9A 4DV8A 1CAQA 1IAEA 4H1QA 1I1IP 2V4BA 1UMTA 3I7GA 3KMCA 2YB9A 2E3XA 4WKIA 3N2UA 2JT6A 1XUDA 2MLRA 1BSWA 3HDAP 1SMPA 4DD8A 3LIRA 5I0LA 1ASTA 1EAKA 1GO7P 4FU4A 2DW1A 2QPJA 3I7IA 3KRYA 1OM7A 1IAAA 1JIWP 1BZSA 2FV5A 4GWNA 3HY7A 1R55A 2USNA 3G5CA 1HFSA 1UTTA 1OMJA 1CGEA 1I76A 1YOUA 1KUIA 2I47A 1ZVXA 4HMAA 1OS2A 4WF6A 2OY4A 3GBOA 3ZVSA 2TCLA 3G42A 1H71P 1EUBA 3VI1A 4XM6A 2W12A 3MA2A 3TVCA 5JMYA 1QJIA 1Y0VA 2DDYA 1UMSA 830CA 1XFVA 2X3AA 1YP1A 4PKQA 3L0VA 3EDZA 3DNGA 1MMRA 1OO9A 4A7BA 1BUDA 1CGLA 2O3EA 1SU3A 1C3IA 4EFSA 2OI0A 1JIZA 3ELMA 1MMQA 3HY9A 3Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYU A;  2OVZ A;  4GUY A;  1SAT A;  3TT4 A;  3KEC A;  4AXQ A;  1DMT A;  4PKV A;  5I4O A;  1KUF A;  4GQL A;  1XFW A;  1QIB A;  2MZH A;  3AYK A;  4GR8 A;  1JK3 A;  2MLS A;  1XFX A;  4L19 A;  2AYK A;  1JAO A;  3DL1 A;  2W0D A;  1KUK A;  1K7Q A;  2OVX A;  1GO8 P;  456C A;  4PKS A;  1USN A;  3LQB A;  2FV9 A;  1MNC A;  3TS4 A;  2WO9 A;  1BQQ M;  4L6T A;  1GE7 A;  2J0T A;  3KEK A;  1D8F A;  1ZXC A;  1BUV M;  2W14 A;  1JJ9 A;  2KRJ A;  5I12 A;  1C8T A;  3B8Z A;  1FLS A;  2K9C A;  1OM8 A;  1ZXV A;  1KAP P;  1D5J A;  4JPA A;  4GR0 A;  3P1V A;  3LK8 A;  1GE6 A;  2DW0 A;  2ERQ A;  4WKE A;  3F15 A;  2L0R A;  2W15 A;  1JAQ A;  2X3C A;  5LAB A;  3DPE A;  1JAP A;  1PWW A;  1ZS0 A;  3K7N A;  2Y6C A;  2X3B A;  1CGF A;  2PJT A;  4IUW A;  2OW0 A;  2POJ A;  3P24 A;  1PWP A;  4H82 A;  2Z2D A;  1IAC A;  3UVC A;  5CUH A;  2N8R A;  3WV2 A;  5D3C A;  3RTT A;  3KHI A;  3HBV P;  1OS9 A;  5BOY A;  1PWU A;  4A3W A;  4XM7 A;  1AF0 A;  4H3X A;  3U1R A;  3ZXH A;  2OXZ A;  1QIC A;  4H84 A;  4XBH A;  3V96 B;  4DF9 A;  1HTD A;  3OHO A;  4FXY P;  1MMP A;  4DPE A;  4H76 A;  3EDG A;  1G49 A;  1HY7 A;  3NX7 A;  3DPF A;  3HB2 P;  3K7L A;  2W13 A;  2JNP A;  3AIG A;  3B2Z A;  1AYK A;  2A8H A;  1YQY A;  1BIW A;  4FXQ A;  4I35 A;  1JH1 A;  3KME A;  5B5P A;  1SLN A;  1D8M A;  1Y93 A;  3LGP A;  3WV3 A;  2XS3 A;  4H2E A;  3F16 A;  4GF1 A;  4WK7 A;  1B8Y A;  1Y8J A;  1I73 A;  5D1T A;  1A86 A;  3EWJ A;  4XCT A;  1QJJ A;  1DTH A;  1G9K A;  1Q3A A;  2OW9 A;  1GKC A;  1O0T A;  1D7X A;  966C A;  1KBC A;  1BKC A;  1CQR A;  1XUR A;  5B5O A;  4J4M A;  1IAG A;  4Q1L A;  1MMB A;  1RM8 A;  4IJO A;  1A85 A;  2D1O A;  1BQO A;  4R3V A;  2J83 A;  3OHL A;  1R1H A;  2E2D A;  2OXU A;  4PKU A;  1PWV A;  3B92 A;  1XUC A;  2X7M A;  1CK7 A;  3HBU P;  1ND1 A;  2JIH A;  3HYG A;  1QIA A;  2RJQ A;  2HU6 A;  1BM6 A;  2Y6D A;  1OM6 A;  1RMZ A;  1YCM A;  3KWV C;  1KUG A;  1FBL A;  1IAD A;  3CKI A;  3LIK A;  5L7F A;  4JA1 A;  1EB6 A;  1HFC A;  2AIG P;  5I2Z A;  4H49 A;  5I3M A;  1XFY A;  3LKA A;  4AUO A;  1ZP5 A;  1ROS A;  4L63 A;  2OW1 A;  3LJT A;  4JIJ A;  1L6J A;  5D7W A;  3F17 A;  4G9L A;  1B3D A;  1G12 A;  2CLT A;  3LMC A;  3EHY A;  1GE5 A;  2WO8 A;  4HX3 A;  3F19 A;  5H8X A;  3SHI A;  1SRP A;  1JAN A;  2SRT A;  3N2V A;  4G0D A;  3DSL A;  2DDF A;  5D1S A;  1JKY A;  3E8R A;  1GXD A;  3BA0 A;  5L79 A;  3LUM A;  4AIG A;  1ATL A;  1O0Q A;  1S4B P;  1ZTQ A;  2YIG A;  3EDI A;  3LJZ A;  3O64 A;  1KUH A;  4FVL A;  3USN A;  2K2G A;  3O2X A;  1UEA A;  2DW2 A;  5D1U A;  1J7N A;  5D2B A;  4GWM A;  1IAB A;  1XFZ A;  3LQ0 A;  4ILW D;  3LJG A;  2O36 A;  1XFU A;  4GR3 A;  2XS4 A;  1R54 A;  1K7I A;  1R1J A;  4I03 A;  1CXV A;  4ON1 A;  1SLM A;  4JP4 A;  4IN9 A;  2MZE A;  5CZM A;  2OY2 A;  3HDB A;  4PKT A;  4XM8 A;  4JQG A;  4PKR A;  1BKC E;  1BKC I;  1WNI A;  1HV5 A;  2OZR A;  1G05 A;  1AKL A;  2D1N A;  3EDH A;  4H30 A;  2RJP A;  4CTH A;  5BPA A;  3RTS A;  5BOT A;  1R1I A;  1CIZ A;  1PWQ A;  2JT5 A;  5CXA A;  1GKD A;  3LUN A;  2JSD A;  4ZR5 A;  1HOV A;  3F18 A;  4AYK A;  3EHX A;  1QUA A;  1UTZ A;  2OW2 A;  3LEA A;  3L0T A;  2ERP A;  2ERO A;  2WOA A;  3LIL A;  1G4K A;  4QKZ A;  1FM1 A;  3KEJ A;  3DWB A;  3TSK A;  3F1A A;  2OXW A;  3VTG A;  3WV1 A;  1K7G A;  1C7K A;  3ZUK A;  5I43 A;  1Z3J A;  4WZV A;  4PKW A;  2MZI A;  3Q2G A;  2CKI A;  3LE9 A;  4DV8 A;  1CAQ A;  1IAE A;  4H1Q A;  1I1I P;  2V4B A;  1UMT A;  3I7G A;  3KMC A;  2YB9 A;  2E3X A;  4WKI A;  3N2U A;  2JT6 A;  1XUD A;  2MLR A;  1BSW A;  3HDA P;  1SMP A;  4DD8 A;  3LIR A;  5I0L A;  1AST A;  1EAK A;  1GO7 P;  4FU4 A;  2DW1 A;  2QPJ A;  3I7I A;  3KRY A;  1OM7 A;  1IAA A;  1JIW P;  1BZS A;  2FV5 A;  4GWN A;  3HY7 A;  1R55 A;  2USN A;  3G5C A;  1HFS A;  1UTT A;  1OMJ A;  1CGE A;  1I76 A;  1YOU A;  1KUI A;  2I47 A;  1ZVX A;  4HMA A;  1OS2 A;  4WF6 A;  2OY4 A;  3GBO A;  3ZVS A;  2TCL A;  3G42 A;  1H71 P;  1EUB A;  3VI1 A;  4XM6 A;  2W12 A;  3MA2 A;  3TVC A;  5JMY A;  1QJI A;  1Y0V A;  2DDY A;  1UMS A;  830C A;  1XFV A;  2X3A A;  1YP1 A;  4PKQ A;  3L0V A;  3EDZ A;  3DNG A;  1MMR A;  1OO9 A;  4A7B A;  1BUD A;  1CGL A;  2O3E A;  1SU3 A;  1C3I A;  4EFS A;  2OI0 A;  1JIZ A;  3ELM A;  1MMQ A;  3HY9 A;  3Q2H A; 
#chains in the Genus database with same CATH topology
 3AYU A;  2OVZ A;  3DTI A;  4GUY A;  1SAT A;  3TT4 A;  3KEC A;  4AXQ A;  1DMT A;  4PKV A;  5I4O A;  1KUF A;  4GQL A;  1XFW A;  1QIB A;  2MZH A;  3AYK A;  4GR8 A;  1JK3 A;  2MLS A;  1XFX A;  4L19 A;  2AYK A;  1JAO A;  3DL1 A;  2W0D A;  1KUK A;  1K7Q A;  2OVX A;  1GO8 P;  456C A;  4PKS A;  1USN A;  3LQB A;  2FV9 A;  1MNC A;  3TS4 A;  2WO9 A;  1BQQ M;  4L6T A;  1GE7 A;  2J0T A;  3KEK A;  1D8F A;  1ZXC A;  1BUV M;  2W14 A;  1JJ9 A;  2KRJ A;  5I12 A;  1C8T A;  3B8Z A;  1FLS A;  2K9C A;  1OM8 A;  1ZXV A;  1KAP P;  1D5J A;  4JPA A;  4GR0 A;  3P1V A;  3LK8 A;  1GE6 A;  2DW0 A;  2ERQ A;  4WKE A;  3F15 A;  2L0R A;  2W15 A;  1JAQ A;  2X3C A;  5LAB A;  3DPE A;  1JAP A;  1PWW A;  1ZS0 A;  3K7N A;  4L7A A;  2Y6C A;  2X3B A;  1CGF A;  2PJT A;  4IUW A;  2OW0 A;  2POJ A;  3P24 A;  1PWP A;  4H82 A;  2Z2D A;  1IAC A;  3UVC A;  5CUH A;  2N8R A;  3WV2 A;  5D3C A;  3RTT A;  3KHI A;  3HBV P;  1OS9 A;  5BOY A;  1PWU A;  4A3W A;  4XM7 A;  1AF0 A;  4H3X A;  3U1R A;  3ZXH A;  2OXZ A;  1QIC A;  4H84 A;  4XBH A;  3V96 B;  4DF9 A;  1HTD A;  3OHO A;  4FXY P;  1MMP A;  4DPE A;  4H76 A;  3EDG A;  1G49 A;  1HY7 A;  3NX7 A;  3DPF A;  1TVI A;  3HB2 P;  3K7L A;  2W13 A;  2JNP A;  3AIG A;  3B2Z A;  1AYK A;  2A8H A;  1YQY A;  1BIW A;  4FXQ A;  4I35 A;  1JH1 A;  3KME A;  5B5P A;  1SLN A;  1D8M A;  1Y93 A;  3LGP A;  3WV3 A;  2XS3 A;  4H2E A;  3F16 A;  4GF1 A;  4WK7 A;  1B8Y A;  1Y8J A;  1I73 A;  5D1T A;  1A86 A;  3EWJ A;  4XCT A;  1QJJ A;  1DTH A;  1G9K A;  1Q3A A;  2OW9 A;  1GKC A;  1O0T A;  1D7X A;  966C A;  1KBC A;  1BKC A;  1CQR A;  1XUR A;  5B5O A;  4J4M A;  1IAG A;  4Q1L A;  1MMB A;  1RM8 A;  4IJO A;  1A85 A;  2D1O A;  1BQO A;  4R3V A;  2J83 A;  3OHL A;  1R1H A;  2E2D A;  2OXU A;  4PKU A;  1PWV A;  3B92 A;  1XUC A;  2X7M A;  1CK7 A;  3HBU P;  1ND1 A;  2JIH A;  3HYG A;  1QIA A;  2RJQ A;  2HU6 A;  1BM6 A;  2Y6D A;  1OM6 A;  1RMZ A;  1YCM A;  3KWV C;  1KUG A;  1FBL A;  1XM5 A;  1IAD A;  3CKI A;  3LIK A;  5L7F A;  4JA1 A;  1EB6 A;  1HFC A;  2AIG P;  5I2Z A;  4H49 A;  5I3M A;  1XFY A;  3LKA A;  4AUO A;  1ZP5 A;  1ROS A;  4L63 A;  2OW1 A;  3LJT A;  4JIJ A;  1L6J A;  3DTE A;  5D7W A;  3F17 A;  4G9L A;  1B3D A;  1G12 A;  2CLT A;  3LMC A;  3EHY A;  1GE5 A;  2WO8 A;  4HX3 A;  3F19 A;  5H8X A;  3SHI A;  1SRP A;  1JAN A;  2SRT A;  3N2V A;  4G0D A;  3DSL A;  2DDF A;  5D1S A;  1JKY A;  3E8R A;  1GXD A;  3BA0 A;  5L79 A;  3LUM A;  4AIG A;  1ATL A;  1O0Q A;  1S4B P;  1ZTQ A;  2YIG A;  3EDI A;  3LJZ A;  3O64 A;  1KUH A;  4FVL A;  3USN A;  2K2G A;  3O2X A;  1UEA A;  2DW2 A;  5D1U A;  1J7N A;  5D2B A;  4GWM A;  1IAB A;  1XFZ A;  3LQ0 A;  4ILW D;  3LJG A;  2O36 A;  1XFU A;  4GR3 A;  2XS4 A;  1R54 A;  1K7I A;  1R1J A;  4I03 A;  1CXV A;  4ON1 A;  1SLM A;  4JP4 A;  4IN9 A;  3DTK A;  2MZE A;  5CZM A;  2OY2 A;  3HDB A;  4PKT A;  4XM8 A;  4JQG A;  4PKR A;  1BKC E;  1BKC I;  1WNI A;  1HV5 A;  2OZR A;  1G05 A;  1AKL A;  2D1N A;  3EDH A;  4H30 A;  2YUF A;  2RJP A;  4CTH A;  5BPA A;  3RTS A;  5BOT A;  1R1I A;  1CIZ A;  1PWQ A;  2JT5 A;  5CXA A;  1GKD A;  3LUN A;  2JSD A;  4ZR5 A;  1HOV A;  3F18 A;  4AYK A;  3EHX A;  1QUA A;  1UTZ A;  2OW2 A;  3LEA A;  3L0T A;  2ERP A;  2ERO A;  2WOA A;  3LIL A;  1G4K A;  4QKZ A;  1FM1 A;  3KEJ A;  3DWB A;  3TSK A;  3F1A A;  2OXW A;  3VTG A;  3WV1 A;  1K7G A;  1C7K A;  3ZUK A;  1XAX A;  5I43 A;  1Z3J A;  4WZV A;  4PKW A;  2MZI A;  3Q2G A;  2CKI A;  3LE9 A;  4DV8 A;  1CAQ A;  1IAE A;  4H1Q A;  1I1I P;  2V4B A;  1UMT A;  3I7G A;  3KMC A;  2YB9 A;  2E3X A;  4WKI A;  3N2U A;  2JT6 A;  1XUD A;  2MLR A;  1BSW A;  3HDA P;  1SMP A;  4DD8 A;  3LIR A;  5I0L A;  1AST A;  1EAK A;  1GO7 P;  4FU4 A;  2DW1 A;  2QPJ A;  3I7I A;  3KRY A;  1OM7 A;  1IAA A;  1JIW P;  1BZS A;  2FV5 A;  4GWN A;  3HY7 A;  1R55 A;  2USN A;  3G5C A;  1HFS A;  1UTT A;  1OMJ A;  1CGE A;  1I76 A;  1YOU A;  1KUI A;  2I47 A;  1ZVX A;  4HMA A;  1OS2 A;  4WF6 A;  2OY4 A;  3GBO A;  3ZVS A;  2TCL A;  3G42 A;  1H71 P;  1EUB A;  3VI1 A;  4XM6 A;  2W12 A;  3MA2 A;  3TVC A;  5JMY A;  1QJI A;  1Y0V A;  2DDY A;  1UMS A;  830C A;  1XFV A;  2X3A A;  1YP1 A;  4PKQ A;  3L0V A;  3EDZ A;  3DNG A;  1MMR A;  1OO9 A;  4A7B A;  1BUD A;  1CGL A;  2O3E A;  1SU3 A;  1C3I A;  4EFS A;  2OI0 A;  1JIZ A;  1OZ9 A;  3ELM A;  1MMQ A;  3HY9 A;  3Q2H A; 
#chains in the Genus database with same CATH homology
 3AYU A;  2OVZ A;  3DTI A;  4GUY A;  1SAT A;  3TT4 A;  3KEC A;  4AXQ A;  1DMT A;  4PKV A;  5I4O A;  1KUF A;  4GQL A;  1XFW A;  1QIB A;  2MZH A;  3AYK A;  4GR8 A;  1JK3 A;  2MLS A;  1XFX A;  4L19 A;  2AYK A;  1JAO A;  3DL1 A;  2W0D A;  1KUK A;  1K7Q A;  2OVX A;  1GO8 P;  456C A;  4PKS A;  1USN A;  3LQB A;  2FV9 A;  1MNC A;  3TS4 A;  2WO9 A;  1BQQ M;  4L6T A;  1GE7 A;  2J0T A;  3KEK A;  1D8F A;  1ZXC A;  1BUV M;  2W14 A;  1JJ9 A;  2KRJ A;  5I12 A;  1C8T A;  3B8Z A;  1FLS A;  2K9C A;  1OM8 A;  1ZXV A;  1KAP P;  1D5J A;  4JPA A;  4GR0 A;  3P1V A;  3LK8 A;  1GE6 A;  2DW0 A;  2ERQ A;  4WKE A;  3F15 A;  2L0R A;  2W15 A;  1JAQ A;  2X3C A;  5LAB A;  3DPE A;  1JAP A;  1PWW A;  1ZS0 A;  3K7N A;  4L7A A;  2Y6C A;  2X3B A;  1CGF A;  2PJT A;  4IUW A;  2OW0 A;  2POJ A;  3P24 A;  1PWP A;  4H82 A;  2Z2D A;  1IAC A;  3UVC A;  5CUH A;  2N8R A;  3WV2 A;  5D3C A;  3RTT A;  3KHI A;  3HBV P;  1OS9 A;  5BOY A;  1PWU A;  4A3W A;  4XM7 A;  1AF0 A;  4H3X A;  3U1R A;  3ZXH A;  2OXZ A;  1QIC A;  4H84 A;  4XBH A;  3V96 B;  4DF9 A;  1HTD A;  3OHO A;  4FXY P;  1MMP A;  4DPE A;  4H76 A;  3EDG A;  1G49 A;  1HY7 A;  3NX7 A;  3DPF A;  3HB2 P;  3K7L A;  2W13 A;  2JNP A;  3AIG A;  3B2Z A;  1AYK A;  2A8H A;  1YQY A;  1BIW A;  4FXQ A;  4I35 A;  1JH1 A;  3KME A;  5B5P A;  1SLN A;  1D8M A;  1Y93 A;  3LGP A;  3WV3 A;  2XS3 A;  4H2E A;  3F16 A;  4GF1 A;  4WK7 A;  1B8Y A;  1Y8J A;  1I73 A;  5D1T A;  1A86 A;  3EWJ A;  4XCT A;  1QJJ A;  1DTH A;  1G9K A;  1Q3A A;  2OW9 A;  1GKC A;  1O0T A;  1D7X A;  966C A;  1KBC A;  1BKC A;  1CQR A;  1XUR A;  5B5O A;  4J4M A;  1IAG A;  4Q1L A;  1MMB A;  1RM8 A;  4IJO A;  1A85 A;  2D1O A;  1BQO A;  4R3V A;  2J83 A;  3OHL A;  1R1H A;  2E2D A;  2OXU A;  4PKU A;  1PWV A;  3B92 A;  1XUC A;  2X7M A;  1CK7 A;  3HBU P;  1ND1 A;  2JIH A;  3HYG A;  1QIA A;  2RJQ A;  2HU6 A;  1BM6 A;  2Y6D A;  1OM6 A;  1RMZ A;  1YCM A;  3KWV C;  1KUG A;  1FBL A;  1IAD A;  3CKI A;  3LIK A;  5L7F A;  4JA1 A;  1EB6 A;  1HFC A;  2AIG P;  5I2Z A;  4H49 A;  5I3M A;  1XFY A;  3LKA A;  4AUO A;  1ZP5 A;  1ROS A;  4L63 A;  2OW1 A;  3LJT A;  4JIJ A;  1L6J A;  3DTE A;  5D7W A;  3F17 A;  4G9L A;  1B3D A;  1G12 A;  2CLT A;  3LMC A;  3EHY A;  1GE5 A;  2WO8 A;  4HX3 A;  3F19 A;  5H8X A;  3SHI A;  1SRP A;  1JAN A;  2SRT A;  3N2V A;  4G0D A;  3DSL A;  2DDF A;  5D1S A;  1JKY A;  3E8R A;  1GXD A;  3BA0 A;  5L79 A;  3LUM A;  4AIG A;  1ATL A;  1O0Q A;  1S4B P;  1ZTQ A;  2YIG A;  3EDI A;  3LJZ A;  3O64 A;  1KUH A;  4FVL A;  3USN A;  2K2G A;  3O2X A;  1UEA A;  2DW2 A;  5D1U A;  1J7N A;  5D2B A;  4GWM A;  1IAB A;  1XFZ A;  3LQ0 A;  4ILW D;  3LJG A;  2O36 A;  1XFU A;  4GR3 A;  2XS4 A;  1R54 A;  1K7I A;  1R1J A;  4I03 A;  1CXV A;  4ON1 A;  1SLM A;  4JP4 A;  4IN9 A;  3DTK A;  2MZE A;  5CZM A;  2OY2 A;  3HDB A;  4PKT A;  4XM8 A;  4JQG A;  4PKR A;  1BKC E;  1BKC I;  1WNI A;  1HV5 A;  2OZR A;  1G05 A;  1AKL A;  2D1N A;  3EDH A;  4H30 A;  2YUF A;  2RJP A;  4CTH A;  5BPA A;  3RTS A;  5BOT A;  1R1I A;  1CIZ A;  1PWQ A;  2JT5 A;  5CXA A;  1GKD A;  3LUN A;  2JSD A;  4ZR5 A;  1HOV A;  3F18 A;  4AYK A;  3EHX A;  1QUA A;  1UTZ A;  2OW2 A;  3LEA A;  3L0T A;  2ERP A;  2ERO A;  2WOA A;  3LIL A;  1G4K A;  4QKZ A;  1FM1 A;  3KEJ A;  3DWB A;  3TSK A;  3F1A A;  2OXW A;  3VTG A;  3WV1 A;  1K7G A;  1C7K A;  3ZUK A;  5I43 A;  1Z3J A;  4WZV A;  4PKW A;  2MZI A;  3Q2G A;  2CKI A;  3LE9 A;  4DV8 A;  1CAQ A;  1IAE A;  4H1Q A;  1I1I P;  2V4B A;  1UMT A;  3I7G A;  3KMC A;  2YB9 A;  2E3X A;  4WKI A;  3N2U A;  2JT6 A;  1XUD A;  2MLR A;  1BSW A;  3HDA P;  1SMP A;  4DD8 A;  3LIR A;  5I0L A;  1AST A;  1EAK A;  1GO7 P;  4FU4 A;  2DW1 A;  2QPJ A;  3I7I A;  3KRY A;  1OM7 A;  1IAA A;  1JIW P;  1BZS A;  2FV5 A;  4GWN A;  3HY7 A;  1R55 A;  2USN A;  3G5C A;  1HFS A;  1UTT A;  1OMJ A;  1CGE A;  1I76 A;  1YOU A;  1KUI A;  2I47 A;  1ZVX A;  4HMA A;  1OS2 A;  4WF6 A;  2OY4 A;  3GBO A;  3ZVS A;  2TCL A;  3G42 A;  1H71 P;  1EUB A;  3VI1 A;  4XM6 A;  2W12 A;  3MA2 A;  3TVC A;  5JMY A;  1QJI A;  1Y0V A;  2DDY A;  1UMS A;  830C A;  1XFV A;  2X3A A;  1YP1 A;  4PKQ A;  3L0V A;  3EDZ A;  3DNG A;  1MMR A;  1OO9 A;  4A7B A;  1BUD A;  1CGL A;  2O3E A;  1SU3 A;  1C3I A;  4EFS A;  2OI0 A;  1JIZ A;  3ELM A;  1MMQ A;  3HY9 A;  3Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...