4AXQA

Crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
GSHMKIYIQPLSVNSHTVEVLANSLPKIFNAEVFVLPASDVSLKCYNASRRQYNSTCILRMLPPIKVTLGVTGKDIYAKGMNFVFGEAELGGARAVLSVFRLTTADSELYRERVVKEAVHEIGHVLGLKHCSNNCVMRFSNSVQDVDRKPVSFCRECASKIRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARCHAEMETZINCIN
publication title Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 53
structure length 163
sequence length 163
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07998 Peptidase_M54 Peptidase family M54
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4axqA01
2Y6CA 1EAKA 1Y8JA 2OI0A 4XM8A 4GWMA 2JIHA 1G49A 1IAGA 1GKDA 1CAQA 1KUFA 4XCTA 1XFXA 3DSLA 5JMYA 1QICA 1MMBA 3WV2A 2DW2A 3KMEA 2W0DA 1K7QA 1ND1A 3HBUP 4H2EA 1CQRA 5D1SA 5I43A 1GO7P 1JIZA 1GO8P 5D3CA 3LUNA 4R3VA 1J7NA 3AYKA 4QKZA 1XFWA 5L7FA 2D1NA 5L79A 3KEKA 2JT6A 3SHIA 4AYKA 1B8YA 3RTTA 1BIWA 1CGLA 1JIWP 1L6JA 4WKEA 1CIZA 2X3CA 2A8HA 3LE9A 1BKCI 3TS4A 4GR0A 2X7MA 1JAOA 1QIBA 4WKIA 1IADA 3OHLA 1QUAA 3EDHA 2W12A 1ZXVA 3LJGA 2OXUA 2WOAA 1UEAA 3CKIA 1S4BP 3K7NA 830CA 4JQGA 1Y93A 1R1JA 966CA 5CZMA 1I1IP 4AIGA 1GE5A 3LQBA 1OM7A 4DV8A 2ERPA 2X3BA 3HYGA 5I0LA 2CKIA 2POJA 2ERQA 4H49A 4H76A 5I2ZA 2SRTA 4A7BA 4L63A 1XUDA 2OW1A 1C7KA 3EHYA 3P24A 1UTZA 4IN9A 3HY7A 1IABA 3F17A 1PWVA 1JAPA 3O64A 3LK8A 3AIGA 1BSWA 4PKVA 4GQLA 1R55A 2MZHA 1GE6A 1JANA 1R54A 1XFUA 3HY9A 1UTTA 1IAAA 4FXYP 4ILWD 2XS4A 2HU6A 3HB2P 1A86A 1DMTA 3LIRA 2AIGP 3LILA 3LMCA 2J83A 1G9KA 2K2GA 2FV5A 1USNA 3DPEA 1O0QA 3LQ0A 2JNPA 4G0DA 1MMQA 4HMAA 1ZP5A 4G9LA 3LKAA 2N8RA 4PKTA 3O2XA 2OXWA 2O3EA 3ZUKA 1FM1A 2D1OA 1GKCA 1YOUA 1A85A 4XM7A 5BOYA 1BKCE 1MNCA 1D8MA 2E2DA 1KUHA 2MLSA 5CUHA 1BM6A 1HY7A 3MA2A 3L0VA 4Q1LA 1G12A 1IACA 5BOTA 1UMTA 4FU4A 2OY4A 1B3DA 1BKCA 3TVCA 3L0TA 1AYKA 4HX3A 4PKRA 4H84A 1YCMA 2AYKA 3P1VA 1O0TA 3ZXHA 1BUDA 2DDYA 2WO8A 3VI1A 1SU3A 3DPFA 2OW0A 1I73A 3WV1A 1GXDA 1OS9A 4WK7A 5D1TA 1ROSA 3KMCA 4IUWA 1MMRA 5D7WA 1MMPA 4DD8A 2KRJA 2X3AA 2DDFA 4H3XA 1H71P 3LIKA 1HV5A 2FV9A 1GE7A 1KUIA 3G5CA 2MZEA 1JJ9A 2RJPA 1ZS0A 2DW1A 1DTHA 1C3IA 4JPAA 3ELMA 4AXQA 4PKSA 2W14A 1PWWA 4WZVA 3K7LA 4AUOA 1R1HA 2J0TA 3KWVC 2QPJA 4GR8A 1CXVA 1WNIA 1OM6A 1BQQM 3F1AA 3F18A 3G42A 2MZIA 1JAQA 5I3MA 1HTDA 2L0RA 4XBHA 4JP4A 5D1UA 4I35A 3N2VA 1C8TA 1D8FA 1OO9A 3B92A 1R1IA 2OW2A 3Q2GA 2OW9A 4A3WA 3B2ZA 4FVLA 2K9CA 3HDAP 1HFSA 2USNA 3DWBA 4GUYA 1XFYA 3USNA 4DPEA 3KECA 1RMZA 3F19A 1SLMA 3V96B 1ZTQA 2MLRA 3N2UA 1YQYA 3EDGA 3KEJA 4J4MA 3HDBA 1XFZA 2W13A 1CGEA 3I7GA 1Y0VA 1I76A 2PJTA 3EHXA 1XURA 1G4KA 1AKLA 4FXQA 1PWUA 2OZRA 5I4OA 4IJOA 3ZVSA 1BUVM 2OXZA 3GBOA 1OMJA 2O36A 2OVZA 3LJZA 4ON1A 456CA 1K7IA 3RTSA 1FLSA 1RM8A 5LABA 3TT4A 1K7GA 1HFCA 1PWPA 1CK7A 3KRYA 1JKYA 1HOVA 1XUCA 1KUGA 3I7IA 2DW0A 5BPAA 3WV3A 1QJJA 2YB9A 1Z3JA 4H30A 1SRPA 2JSDA 1EB6A 3BA0A 1OM8A 4L19A 3UVCA 1ZVXA 4ZR5A 4H82A 4JIJA 3DL1A 4PKQA 1EUBA 3LEAA 1KAPP 1KUKA 3E8RA 3LUMA 1AF0A 2W15A 3AYUA 1SATA 2RJQA 4XM6A 1Q3AA 2EROA 5I12A 1G05A 2YIGA 1BZSA 3NX7A 5B5PA 3F15A 1QJIA 1JK3A 5H8XA 5CXAA 3F16A 1CGFA 1PWQA 1YP1A 1ZXCA 2I47A 2Z2DA 2XS3A 4H1QA 1ASTA 3EDZA 5D2BA 3EWJA 1D5JA 3VTGA 1XFVA 2Y6DA 2CLTA 3B8ZA 4GF1A 1BQOA 1D7XA 4L6TA 3U1RA 3HBVP 1UMSA 4PKUA 5B5OA 3LGPA 4GR3A 2WO9A 2JT5A 1SLNA 1SMPA 3Q2HA 4WF6A 4I03A 1KBCA 4PKWA 2V4BA 3OHOA 1IAEA 4EFSA 2TCLA 1QIAA 1JH1A 1FBLA 2E3XA 3EDIA 4GWNA 2OVXA 3DNGA 3TSKA 1ATLA 3KHIA 4DF9A 4JA1A 1OS2A 4CTHA 3LJTA 2OY2A
chains in the Genus database with same CATH superfamily
2Y6CA 1EAKA 1Y8JA 2OI0A 4XM8A 4GWMA 2JIHA 1G49A 1IAGA 1GKDA 1CAQA 1KUFA 4XCTA 1XFXA 3DSLA 5JMYA 1QICA 1MMBA 3WV2A 2DW2A 3KMEA 2W0DA 1K7QA 1ND1A 3HBUP 4H2EA 1CQRA 5D1SA 5I43A 1GO7P 1JIZA 1GO8P 5D3CA 3LUNA 4R3VA 1J7NA 3AYKA 4QKZA 1XFWA 5L7FA 2D1NA 5L79A 3KEKA 2JT6A 3SHIA 4AYKA 1B8YA 3RTTA 1BIWA 1CGLA 1JIWP 1L6JA 4WKEA 1CIZA 2X3CA 2A8HA 3LE9A 1BKCI 3TS4A 4GR0A 2X7MA 1JAOA 3DTEA 1QIBA 4WKIA 1IADA 3OHLA 1QUAA 3EDHA 2W12A 1ZXVA 3LJGA 2OXUA 2WOAA 1UEAA 3CKIA 1S4BP 3K7NA 830CA 4JQGA 1Y93A 1R1JA 966CA 5CZMA 1I1IP 4AIGA 1GE5A 3LQBA 1OM7A 4DV8A 2ERPA 2X3BA 3HYGA 5I0LA 2CKIA 2POJA 2ERQA 2YUFA 4H49A 4H76A 5I2ZA 2SRTA 4A7BA 4L63A 1XUDA 2OW1A 1C7KA 3EHYA 3P24A 1UTZA 4IN9A 3HY7A 1IABA 3F17A 1PWVA 1JAPA 3O64A 3LK8A 3AIGA 1BSWA 4PKVA 4GQLA 1R55A 1XM5A 2MZHA 1GE6A 1JANA 1R54A 1XFUA 3HY9A 1UTTA 1IAAA 4FXYP 4ILWD 2XS4A 2HU6A 3HB2P 1A86A 1DMTA 3LIRA 2AIGP 3LILA 3LMCA 2J83A 1G9KA 2K2GA 2FV5A 1USNA 3DPEA 1O0QA 3LQ0A 2JNPA 4G0DA 1MMQA 4HMAA 1ZP5A 4G9LA 3LKAA 2N8RA 4PKTA 3O2XA 2OXWA 2O3EA 3ZUKA 1FM1A 2D1OA 1GKCA 1YOUA 1A85A 4XM7A 5BOYA 1BKCE 1MNCA 1D8MA 2E2DA 1KUHA 2MLSA 5CUHA 1BM6A 1HY7A 3MA2A 3L0VA 4Q1LA 1G12A 1IACA 5BOTA 1UMTA 4FU4A 2OY4A 1B3DA 1BKCA 3TVCA 3L0TA 1AYKA 4HX3A 3DTIA 4PKRA 4H84A 1YCMA 2AYKA 1XAXA 3P1VA 1O0TA 3ZXHA 1BUDA 2DDYA 2WO8A 3VI1A 1SU3A 3DPFA 2OW0A 1I73A 3WV1A 1GXDA 1OS9A 4WK7A 5D1TA 1ROSA 3KMCA 4IUWA 1MMRA 5D7WA 1MMPA 4DD8A 2KRJA 2X3AA 2DDFA 4H3XA 1H71P 3LIKA 1HV5A 2FV9A 1GE7A 1KUIA 3G5CA 2MZEA 1JJ9A 2RJPA 1ZS0A 2DW1A 1DTHA 1C3IA 4JPAA 3ELMA 4AXQA 4PKSA 2W14A 1PWWA 4WZVA 3K7LA 4AUOA 1R1HA 2J0TA 3KWVC 2QPJA 4GR8A 1CXVA 1WNIA 1OM6A 1BQQM 3F1AA 3F18A 3G42A 2MZIA 1JAQA 5I3MA 1HTDA 2L0RA 4XBHA 4JP4A 5D1UA 4I35A 3N2VA 1C8TA 1D8FA 1OO9A 3B92A 1R1IA 2OW2A 3Q2GA 2OW9A 4A3WA 4L7AA 3B2ZA 4FVLA 2K9CA 3HDAP 1HFSA 2USNA 3DWBA 4GUYA 1XFYA 3USNA 4DPEA 3KECA 1RMZA 3F19A 1SLMA 3V96B 1ZTQA 2MLRA 3N2UA 1YQYA 3EDGA 3KEJA 4J4MA 3HDBA 1XFZA 2W13A 1CGEA 3I7GA 1Y0VA 1I76A 2PJTA 3EHXA 1XURA 1G4KA 1AKLA 3DTKA 1PWUA 4FXQA 2OZRA 5I4OA 4IJOA 3ZVSA 1BUVM 2OXZA 3GBOA 1OMJA 2O36A 1OZ9A 2OVZA 3LJZA 4ON1A 456CA 1K7IA 3RTSA 1FLSA 1RM8A 5LABA 3TT4A 1K7GA 1HFCA 1PWPA 1CK7A 3KRYA 1JKYA 1TVIA 1HOVA 1XUCA 1KUGA 3I7IA 2DW0A 5BPAA 3WV3A 1QJJA 2YB9A 1Z3JA 4H30A 1SRPA 2JSDA 1EB6A 3BA0A 1OM8A 4L19A 3UVCA 1ZVXA 4ZR5A 4H82A 4JIJA 3DL1A 4PKQA 1EUBA 3LEAA 1KAPP 1KUKA 3E8RA 3LUMA 1AF0A 2W15A 3AYUA 1SATA 2RJQA 4XM6A 1Q3AA 2EROA 5I12A 1G05A 2YIGA 1BZSA 3NX7A 5B5PA 3F15A 1QJIA 1JK3A 5H8XA 5CXAA 3F16A 1CGFA 1PWQA 1YP1A 1ZXCA 2I47A 2Z2DA 2XS3A 4H1QA 1ASTA 3EDZA 5D2BA 3EWJA 1D5JA 3VTGA 1XFVA 2Y6DA 2CLTA 3B8ZA 4GF1A 1BQOA 1D7XA 4L6TA 3U1RA 3HBVP 1UMSA 4PKUA 5B5OA 3LGPA 4GR3A 2WO9A 2JT5A 1SLNA 1SMPA 3Q2HA 4WF6A 4I03A 1KBCA 4PKWA 2V4BA 3OHOA 1IAEA 4EFSA 2TCLA 1QIAA 1JH1A 1FBLA 2E3XA 3EDIA 4GWNA 2OVXA 3DNGA 3TSKA 1ATLA 3KHIA 4DF9A 4JA1A 1OS2A 4CTHA 3LJTA 2OY2A
chains in the Genus database with same CATH topology
2Y6CA 1EAKA 1Y8JA 2OI0A 4XM8A 4GWMA 2JIHA 1G49A 1IAGA 1GKDA 1CAQA 1KUFA 4XCTA 1XFXA 3DSLA 5JMYA 1QICA 1MMBA 3WV2A 2DW2A 3KMEA 2W0DA 1K7QA 1ND1A 3HBUP 4H2EA 1CQRA 5D1SA 5I43A 1GO7P 1JIZA 1GO8P 5D3CA 3LUNA 4R3VA 1J7NA 3AYKA 4QKZA 1XFWA 5L7FA 2D1NA 5L79A 3KEKA 2JT6A 3SHIA 4AYKA 1B8YA 3RTTA 1BIWA 1CGLA 1JIWP 1L6JA 4WKEA 1CIZA 2X3CA 2A8HA 3LE9A 1BKCI 3TS4A 4GR0A 2X7MA 1JAOA 3DTEA 1QIBA 4WKIA 1IADA 3OHLA 1QUAA 3EDHA 2W12A 1ZXVA 3LJGA 2OXUA 2WOAA 1UEAA 3CKIA 1S4BP 3K7NA 830CA 4JQGA 1Y93A 1R1JA 966CA 5CZMA 1I1IP 4AIGA 1GE5A 3LQBA 1OM7A 4DV8A 2ERPA 2X3BA 3HYGA 5I0LA 2CKIA 2POJA 2ERQA 2YUFA 4H49A 4H76A 5I2ZA 2SRTA 4A7BA 4L63A 1XUDA 2OW1A 1C7KA 3EHYA 3P24A 1UTZA 4IN9A 3HY7A 1IABA 3F17A 1PWVA 1JAPA 3O64A 3LK8A 3AIGA 1BSWA 4PKVA 4GQLA 1R55A 2MZHA 1GE6A 1JANA 1R54A 1XFUA 3HY9A 1UTTA 1IAAA 4FXYP 4ILWD 2XS4A 2HU6A 3HB2P 1A86A 1DMTA 3LIRA 2AIGP 3LILA 3LMCA 2J83A 1G9KA 2K2GA 2FV5A 1USNA 3DPEA 1O0QA 3LQ0A 2JNPA 4G0DA 1MMQA 4HMAA 1ZP5A 4G9LA 3LKAA 2N8RA 4PKTA 3O2XA 2OXWA 2O3EA 3ZUKA 1FM1A 2D1OA 1GKCA 1YOUA 1A85A 4XM7A 5BOYA 1BKCE 1MNCA 1D8MA 2E2DA 1KUHA 2MLSA 5CUHA 1BM6A 1HY7A 3MA2A 3L0VA 4Q1LA 1G12A 1IACA 5BOTA 1UMTA 4FU4A 2OY4A 1B3DA 1BKCA 3TVCA 3L0TA 1AYKA 4HX3A 3DTIA 4PKRA 4H84A 1YCMA 2AYKA 3P1VA 1O0TA 3ZXHA 1BUDA 2DDYA 2WO8A 3VI1A 1SU3A 3DPFA 2OW0A 1I73A 3WV1A 1GXDA 1OS9A 4WK7A 5D1TA 1ROSA 3KMCA 4IUWA 1MMRA 5D7WA 1MMPA 4DD8A 2KRJA 2X3AA 2DDFA 4H3XA 1H71P 3LIKA 1HV5A 2FV9A 1GE7A 1KUIA 3G5CA 2MZEA 1JJ9A 2RJPA 1ZS0A 2DW1A 1DTHA 1C3IA 4JPAA 3ELMA 4AXQA 4PKSA 2W14A 1PWWA 4WZVA 3K7LA 4AUOA 1R1HA 2J0TA 3KWVC 2QPJA 4GR8A 1CXVA 1WNIA 1OM6A 1BQQM 3F1AA 3F18A 3G42A 2MZIA 1JAQA 5I3MA 1HTDA 2L0RA 4XBHA 4JP4A 5D1UA 4I35A 3N2VA 1C8TA 1D8FA 1OO9A 3B92A 1R1IA 2OW2A 3Q2GA 2OW9A 4A3WA 4L7AA 3B2ZA 4FVLA 2K9CA 3HDAP 1HFSA 2USNA 3DWBA 4GUYA 1XFYA 3USNA 4DPEA 3KECA 1RMZA 3F19A 1SLMA 3V96B 1ZTQA 2MLRA 3N2UA 1YQYA 3EDGA 3KEJA 4J4MA 3HDBA 1XFZA 2W13A 1CGEA 3I7GA 1Y0VA 1I76A 2PJTA 3EHXA 1XURA 1G4KA 1AKLA 3DTKA 1PWUA 4FXQA 2OZRA 5I4OA 4IJOA 3ZVSA 1BUVM 2OXZA 3GBOA 1OMJA 2O36A 2OVZA 3LJZA 4ON1A 456CA 1K7IA 3RTSA 1FLSA 1RM8A 5LABA 3TT4A 1K7GA 1HFCA 1PWPA 1CK7A 3KRYA 1JKYA 1HOVA 1XUCA 1KUGA 3I7IA 2DW0A 5BPAA 3WV3A 1QJJA 2YB9A 1Z3JA 4H30A 1SRPA 2JSDA 1EB6A 3BA0A 1OM8A 4L19A 3UVCA 1ZVXA 4ZR5A 4H82A 4JIJA 3DL1A 4PKQA 1EUBA 3LEAA 1KAPP 1KUKA 3E8RA 3LUMA 1AF0A 2W15A 3AYUA 1SATA 2RJQA 4XM6A 1Q3AA 2EROA 5I12A 1G05A 2YIGA 1BZSA 3NX7A 5B5PA 3F15A 1QJIA 1JK3A 5H8XA 5CXAA 3F16A 1CGFA 1PWQA 1YP1A 1ZXCA 2I47A 2Z2DA 2XS3A 4H1QA 1ASTA 3EDZA 5D2BA 3EWJA 1D5JA 3VTGA 1XFVA 2Y6DA 2CLTA 3B8ZA 4GF1A 1BQOA 1D7XA 4L6TA 3U1RA 3HBVP 1UMSA 4PKUA 5B5OA 3LGPA 4GR3A 2WO9A 2JT5A 1SLNA 1SMPA 3Q2HA 4WF6A 4I03A 1KBCA 4PKWA 2V4BA 3OHOA 1IAEA 4EFSA 2TCLA 1QIAA 1JH1A 1FBLA 2E3XA 3EDIA 4GWNA 2OVXA 3DNGA 3TSKA 1ATLA 3KHIA 4DF9A 4JA1A 1OS2A 4CTHA 3LJTA 2OY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6C A;  1EAK A;  1Y8J A;  2OI0 A;  4XM8 A;  4GWM A;  2JIH A;  1G49 A;  1IAG A;  1GKD A;  1CAQ A;  1KUF A;  4XCT A;  1XFX A;  3DSL A;  5JMY A;  1QIC A;  1MMB A;  3WV2 A;  2DW2 A;  3KME A;  2W0D A;  1K7Q A;  1ND1 A;  3HBU P;  4H2E A;  1CQR A;  5D1S A;  5I43 A;  1GO7 P;  1JIZ A;  1GO8 P;  5D3C A;  3LUN A;  4R3V A;  1J7N A;  3AYK A;  4QKZ A;  1XFW A;  5L7F A;  2D1N A;  5L79 A;  3KEK A;  2JT6 A;  3SHI A;  4AYK A;  1B8Y A;  3RTT A;  1BIW A;  1CGL A;  1JIW P;  1L6J A;  4WKE A;  1CIZ A;  2X3C A;  2A8H A;  3LE9 A;  1BKC I;  3TS4 A;  4GR0 A;  2X7M A;  1JAO A;  1QIB A;  4WKI A;  1IAD A;  3OHL A;  1QUA A;  3EDH A;  2W12 A;  1ZXV A;  3LJG A;  2OXU A;  2WOA A;  1UEA A;  3CKI A;  1S4B P;  3K7N A;  830C A;  4JQG A;  1Y93 A;  1R1J A;  966C A;  5CZM A;  1I1I P;  4AIG A;  1GE5 A;  3LQB A;  1OM7 A;  4DV8 A;  2ERP A;  2X3B A;  3HYG A;  5I0L A;  2CKI A;  2POJ A;  2ERQ A;  4H49 A;  4H76 A;  5I2Z A;  2SRT A;  4A7B A;  4L63 A;  1XUD A;  2OW1 A;  1C7K A;  3EHY A;  3P24 A;  1UTZ A;  4IN9 A;  3HY7 A;  1IAB A;  3F17 A;  1PWV A;  1JAP A;  3O64 A;  3LK8 A;  3AIG A;  1BSW A;  4PKV A;  4GQL A;  1R55 A;  2MZH A;  1GE6 A;  1JAN A;  1R54 A;  1XFU A;  3HY9 A;  1UTT A;  1IAA A;  4FXY P;  4ILW D;  2XS4 A;  2HU6 A;  3HB2 P;  1A86 A;  1DMT A;  3LIR A;  2AIG P;  3LIL A;  3LMC A;  2J83 A;  1G9K A;  2K2G A;  2FV5 A;  1USN A;  3DPE A;  1O0Q A;  3LQ0 A;  2JNP A;  4G0D A;  1MMQ A;  4HMA A;  1ZP5 A;  4G9L A;  3LKA A;  2N8R A;  4PKT A;  3O2X A;  2OXW A;  2O3E A;  3ZUK A;  1FM1 A;  2D1O A;  1GKC A;  1YOU A;  1A85 A;  4XM7 A;  5BOY A;  1BKC E;  1MNC A;  1D8M A;  2E2D A;  1KUH A;  2MLS A;  5CUH A;  1BM6 A;  1HY7 A;  3MA2 A;  3L0V A;  4Q1L A;  1G12 A;  1IAC A;  5BOT A;  1UMT A;  4FU4 A;  2OY4 A;  1B3D A;  1BKC A;  3TVC A;  3L0T A;  1AYK A;  4HX3 A;  4PKR A;  4H84 A;  1YCM A;  2AYK A;  3P1V A;  1O0T A;  3ZXH A;  1BUD A;  2DDY A;  2WO8 A;  3VI1 A;  1SU3 A;  3DPF A;  2OW0 A;  1I73 A;  3WV1 A;  1GXD A;  1OS9 A;  4WK7 A;  5D1T A;  1ROS A;  3KMC A;  4IUW A;  1MMR A;  5D7W A;  1MMP A;  4DD8 A;  2KRJ A;  2X3A A;  2DDF A;  4H3X A;  1H71 P;  3LIK A;  1HV5 A;  2FV9 A;  1GE7 A;  1KUI A;  3G5C A;  2MZE A;  1JJ9 A;  2RJP A;  1ZS0 A;  2DW1 A;  1DTH A;  1C3I A;  4JPA A;  3ELM A;  4AXQ A;  4PKS A;  2W14 A;  1PWW A;  4WZV A;  3K7L A;  4AUO A;  1R1H A;  2J0T A;  3KWV C;  2QPJ A;  4GR8 A;  1CXV A;  1WNI A;  1OM6 A;  1BQQ M;  3F1A A;  3F18 A;  3G42 A;  2MZI A;  1JAQ A;  5I3M A;  1HTD A;  2L0R A;  4XBH A;  4JP4 A;  5D1U A;  4I35 A;  3N2V A;  1C8T A;  1D8F A;  1OO9 A;  3B92 A;  1R1I A;  2OW2 A;  3Q2G A;  2OW9 A;  4A3W A;  3B2Z A;  4FVL A;  2K9C A;  3HDA P;  1HFS A;  2USN A;  3DWB A;  4GUY A;  1XFY A;  3USN A;  4DPE A;  3KEC A;  1RMZ A;  3F19 A;  1SLM A;  3V96 B;  1ZTQ A;  2MLR A;  3N2U A;  1YQY A;  3EDG A;  3KEJ A;  4J4M A;  3HDB A;  1XFZ A;  2W13 A;  1CGE A;  3I7G A;  1Y0V A;  1I76 A;  2PJT A;  3EHX A;  1XUR A;  1G4K A;  1AKL A;  4FXQ A;  1PWU A;  2OZR A;  5I4O A;  4IJO A;  3ZVS A;  1BUV M;  2OXZ A;  3GBO A;  1OMJ A;  2O36 A;  2OVZ A;  3LJZ A;  4ON1 A;  456C A;  1K7I A;  3RTS A;  1FLS A;  1RM8 A;  5LAB A;  3TT4 A;  1K7G A;  1HFC A;  1PWP A;  1CK7 A;  3KRY A;  1JKY A;  1HOV A;  1XUC A;  1KUG A;  3I7I A;  2DW0 A;  5BPA A;  3WV3 A;  1QJJ A;  2YB9 A;  1Z3J A;  4H30 A;  1SRP A;  2JSD A;  1EB6 A;  3BA0 A;  1OM8 A;  4L19 A;  3UVC A;  1ZVX A;  4ZR5 A;  4H82 A;  4JIJ A;  3DL1 A;  4PKQ A;  1EUB A;  3LEA A;  1KAP P;  1KUK A;  3E8R A;  3LUM A;  1AF0 A;  2W15 A;  3AYU A;  1SAT A;  2RJQ A;  4XM6 A;  1Q3A A;  2ERO A;  5I12 A;  1G05 A;  2YIG A;  1BZS A;  3NX7 A;  5B5P A;  3F15 A;  1QJI A;  1JK3 A;  5H8X A;  5CXA A;  3F16 A;  1CGF A;  1PWQ A;  1YP1 A;  1ZXC A;  2I47 A;  2Z2D A;  2XS3 A;  4H1Q A;  1AST A;  3EDZ A;  5D2B A;  3EWJ A;  1D5J A;  3VTG A;  1XFV A;  2Y6D A;  2CLT A;  3B8Z A;  4GF1 A;  1BQO A;  1D7X A;  4L6T A;  3U1R A;  3HBV P;  1UMS A;  4PKU A;  5B5O A;  3LGP A;  4GR3 A;  2WO9 A;  2JT5 A;  1SLN A;  1SMP A;  3Q2H A;  4WF6 A;  4I03 A;  1KBC A;  4PKW A;  2V4B A;  3OHO A;  1IAE A;  4EFS A;  2TCL A;  1QIA A;  1JH1 A;  1FBL A;  2E3X A;  3EDI A;  4GWN A;  2OVX A;  3DNG A;  3TSK A;  1ATL A;  3KHI A;  4DF9 A;  4JA1 A;  1OS2 A;  4CTH A;  3LJT A;  2OY2 A; 
#chains in the Genus database with same CATH topology
 2Y6C A;  1EAK A;  1Y8J A;  2OI0 A;  4XM8 A;  4GWM A;  2JIH A;  1G49 A;  1IAG A;  1GKD A;  1CAQ A;  1KUF A;  4XCT A;  1XFX A;  3DSL A;  5JMY A;  1QIC A;  1MMB A;  3WV2 A;  2DW2 A;  3KME A;  2W0D A;  1K7Q A;  1ND1 A;  3HBU P;  4H2E A;  1CQR A;  5D1S A;  5I43 A;  1GO7 P;  1JIZ A;  1GO8 P;  5D3C A;  3LUN A;  4R3V A;  1J7N A;  3AYK A;  4QKZ A;  1XFW A;  5L7F A;  2D1N A;  5L79 A;  3KEK A;  2JT6 A;  3SHI A;  4AYK A;  1B8Y A;  3RTT A;  1BIW A;  1CGL A;  1JIW P;  1L6J A;  4WKE A;  1CIZ A;  2X3C A;  2A8H A;  3LE9 A;  1BKC I;  3TS4 A;  4GR0 A;  2X7M A;  1JAO A;  3DTE A;  1QIB A;  4WKI A;  1IAD A;  3OHL A;  1QUA A;  3EDH A;  2W12 A;  1ZXV A;  3LJG A;  2OXU A;  2WOA A;  1UEA A;  3CKI A;  1S4B P;  3K7N A;  830C A;  4JQG A;  1Y93 A;  1R1J A;  966C A;  5CZM A;  1I1I P;  4AIG A;  1GE5 A;  3LQB A;  1OM7 A;  4DV8 A;  2ERP A;  2X3B A;  3HYG A;  5I0L A;  2CKI A;  2POJ A;  2ERQ A;  2YUF A;  4H49 A;  4H76 A;  5I2Z A;  2SRT A;  4A7B A;  4L63 A;  1XUD A;  2OW1 A;  1C7K A;  3EHY A;  3P24 A;  1UTZ A;  4IN9 A;  3HY7 A;  1IAB A;  3F17 A;  1PWV A;  1JAP A;  3O64 A;  3LK8 A;  3AIG A;  1BSW A;  4PKV A;  4GQL A;  1R55 A;  1XM5 A;  2MZH A;  1GE6 A;  1JAN A;  1R54 A;  1XFU A;  3HY9 A;  1UTT A;  1IAA A;  4FXY P;  4ILW D;  2XS4 A;  2HU6 A;  3HB2 P;  1A86 A;  1DMT A;  3LIR A;  2AIG P;  3LIL A;  3LMC A;  2J83 A;  1G9K A;  2K2G A;  2FV5 A;  1USN A;  3DPE A;  1O0Q A;  3LQ0 A;  2JNP A;  4G0D A;  1MMQ A;  4HMA A;  1ZP5 A;  4G9L A;  3LKA A;  2N8R A;  4PKT A;  3O2X A;  2OXW A;  2O3E A;  3ZUK A;  1FM1 A;  2D1O A;  1GKC A;  1YOU A;  1A85 A;  4XM7 A;  5BOY A;  1BKC E;  1MNC A;  1D8M A;  2E2D A;  1KUH A;  2MLS A;  5CUH A;  1BM6 A;  1HY7 A;  3MA2 A;  3L0V A;  4Q1L A;  1G12 A;  1IAC A;  5BOT A;  1UMT A;  4FU4 A;  2OY4 A;  1B3D A;  1BKC A;  3TVC A;  3L0T A;  1AYK A;  4HX3 A;  3DTI A;  4PKR A;  4H84 A;  1YCM A;  2AYK A;  1XAX A;  3P1V A;  1O0T A;  3ZXH A;  1BUD A;  2DDY A;  2WO8 A;  3VI1 A;  1SU3 A;  3DPF A;  2OW0 A;  1I73 A;  3WV1 A;  1GXD A;  1OS9 A;  4WK7 A;  5D1T A;  1ROS A;  3KMC A;  4IUW A;  1MMR A;  5D7W A;  1MMP A;  4DD8 A;  2KRJ A;  2X3A A;  2DDF A;  4H3X A;  1H71 P;  3LIK A;  1HV5 A;  2FV9 A;  1GE7 A;  1KUI A;  3G5C A;  2MZE A;  1JJ9 A;  2RJP A;  1ZS0 A;  2DW1 A;  1DTH A;  1C3I A;  4JPA A;  3ELM A;  4AXQ A;  4PKS A;  2W14 A;  1PWW A;  4WZV A;  3K7L A;  4AUO A;  1R1H A;  2J0T A;  3KWV C;  2QPJ A;  4GR8 A;  1CXV A;  1WNI A;  1OM6 A;  1BQQ M;  3F1A A;  3F18 A;  3G42 A;  2MZI A;  1JAQ A;  5I3M A;  1HTD A;  2L0R A;  4XBH A;  4JP4 A;  5D1U A;  4I35 A;  3N2V A;  1C8T A;  1D8F A;  1OO9 A;  3B92 A;  1R1I A;  2OW2 A;  3Q2G A;  2OW9 A;  4A3W A;  4L7A A;  3B2Z A;  4FVL A;  2K9C A;  3HDA P;  1HFS A;  2USN A;  3DWB A;  4GUY A;  1XFY A;  3USN A;  4DPE A;  3KEC A;  1RMZ A;  3F19 A;  1SLM A;  3V96 B;  1ZTQ A;  2MLR A;  3N2U A;  1YQY A;  3EDG A;  3KEJ A;  4J4M A;  3HDB A;  1XFZ A;  2W13 A;  1CGE A;  3I7G A;  1Y0V A;  1I76 A;  2PJT A;  3EHX A;  1XUR A;  1G4K A;  1AKL A;  3DTK A;  1PWU A;  4FXQ A;  2OZR A;  5I4O A;  4IJO A;  3ZVS A;  1BUV M;  2OXZ A;  3GBO A;  1OMJ A;  2O36 A;  1OZ9 A;  2OVZ A;  3LJZ A;  4ON1 A;  456C A;  1K7I A;  3RTS A;  1FLS A;  1RM8 A;  5LAB A;  3TT4 A;  1K7G A;  1HFC A;  1PWP A;  1CK7 A;  3KRY A;  1JKY A;  1TVI A;  1HOV A;  1XUC A;  1KUG A;  3I7I A;  2DW0 A;  5BPA A;  3WV3 A;  1QJJ A;  2YB9 A;  1Z3J A;  4H30 A;  1SRP A;  2JSD A;  1EB6 A;  3BA0 A;  1OM8 A;  4L19 A;  3UVC A;  1ZVX A;  4ZR5 A;  4H82 A;  4JIJ A;  3DL1 A;  4PKQ A;  1EUB A;  3LEA A;  1KAP P;  1KUK A;  3E8R A;  3LUM A;  1AF0 A;  2W15 A;  3AYU A;  1SAT A;  2RJQ A;  4XM6 A;  1Q3A A;  2ERO A;  5I12 A;  1G05 A;  2YIG A;  1BZS A;  3NX7 A;  5B5P A;  3F15 A;  1QJI A;  1JK3 A;  5H8X A;  5CXA A;  3F16 A;  1CGF A;  1PWQ A;  1YP1 A;  1ZXC A;  2I47 A;  2Z2D A;  2XS3 A;  4H1Q A;  1AST A;  3EDZ A;  5D2B A;  3EWJ A;  1D5J A;  3VTG A;  1XFV A;  2Y6D A;  2CLT A;  3B8Z A;  4GF1 A;  1BQO A;  1D7X A;  4L6T A;  3U1R A;  3HBV P;  1UMS A;  4PKU A;  5B5O A;  3LGP A;  4GR3 A;  2WO9 A;  2JT5 A;  1SLN A;  1SMP A;  3Q2H A;  4WF6 A;  4I03 A;  1KBC A;  4PKW A;  2V4B A;  3OHO A;  1IAE A;  4EFS A;  2TCL A;  1QIA A;  1JH1 A;  1FBL A;  2E3X A;  3EDI A;  4GWN A;  2OVX A;  3DNG A;  3TSK A;  1ATL A;  3KHI A;  4DF9 A;  4JA1 A;  1OS2 A;  4CTH A;  3LJT A;  2OY2 A; 
#chains in the Genus database with same CATH homology
 2Y6C A;  1EAK A;  1Y8J A;  2OI0 A;  4XM8 A;  4GWM A;  2JIH A;  1G49 A;  1IAG A;  1GKD A;  1CAQ A;  1KUF A;  4XCT A;  1XFX A;  3DSL A;  5JMY A;  1QIC A;  1MMB A;  3WV2 A;  2DW2 A;  3KME A;  2W0D A;  1K7Q A;  1ND1 A;  3HBU P;  4H2E A;  1CQR A;  5D1S A;  5I43 A;  1GO7 P;  1JIZ A;  1GO8 P;  5D3C A;  3LUN A;  4R3V A;  1J7N A;  3AYK A;  4QKZ A;  1XFW A;  5L7F A;  2D1N A;  5L79 A;  3KEK A;  2JT6 A;  3SHI A;  4AYK A;  1B8Y A;  3RTT A;  1BIW A;  1CGL A;  1JIW P;  1L6J A;  4WKE A;  1CIZ A;  2X3C A;  2A8H A;  3LE9 A;  1BKC I;  3TS4 A;  4GR0 A;  2X7M A;  1JAO A;  3DTE A;  1QIB A;  4WKI A;  1IAD A;  3OHL A;  1QUA A;  3EDH A;  2W12 A;  1ZXV A;  3LJG A;  2OXU A;  2WOA A;  1UEA A;  3CKI A;  1S4B P;  3K7N A;  830C A;  4JQG A;  1Y93 A;  1R1J A;  966C A;  5CZM A;  1I1I P;  4AIG A;  1GE5 A;  3LQB A;  1OM7 A;  4DV8 A;  2ERP A;  2X3B A;  3HYG A;  5I0L A;  2CKI A;  2POJ A;  2ERQ A;  2YUF A;  4H49 A;  4H76 A;  5I2Z A;  2SRT A;  4A7B A;  4L63 A;  1XUD A;  2OW1 A;  1C7K A;  3EHY A;  3P24 A;  1UTZ A;  4IN9 A;  3HY7 A;  1IAB A;  3F17 A;  1PWV A;  1JAP A;  3O64 A;  3LK8 A;  3AIG A;  1BSW A;  4PKV A;  4GQL A;  1R55 A;  2MZH A;  1GE6 A;  1JAN A;  1R54 A;  1XFU A;  3HY9 A;  1UTT A;  1IAA A;  4FXY P;  4ILW D;  2XS4 A;  2HU6 A;  3HB2 P;  1A86 A;  1DMT A;  3LIR A;  2AIG P;  3LIL A;  3LMC A;  2J83 A;  1G9K A;  2K2G A;  2FV5 A;  1USN A;  3DPE A;  1O0Q A;  3LQ0 A;  2JNP A;  4G0D A;  1MMQ A;  4HMA A;  1ZP5 A;  4G9L A;  3LKA A;  2N8R A;  4PKT A;  3O2X A;  2OXW A;  2O3E A;  3ZUK A;  1FM1 A;  2D1O A;  1GKC A;  1YOU A;  1A85 A;  4XM7 A;  5BOY A;  1BKC E;  1MNC A;  1D8M A;  2E2D A;  1KUH A;  2MLS A;  5CUH A;  1BM6 A;  1HY7 A;  3MA2 A;  3L0V A;  4Q1L A;  1G12 A;  1IAC A;  5BOT A;  1UMT A;  4FU4 A;  2OY4 A;  1B3D A;  1BKC A;  3TVC A;  3L0T A;  1AYK A;  4HX3 A;  3DTI A;  4PKR A;  4H84 A;  1YCM A;  2AYK A;  3P1V A;  1O0T A;  3ZXH A;  1BUD A;  2DDY A;  2WO8 A;  3VI1 A;  1SU3 A;  3DPF A;  2OW0 A;  1I73 A;  3WV1 A;  1GXD A;  1OS9 A;  4WK7 A;  5D1T A;  1ROS A;  3KMC A;  4IUW A;  1MMR A;  5D7W A;  1MMP A;  4DD8 A;  2KRJ A;  2X3A A;  2DDF A;  4H3X A;  1H71 P;  3LIK A;  1HV5 A;  2FV9 A;  1GE7 A;  1KUI A;  3G5C A;  2MZE A;  1JJ9 A;  2RJP A;  1ZS0 A;  2DW1 A;  1DTH A;  1C3I A;  4JPA A;  3ELM A;  4AXQ A;  4PKS A;  2W14 A;  1PWW A;  4WZV A;  3K7L A;  4AUO A;  1R1H A;  2J0T A;  3KWV C;  2QPJ A;  4GR8 A;  1CXV A;  1WNI A;  1OM6 A;  1BQQ M;  3F1A A;  3F18 A;  3G42 A;  2MZI A;  1JAQ A;  5I3M A;  1HTD A;  2L0R A;  4XBH A;  4JP4 A;  5D1U A;  4I35 A;  3N2V A;  1C8T A;  1D8F A;  1OO9 A;  3B92 A;  1R1I A;  2OW2 A;  3Q2G A;  2OW9 A;  4A3W A;  4L7A A;  3B2Z A;  4FVL A;  2K9C A;  3HDA P;  1HFS A;  2USN A;  3DWB A;  4GUY A;  1XFY A;  3USN A;  4DPE A;  3KEC A;  1RMZ A;  3F19 A;  1SLM A;  3V96 B;  1ZTQ A;  2MLR A;  3N2U A;  1YQY A;  3EDG A;  3KEJ A;  4J4M A;  3HDB A;  1XFZ A;  2W13 A;  1CGE A;  3I7G A;  1Y0V A;  1I76 A;  2PJT A;  3EHX A;  1XUR A;  1G4K A;  1AKL A;  3DTK A;  1PWU A;  4FXQ A;  2OZR A;  5I4O A;  4IJO A;  3ZVS A;  1BUV M;  2OXZ A;  3GBO A;  1OMJ A;  2O36 A;  2OVZ A;  3LJZ A;  4ON1 A;  456C A;  1K7I A;  3RTS A;  1FLS A;  1RM8 A;  5LAB A;  3TT4 A;  1K7G A;  1HFC A;  1PWP A;  1CK7 A;  3KRY A;  1JKY A;  1HOV A;  1XUC A;  1KUG A;  3I7I A;  2DW0 A;  5BPA A;  3WV3 A;  1QJJ A;  2YB9 A;  1Z3J A;  4H30 A;  1SRP A;  2JSD A;  1EB6 A;  3BA0 A;  1OM8 A;  4L19 A;  3UVC A;  1ZVX A;  4ZR5 A;  4H82 A;  4JIJ A;  3DL1 A;  4PKQ A;  1EUB A;  3LEA A;  1KAP P;  1KUK A;  3E8R A;  3LUM A;  1AF0 A;  2W15 A;  3AYU A;  1SAT A;  2RJQ A;  4XM6 A;  1Q3A A;  2ERO A;  5I12 A;  1G05 A;  2YIG A;  1BZS A;  3NX7 A;  5B5P A;  3F15 A;  1QJI A;  1JK3 A;  5H8X A;  5CXA A;  3F16 A;  1CGF A;  1PWQ A;  1YP1 A;  1ZXC A;  2I47 A;  2Z2D A;  2XS3 A;  4H1Q A;  1AST A;  3EDZ A;  5D2B A;  3EWJ A;  1D5J A;  3VTG A;  1XFV A;  2Y6D A;  2CLT A;  3B8Z A;  4GF1 A;  1BQO A;  1D7X A;  4L6T A;  3U1R A;  3HBV P;  1UMS A;  4PKU A;  5B5O A;  3LGP A;  4GR3 A;  2WO9 A;  2JT5 A;  1SLN A;  1SMP A;  3Q2H A;  4WF6 A;  4I03 A;  1KBC A;  4PKW A;  2V4B A;  3OHO A;  1IAE A;  4EFS A;  2TCL A;  1QIA A;  1JH1 A;  1FBL A;  2E3X A;  3EDI A;  4GWN A;  2OVX A;  3DNG A;  3TSK A;  1ATL A;  3KHI A;  4DF9 A;  4JA1 A;  1OS2 A;  4CTH A;  3LJT A;  2OY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...