4AXQA

Crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
GSHMKIYIQPLSVNSHTVEVLANSLPKIFNAEVFVLPASDVSLKCYNASRRQYNSTCILRMLPPIKVTLGVTGKDIYAKGMNFVFGEAELGGARAVLSVFRLTTADSELYRERVVKEAVHEIGHVLGLKHCSNNCVMRFSNSVQDVDRKPVSFCRECASKIRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARCHAEMETZINCIN
publication title Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 53
structure length 163
sequence length 163
ec nomenclature ec 3.-.-.-:
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07998 Peptidase_M54 Peptidase family M54
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4axqA01
5L79A 2WO8A 3LEAA 2V4BA 3LIRA 1SU3A 1XUCA 2JNPA 1GKDA 1DMTA 1IAAA 1OS9A 5CXAA 2MLSA 2E2DA 1XFUA 3E8RA 1G49A 1JAQA 1HFCA 1PWPA 1R1HA 1QIBA 5BOTA 1K7IA 4J4MA 5B5OA 3TVCA 3SHIA 1FM1A 1CGFA 1BSWA 456CA 1SATA 3F17A 3LQ0A 1D7XA 1IADA 4H84A 4EFSA 3EDGA 1D8MA 4DF9A 2ERQA 830CA 2YIGA 1XFZA 3OHOA 1QJIA 4IN9A 3RTSA 2DDFA 1UMTA 4CTHA 1IAEA 3F16A 4DD8A 3DWBA 2OVZA 3TS4A 1BZSA 3NX7A 3LKAA 4G0DA 1IAGA 1KUIA 1SLNA 1XFWA 2A8HA 4XM6A 1CGLA 5D7WA 1GE6A 1MMBA 4PKWA 1AF0A 4WK7A 4JIJA 1C7KA 1HY7A 1OO9A 1BKCE 1BIWA 1JAOA 1ZVXA 5I0LA 2OXUA 4JPAA 1Z3JA 1HV5A 2FV9A 2JIHA 4A7BA 1ND1A 2DDYA 3UVCA 2D1OA 4AXQA 2J83A 2POJA 5CZMA 3LMCA 2DW1A 3CKIA 3ZXHA 1UTZA 2OW2A 1G12A 2D1NA 3LIKA 3K7LA 2FV5A 1GE7A 1ZTQA 3ZVSA 2W15A 3HBVP 1GKCA 1ASTA 4PKVA 2OVXA 4ILWD 2PJTA 1ZXCA 1O0TA 5LABA 5D3CA 2ERPA 5I2ZA 1QJJA 2DW0A 4Q1LA 1Y0VA 4GQLA 4PKUA 1XUDA 1OMJA 1KUHA 1SMPA 3EHXA 4GR8A 1A85A 4FU4A 3WV1A 4FXQA 5D1SA 2QPJA 3P1VA 5JMYA 1QICA 1EUBA 2O36A 5B5PA 1EAKA 1C3IA 3EHYA 4FVLA 1Y8JA 2JSDA 1MMRA 1WNIA 2K2GA 2JT6A 3AIGA 3LUMA 5I4OA 2CLTA 1BKCA 966CA 2KRJA 1R1IA 3MA2A 2J0TA 3DPFA 4IJOA 3EWJA 2SRTA 1JKYA 1UTTA 1IACA 3ELMA 3P24A 4XM8A 2XS4A 2OI0A 3O2XA 3K7NA 1OM8A 2RJQA 1A86A 2MZHA 1QIAA 3DSLA 2W0DA 1CXVA 1ROSA 4JA1A 1I73A 4ZR5A 1Y93A 3EDIA 3HB2P 4PKRA 4H1QA 2WO9A 3LQBA 4GWNA 4JQGA 1BQQM 1KUFA 1SRPA 2MZEA 3OHLA 3VI1A 3LGPA 3G5CA 4XCTA 1CAQA 1JH1A 1UMSA 3BA0A 4R3VA 1OS2A 4GWMA 5BPAA 3I7IA 1L6JA 2I47A 1G4KA 1PWUA 3KHIA 4JP4A 3KMEA 2W12A 2X7MA 2X3CA 4HX3A 4H3XA 3V96B 3KEKA 3HY9A 4WZVA 1B3DA 3Q2GA 2AIGP 2OW1A 1JJ9A 1JANA 1SLMA 2MLRA 2DW2A 1MMQA 4A3WA 3I7GA 3B92A 1OM7A 1BQOA 1ATLA 3Q2HA 3KECA 1YCMA 2X3AA 3HDBA 2USNA 1D8FA 1I1IP 2WOAA 3HY7A 1HTDA 4FXYP 3HDAP 2OW0A 4IUWA 4WF6A 3TSKA 1KBCA 1D5JA 3WV3A 2L0RA 5BOYA 1EB6A 4GR0A 3N2VA 3G42A 1PWQA 4H30A 2OXWA 2OY4A 1JIWP 1JIZA 1JAPA 1XFXA 1I76A 3N2UA 3O64A 4PKTA 3L0VA 3KMCA 3HYGA 3HBUP 2Z2DA 1ZS0A 3DPEA 1XURA 2CKIA 2HU6A 3LJGA 1AYKA 2Y6CA 4H2EA 1XFVA 1AKLA 2W14A 1PWWA 1DTHA 1CIZA 4L19A 1YOUA 2OY2A 1BM6A 3DL1A 5D1UA 3F18A 2O3EA 1PWVA 1IABA 3USNA 3RTTA 3F19A 4GF1A 4GR3A 1XFYA 1B8YA 3WV2A 4L6TA 3LILA 4H49A 4DPEA 3KWVC 2XS3A 3AYUA 3F15A 3LJTA 1GE5A 4XM7A 4I35A 4AYKA 4AUOA 3B2ZA 3GBOA 4GUYA 1FLSA 1CQRA 2N8RA 3VTGA 3LUNA 1KUGA 5D1TA 2OW9A 1BUVM 2AYKA 2K9CA 4G9LA 3U1RA 1ZXVA 1MNCA 1JK3A 1G05A 1R1JA 1GXDA 3L0TA 3EDHA 2OXZA 3LK8A 1CGEA 3TT4A 4QKZA 5D2BA 3KRYA 1USNA 1MMPA 2MZIA 1RM8A 4ON1A 1K7QA 5H8XA 4H76A 5I43A 1GO7P 1BKCI 3KEJA 1O0QA 5I3MA 1RMZA 4XBHA 4AIGA 1H71P 2Y6DA 4H82A 1BUDA 1K7GA 1HOVA 1YP1A 1ZP5A 1UEAA 4HMAA 2E3XA 5CUHA 3DNGA 3F1AA 5I12A 3LJZA 3EDZA 4WKEA 1KAPP 1R54A 2W13A 1J7NA 3LE9A 1S4BP 4DV8A 2OZRA 1GO8P 1FBLA 1G9KA 2YB9A 3ZUKA 1C8TA 4WKIA 5L7FA 3AYKA 3B8ZA 4PKQA 1YQYA 2JT5A 1QUAA 2TCLA 1OM6A 2RJPA 1Q3AA 4L63A 1KUKA 2X3BA 4PKSA 1HFSA 4I03A 2EROA 1R55A 1CK7A
chains in the Genus database with same CATH superfamily
5L79A 2WO8A 3LEAA 2V4BA 3LIRA 1SU3A 1XUCA 2JNPA 1GKDA 1DMTA 1IAAA 1OS9A 5CXAA 2MLSA 2E2DA 1XFUA 3E8RA 1G49A 1JAQA 1HFCA 1PWPA 1R1HA 1QIBA 5BOTA 1K7IA 4J4MA 5B5OA 3TVCA 3SHIA 1FM1A 1CGFA 1BSWA 456CA 1SATA 3F17A 3LQ0A 1D7XA 1IADA 4H84A 4EFSA 3EDGA 1D8MA 4DF9A 2ERQA 830CA 2YIGA 1XFZA 3OHOA 1QJIA 4IN9A 3RTSA 2DDFA 1UMTA 4CTHA 1IAEA 3F16A 4DD8A 3DWBA 2OVZA 3TS4A 1BZSA 3NX7A 3LKAA 4G0DA 1IAGA 1KUIA 1SLNA 1XFWA 2A8HA 4XM6A 1CGLA 5D7WA 1GE6A 1MMBA 4PKWA 1AF0A 4WK7A 4JIJA 1C7KA 1HY7A 1OO9A 1BKCE 1BIWA 1JAOA 1ZVXA 5I0LA 2OXUA 4JPAA 1Z3JA 1HV5A 2FV9A 2JIHA 4A7BA 1ND1A 2DDYA 3UVCA 2D1OA 4AXQA 2YUFA 2J83A 2POJA 5CZMA 3LMCA 2DW1A 3CKIA 3ZXHA 1UTZA 2OW2A 1G12A 2D1NA 3LIKA 3K7LA 2FV5A 1GE7A 1ZTQA 3ZVSA 2W15A 3HBVP 1GKCA 1ASTA 4PKVA 2OVXA 4ILWD 2PJTA 1ZXCA 1O0TA 5LABA 5D3CA 2ERPA 5I2ZA 1QJJA 2DW0A 4Q1LA 1Y0VA 4GQLA 4PKUA 1XUDA 1OMJA 1KUHA 1SMPA 3EHXA 4GR8A 1A85A 4FU4A 3WV1A 4FXQA 5D1SA 2QPJA 3P1VA 5JMYA 1QICA 1EUBA 2O36A 5B5PA 1EAKA 1C3IA 3EHYA 4FVLA 1Y8JA 1TVIA 2JSDA 1MMRA 1WNIA 2K2GA 2JT6A 3AIGA 3LUMA 5I4OA 2CLTA 1BKCA 966CA 2KRJA 1R1IA 3MA2A 2J0TA 3DPFA 4IJOA 3EWJA 2SRTA 1JKYA 1UTTA 1IACA 3ELMA 3P24A 4XM8A 2XS4A 2OI0A 3O2XA 3K7NA 3DTEA 1OM8A 2RJQA 1A86A 2MZHA 1QIAA 3DSLA 1OZ9A 2W0DA 1CXVA 1ROSA 4JA1A 1I73A 4ZR5A 1Y93A 3EDIA 3HB2P 4PKRA 4H1QA 2WO9A 3LQBA 4GWNA 4JQGA 1BQQM 1KUFA 1SRPA 2MZEA 3OHLA 3VI1A 3DTIA 3LGPA 3G5CA 4XCTA 1CAQA 1JH1A 1UMSA 3BA0A 4R3VA 1OS2A 4GWMA 5BPAA 3I7IA 1L6JA 2I47A 1G4KA 1PWUA 3KHIA 4L7AA 4JP4A 3KMEA 2W12A 2X7MA 2X3CA 4HX3A 4H3XA 3V96B 3KEKA 3HY9A 4WZVA 1B3DA 3Q2GA 2AIGP 2OW1A 1JJ9A 1JANA 1SLMA 2MLRA 2DW2A 3DTKA 1MMQA 4A3WA 3I7GA 3B92A 1OM7A 1BQOA 1ATLA 3Q2HA 3KECA 1YCMA 2X3AA 3HDBA 2USNA 1D8FA 1I1IP 2WOAA 3HY7A 1HTDA 4FXYP 3HDAP 2OW0A 4IUWA 4WF6A 3TSKA 1KBCA 1D5JA 3WV3A 2L0RA 5BOYA 1EB6A 4GR0A 3N2VA 3G42A 1PWQA 4H30A 2OXWA 2OY4A 1JIWP 1JIZA 1JAPA 1XFXA 1I76A 3N2UA 3O64A 4PKTA 3L0VA 3KMCA 3HYGA 3HBUP 2Z2DA 1ZS0A 3DPEA 1XURA 2CKIA 2HU6A 3LJGA 1AYKA 2Y6CA 4H2EA 1XFVA 1AKLA 2W14A 1PWWA 1DTHA 1CIZA 4L19A 1YOUA 2OY2A 1BM6A 3DL1A 5D1UA 3F18A 2O3EA 1PWVA 1IABA 3USNA 3RTTA 3F19A 4GF1A 4GR3A 1XFYA 1B8YA 3WV2A 4L6TA 3LILA 4H49A 4DPEA 3KWVC 2XS3A 3AYUA 3F15A 3LJTA 1GE5A 4XM7A 4I35A 4AYKA 4AUOA 3B2ZA 3GBOA 4GUYA 1FLSA 1CQRA 2N8RA 3VTGA 3LUNA 1KUGA 5D1TA 1XM5A 2OW9A 1BUVM 2AYKA 2K9CA 4G9LA 3U1RA 1ZXVA 1MNCA 1JK3A 1G05A 1R1JA 1GXDA 3L0TA 3EDHA 2OXZA 3LK8A 1CGEA 3TT4A 4QKZA 5D2BA 3KRYA 1USNA 1MMPA 2MZIA 1RM8A 4ON1A 1K7QA 5H8XA 4H76A 5I43A 1GO7P 1BKCI 3KEJA 1O0QA 5I3MA 1RMZA 4XBHA 4AIGA 1H71P 2Y6DA 4H82A 1BUDA 1K7GA 1HOVA 1YP1A 1ZP5A 1UEAA 4HMAA 2E3XA 5CUHA 1XAXA 3DNGA 3F1AA 5I12A 3LJZA 3EDZA 4WKEA 1KAPP 1R54A 2W13A 1J7NA 3LE9A 1S4BP 4DV8A 2OZRA 1GO8P 1FBLA 1G9KA 2YB9A 3ZUKA 1C8TA 4WKIA 5L7FA 3AYKA 3B8ZA 4PKQA 1YQYA 2JT5A 1QUAA 2TCLA 1OM6A 2RJPA 1Q3AA 4L63A 1KUKA 2X3BA 4PKSA 1HFSA 4I03A 2EROA 1R55A 1CK7A
chains in the Genus database with same CATH topology
5L79A 2WO8A 3LEAA 2V4BA 3LIRA 1SU3A 1XUCA 2JNPA 1GKDA 1DMTA 1IAAA 1OS9A 5CXAA 2MLSA 2E2DA 1XFUA 3E8RA 1G49A 1JAQA 1HFCA 1PWPA 1R1HA 1QIBA 5BOTA 1K7IA 4J4MA 5B5OA 3TVCA 3SHIA 1FM1A 1CGFA 1BSWA 456CA 1SATA 3F17A 3LQ0A 1D7XA 1IADA 4H84A 4EFSA 3EDGA 1D8MA 4DF9A 2ERQA 830CA 2YIGA 1XFZA 3OHOA 1QJIA 4IN9A 3RTSA 2DDFA 1UMTA 4CTHA 1IAEA 3F16A 4DD8A 3DWBA 2OVZA 3TS4A 1BZSA 3NX7A 3LKAA 4G0DA 1IAGA 1KUIA 1SLNA 1XFWA 2A8HA 4XM6A 1CGLA 5D7WA 1GE6A 1MMBA 4PKWA 1AF0A 4WK7A 4JIJA 1C7KA 1HY7A 1OO9A 1BKCE 1BIWA 1JAOA 1ZVXA 5I0LA 2OXUA 4JPAA 1Z3JA 1HV5A 2FV9A 2JIHA 4A7BA 1ND1A 2DDYA 3UVCA 2D1OA 4AXQA 2YUFA 2J83A 2POJA 5CZMA 3LMCA 2DW1A 3CKIA 3ZXHA 1UTZA 2OW2A 1G12A 2D1NA 3LIKA 3K7LA 2FV5A 1GE7A 1ZTQA 3ZVSA 2W15A 3HBVP 1GKCA 1ASTA 4PKVA 2OVXA 4ILWD 2PJTA 1ZXCA 1O0TA 5LABA 5D3CA 2ERPA 5I2ZA 1QJJA 2DW0A 4Q1LA 1Y0VA 4GQLA 4PKUA 1XUDA 1OMJA 1KUHA 1SMPA 3EHXA 4GR8A 1A85A 4FU4A 3WV1A 4FXQA 5D1SA 2QPJA 3P1VA 5JMYA 1QICA 1EUBA 2O36A 5B5PA 1EAKA 1C3IA 3EHYA 4FVLA 1Y8JA 2JSDA 1MMRA 1WNIA 2K2GA 2JT6A 3AIGA 3LUMA 5I4OA 2CLTA 1BKCA 966CA 2KRJA 1R1IA 3MA2A 2J0TA 3DPFA 4IJOA 3EWJA 2SRTA 1JKYA 1UTTA 1IACA 3ELMA 3P24A 4XM8A 2XS4A 2OI0A 3O2XA 3K7NA 3DTEA 1OM8A 2RJQA 1A86A 2MZHA 1QIAA 3DSLA 2W0DA 1CXVA 1ROSA 4JA1A 1I73A 4ZR5A 1Y93A 3EDIA 3HB2P 4PKRA 4H1QA 2WO9A 3LQBA 4GWNA 4JQGA 1BQQM 1KUFA 1SRPA 2MZEA 3OHLA 3VI1A 3DTIA 3LGPA 3G5CA 4XCTA 1CAQA 1JH1A 1UMSA 3BA0A 4R3VA 1OS2A 4GWMA 5BPAA 3I7IA 1L6JA 2I47A 1G4KA 1PWUA 3KHIA 4L7AA 4JP4A 3KMEA 2W12A 2X7MA 2X3CA 4HX3A 4H3XA 3V96B 3KEKA 3HY9A 4WZVA 1B3DA 3Q2GA 2AIGP 2OW1A 1JJ9A 1JANA 1SLMA 2MLRA 2DW2A 3DTKA 1MMQA 4A3WA 3I7GA 3B92A 1OM7A 1BQOA 1ATLA 3Q2HA 3KECA 1YCMA 2X3AA 3HDBA 2USNA 1D8FA 1I1IP 2WOAA 3HY7A 1HTDA 4FXYP 3HDAP 2OW0A 4IUWA 4WF6A 3TSKA 1KBCA 1D5JA 3WV3A 2L0RA 5BOYA 1EB6A 4GR0A 3N2VA 3G42A 1PWQA 4H30A 2OXWA 2OY4A 1JIWP 1JIZA 1JAPA 1XFXA 1I76A 3N2UA 3O64A 4PKTA 3L0VA 3KMCA 3HYGA 3HBUP 2Z2DA 1ZS0A 3DPEA 1XURA 2CKIA 2HU6A 3LJGA 1AYKA 2Y6CA 4H2EA 1XFVA 1AKLA 2W14A 1PWWA 1DTHA 1CIZA 4L19A 1YOUA 2OY2A 1BM6A 3DL1A 5D1UA 3F18A 2O3EA 1PWVA 1IABA 3USNA 3RTTA 3F19A 4GF1A 4GR3A 1XFYA 1B8YA 3WV2A 4L6TA 3LILA 4H49A 4DPEA 3KWVC 2XS3A 3AYUA 3F15A 3LJTA 1GE5A 4XM7A 4I35A 4AYKA 4AUOA 3B2ZA 3GBOA 4GUYA 1FLSA 1CQRA 2N8RA 3VTGA 3LUNA 1KUGA 5D1TA 2OW9A 1BUVM 2AYKA 2K9CA 4G9LA 3U1RA 1ZXVA 1MNCA 1JK3A 1G05A 1R1JA 1GXDA 3L0TA 3EDHA 2OXZA 3LK8A 1CGEA 3TT4A 4QKZA 5D2BA 3KRYA 1USNA 1MMPA 2MZIA 1RM8A 4ON1A 1K7QA 5H8XA 4H76A 5I43A 1GO7P 1BKCI 3KEJA 1O0QA 5I3MA 1RMZA 4XBHA 4AIGA 1H71P 2Y6DA 4H82A 1BUDA 1K7GA 1HOVA 1YP1A 1ZP5A 1UEAA 4HMAA 2E3XA 5CUHA 3DNGA 3F1AA 5I12A 3LJZA 3EDZA 4WKEA 1KAPP 1R54A 2W13A 1J7NA 3LE9A 1S4BP 4DV8A 2OZRA 1GO8P 1FBLA 1G9KA 2YB9A 3ZUKA 1C8TA 4WKIA 5L7FA 3AYKA 3B8ZA 4PKQA 1YQYA 2JT5A 1QUAA 2TCLA 1OM6A 2RJPA 1Q3AA 4L63A 1KUKA 2X3BA 4PKSA 1HFSA 4I03A 2EROA 1R55A 1CK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L79 A;  2WO8 A;  3LEA A;  2V4B A;  3LIR A;  1SU3 A;  1XUC A;  2JNP A;  1GKD A;  1DMT A;  1IAA A;  1OS9 A;  5CXA A;  2MLS A;  2E2D A;  1XFU A;  3E8R A;  1G49 A;  1JAQ A;  1HFC A;  1PWP A;  1R1H A;  1QIB A;  5BOT A;  1K7I A;  4J4M A;  5B5O A;  3TVC A;  3SHI A;  1FM1 A;  1CGF A;  1BSW A;  456C A;  1SAT A;  3F17 A;  3LQ0 A;  1D7X A;  1IAD A;  4H84 A;  4EFS A;  3EDG A;  1D8M A;  4DF9 A;  2ERQ A;  830C A;  2YIG A;  1XFZ A;  3OHO A;  1QJI A;  4IN9 A;  3RTS A;  2DDF A;  1UMT A;  4CTH A;  1IAE A;  3F16 A;  4DD8 A;  3DWB A;  2OVZ A;  3TS4 A;  1BZS A;  3NX7 A;  3LKA A;  4G0D A;  1IAG A;  1KUI A;  1SLN A;  1XFW A;  2A8H A;  4XM6 A;  1CGL A;  5D7W A;  1GE6 A;  1MMB A;  4PKW A;  1AF0 A;  4WK7 A;  4JIJ A;  1C7K A;  1HY7 A;  1OO9 A;  1BKC E;  1BIW A;  1JAO A;  1ZVX A;  5I0L A;  2OXU A;  4JPA A;  1Z3J A;  1HV5 A;  2FV9 A;  2JIH A;  4A7B A;  1ND1 A;  2DDY A;  3UVC A;  2D1O A;  4AXQ A;  2J83 A;  2POJ A;  5CZM A;  3LMC A;  2DW1 A;  3CKI A;  3ZXH A;  1UTZ A;  2OW2 A;  1G12 A;  2D1N A;  3LIK A;  3K7L A;  2FV5 A;  1GE7 A;  1ZTQ A;  3ZVS A;  2W15 A;  3HBV P;  1GKC A;  1AST A;  4PKV A;  2OVX A;  4ILW D;  2PJT A;  1ZXC A;  1O0T A;  5LAB A;  5D3C A;  2ERP A;  5I2Z A;  1QJJ A;  2DW0 A;  4Q1L A;  1Y0V A;  4GQL A;  4PKU A;  1XUD A;  1OMJ A;  1KUH A;  1SMP A;  3EHX A;  4GR8 A;  1A85 A;  4FU4 A;  3WV1 A;  4FXQ A;  5D1S A;  2QPJ A;  3P1V A;  5JMY A;  1QIC A;  1EUB A;  2O36 A;  5B5P A;  1EAK A;  1C3I A;  3EHY A;  4FVL A;  1Y8J A;  2JSD A;  1MMR A;  1WNI A;  2K2G A;  2JT6 A;  3AIG A;  3LUM A;  5I4O A;  2CLT A;  1BKC A;  966C A;  2KRJ A;  1R1I A;  3MA2 A;  2J0T A;  3DPF A;  4IJO A;  3EWJ A;  2SRT A;  1JKY A;  1UTT A;  1IAC A;  3ELM A;  3P24 A;  4XM8 A;  2XS4 A;  2OI0 A;  3O2X A;  3K7N A;  1OM8 A;  2RJQ A;  1A86 A;  2MZH A;  1QIA A;  3DSL A;  2W0D A;  1CXV A;  1ROS A;  4JA1 A;  1I73 A;  4ZR5 A;  1Y93 A;  3EDI A;  3HB2 P;  4PKR A;  4H1Q A;  2WO9 A;  3LQB A;  4GWN A;  4JQG A;  1BQQ M;  1KUF A;  1SRP A;  2MZE A;  3OHL A;  3VI1 A;  3LGP A;  3G5C A;  4XCT A;  1CAQ A;  1JH1 A;  1UMS A;  3BA0 A;  4R3V A;  1OS2 A;  4GWM A;  5BPA A;  3I7I A;  1L6J A;  2I47 A;  1G4K A;  1PWU A;  3KHI A;  4JP4 A;  3KME A;  2W12 A;  2X7M A;  2X3C A;  4HX3 A;  4H3X A;  3V96 B;  3KEK A;  3HY9 A;  4WZV A;  1B3D A;  3Q2G A;  2AIG P;  2OW1 A;  1JJ9 A;  1JAN A;  1SLM A;  2MLR A;  2DW2 A;  1MMQ A;  4A3W A;  3I7G A;  3B92 A;  1OM7 A;  1BQO A;  1ATL A;  3Q2H A;  3KEC A;  1YCM A;  2X3A A;  3HDB A;  2USN A;  1D8F A;  1I1I P;  2WOA A;  3HY7 A;  1HTD A;  4FXY P;  3HDA P;  2OW0 A;  4IUW A;  4WF6 A;  3TSK A;  1KBC A;  1D5J A;  3WV3 A;  2L0R A;  5BOY A;  1EB6 A;  4GR0 A;  3N2V A;  3G42 A;  1PWQ A;  4H30 A;  2OXW A;  2OY4 A;  1JIW P;  1JIZ A;  1JAP A;  1XFX A;  1I76 A;  3N2U A;  3O64 A;  4PKT A;  3L0V A;  3KMC A;  3HYG A;  3HBU P;  2Z2D A;  1ZS0 A;  3DPE A;  1XUR A;  2CKI A;  2HU6 A;  3LJG A;  1AYK A;  2Y6C A;  4H2E A;  1XFV A;  1AKL A;  2W14 A;  1PWW A;  1DTH A;  1CIZ A;  4L19 A;  1YOU A;  2OY2 A;  1BM6 A;  3DL1 A;  5D1U A;  3F18 A;  2O3E A;  1PWV A;  1IAB A;  3USN A;  3RTT A;  3F19 A;  4GF1 A;  4GR3 A;  1XFY A;  1B8Y A;  3WV2 A;  4L6T A;  3LIL A;  4H49 A;  4DPE A;  3KWV C;  2XS3 A;  3AYU A;  3F15 A;  3LJT A;  1GE5 A;  4XM7 A;  4I35 A;  4AYK A;  4AUO A;  3B2Z A;  3GBO A;  4GUY A;  1FLS A;  1CQR A;  2N8R A;  3VTG A;  3LUN A;  1KUG A;  5D1T A;  2OW9 A;  1BUV M;  2AYK A;  2K9C A;  4G9L A;  3U1R A;  1ZXV A;  1MNC A;  1JK3 A;  1G05 A;  1R1J A;  1GXD A;  3L0T A;  3EDH A;  2OXZ A;  3LK8 A;  1CGE A;  3TT4 A;  4QKZ A;  5D2B A;  3KRY A;  1USN A;  1MMP A;  2MZI A;  1RM8 A;  4ON1 A;  1K7Q A;  5H8X A;  4H76 A;  5I43 A;  1GO7 P;  1BKC I;  3KEJ A;  1O0Q A;  5I3M A;  1RMZ A;  4XBH A;  4AIG A;  1H71 P;  2Y6D A;  4H82 A;  1BUD A;  1K7G A;  1HOV A;  1YP1 A;  1ZP5 A;  1UEA A;  4HMA A;  2E3X A;  5CUH A;  3DNG A;  3F1A A;  5I12 A;  3LJZ A;  3EDZ A;  4WKE A;  1KAP P;  1R54 A;  2W13 A;  1J7N A;  3LE9 A;  1S4B P;  4DV8 A;  2OZR A;  1GO8 P;  1FBL A;  1G9K A;  2YB9 A;  3ZUK A;  1C8T A;  4WKI A;  5L7F A;  3AYK A;  3B8Z A;  4PKQ A;  1YQY A;  2JT5 A;  1QUA A;  2TCL A;  1OM6 A;  2RJP A;  1Q3A A;  4L63 A;  1KUK A;  2X3B A;  4PKS A;  1HFS A;  4I03 A;  2ERO A;  1R55 A;  1CK7 A; 
#chains in the Genus database with same CATH topology
 5L79 A;  2WO8 A;  3LEA A;  2V4B A;  3LIR A;  1SU3 A;  1XUC A;  2JNP A;  1GKD A;  1DMT A;  1IAA A;  1OS9 A;  5CXA A;  2MLS A;  2E2D A;  1XFU A;  3E8R A;  1G49 A;  1JAQ A;  1HFC A;  1PWP A;  1R1H A;  1QIB A;  5BOT A;  1K7I A;  4J4M A;  5B5O A;  3TVC A;  3SHI A;  1FM1 A;  1CGF A;  1BSW A;  456C A;  1SAT A;  3F17 A;  3LQ0 A;  1D7X A;  1IAD A;  4H84 A;  4EFS A;  3EDG A;  1D8M A;  4DF9 A;  2ERQ A;  830C A;  2YIG A;  1XFZ A;  3OHO A;  1QJI A;  4IN9 A;  3RTS A;  2DDF A;  1UMT A;  4CTH A;  1IAE A;  3F16 A;  4DD8 A;  3DWB A;  2OVZ A;  3TS4 A;  1BZS A;  3NX7 A;  3LKA A;  4G0D A;  1IAG A;  1KUI A;  1SLN A;  1XFW A;  2A8H A;  4XM6 A;  1CGL A;  5D7W A;  1GE6 A;  1MMB A;  4PKW A;  1AF0 A;  4WK7 A;  4JIJ A;  1C7K A;  1HY7 A;  1OO9 A;  1BKC E;  1BIW A;  1JAO A;  1ZVX A;  5I0L A;  2OXU A;  4JPA A;  1Z3J A;  1HV5 A;  2FV9 A;  2JIH A;  4A7B A;  1ND1 A;  2DDY A;  3UVC A;  2D1O A;  4AXQ A;  2YUF A;  2J83 A;  2POJ A;  5CZM A;  3LMC A;  2DW1 A;  3CKI A;  3ZXH A;  1UTZ A;  2OW2 A;  1G12 A;  2D1N A;  3LIK A;  3K7L A;  2FV5 A;  1GE7 A;  1ZTQ A;  3ZVS A;  2W15 A;  3HBV P;  1GKC A;  1AST A;  4PKV A;  2OVX A;  4ILW D;  2PJT A;  1ZXC A;  1O0T A;  5LAB A;  5D3C A;  2ERP A;  5I2Z A;  1QJJ A;  2DW0 A;  4Q1L A;  1Y0V A;  4GQL A;  4PKU A;  1XUD A;  1OMJ A;  1KUH A;  1SMP A;  3EHX A;  4GR8 A;  1A85 A;  4FU4 A;  3WV1 A;  4FXQ A;  5D1S A;  2QPJ A;  3P1V A;  5JMY A;  1QIC A;  1EUB A;  2O36 A;  5B5P A;  1EAK A;  1C3I A;  3EHY A;  4FVL A;  1Y8J A;  1TVI A;  2JSD A;  1MMR A;  1WNI A;  2K2G A;  2JT6 A;  3AIG A;  3LUM A;  5I4O A;  2CLT A;  1BKC A;  966C A;  2KRJ A;  1R1I A;  3MA2 A;  2J0T A;  3DPF A;  4IJO A;  3EWJ A;  2SRT A;  1JKY A;  1UTT A;  1IAC A;  3ELM A;  3P24 A;  4XM8 A;  2XS4 A;  2OI0 A;  3O2X A;  3K7N A;  3DTE A;  1OM8 A;  2RJQ A;  1A86 A;  2MZH A;  1QIA A;  3DSL A;  1OZ9 A;  2W0D A;  1CXV A;  1ROS A;  4JA1 A;  1I73 A;  4ZR5 A;  1Y93 A;  3EDI A;  3HB2 P;  4PKR A;  4H1Q A;  2WO9 A;  3LQB A;  4GWN A;  4JQG A;  1BQQ M;  1KUF A;  1SRP A;  2MZE A;  3OHL A;  3VI1 A;  3DTI A;  3LGP A;  3G5C A;  4XCT A;  1CAQ A;  1JH1 A;  1UMS A;  3BA0 A;  4R3V A;  1OS2 A;  4GWM A;  5BPA A;  3I7I A;  1L6J A;  2I47 A;  1G4K A;  1PWU A;  3KHI A;  4L7A A;  4JP4 A;  3KME A;  2W12 A;  2X7M A;  2X3C A;  4HX3 A;  4H3X A;  3V96 B;  3KEK A;  3HY9 A;  4WZV A;  1B3D A;  3Q2G A;  2AIG P;  2OW1 A;  1JJ9 A;  1JAN A;  1SLM A;  2MLR A;  2DW2 A;  3DTK A;  1MMQ A;  4A3W A;  3I7G A;  3B92 A;  1OM7 A;  1BQO A;  1ATL A;  3Q2H A;  3KEC A;  1YCM A;  2X3A A;  3HDB A;  2USN A;  1D8F A;  1I1I P;  2WOA A;  3HY7 A;  1HTD A;  4FXY P;  3HDA P;  2OW0 A;  4IUW A;  4WF6 A;  3TSK A;  1KBC A;  1D5J A;  3WV3 A;  2L0R A;  5BOY A;  1EB6 A;  4GR0 A;  3N2V A;  3G42 A;  1PWQ A;  4H30 A;  2OXW A;  2OY4 A;  1JIW P;  1JIZ A;  1JAP A;  1XFX A;  1I76 A;  3N2U A;  3O64 A;  4PKT A;  3L0V A;  3KMC A;  3HYG A;  3HBU P;  2Z2D A;  1ZS0 A;  3DPE A;  1XUR A;  2CKI A;  2HU6 A;  3LJG A;  1AYK A;  2Y6C A;  4H2E A;  1XFV A;  1AKL A;  2W14 A;  1PWW A;  1DTH A;  1CIZ A;  4L19 A;  1YOU A;  2OY2 A;  1BM6 A;  3DL1 A;  5D1U A;  3F18 A;  2O3E A;  1PWV A;  1IAB A;  3USN A;  3RTT A;  3F19 A;  4GF1 A;  4GR3 A;  1XFY A;  1B8Y A;  3WV2 A;  4L6T A;  3LIL A;  4H49 A;  4DPE A;  3KWV C;  2XS3 A;  3AYU A;  3F15 A;  3LJT A;  1GE5 A;  4XM7 A;  4I35 A;  4AYK A;  4AUO A;  3B2Z A;  3GBO A;  4GUY A;  1FLS A;  1CQR A;  2N8R A;  3VTG A;  3LUN A;  1KUG A;  5D1T A;  1XM5 A;  2OW9 A;  1BUV M;  2AYK A;  2K9C A;  4G9L A;  3U1R A;  1ZXV A;  1MNC A;  1JK3 A;  1G05 A;  1R1J A;  1GXD A;  3L0T A;  3EDH A;  2OXZ A;  3LK8 A;  1CGE A;  3TT4 A;  4QKZ A;  5D2B A;  3KRY A;  1USN A;  1MMP A;  2MZI A;  1RM8 A;  4ON1 A;  1K7Q A;  5H8X A;  4H76 A;  5I43 A;  1GO7 P;  1BKC I;  3KEJ A;  1O0Q A;  5I3M A;  1RMZ A;  4XBH A;  4AIG A;  1H71 P;  2Y6D A;  4H82 A;  1BUD A;  1K7G A;  1HOV A;  1YP1 A;  1ZP5 A;  1UEA A;  4HMA A;  2E3X A;  5CUH A;  1XAX A;  3DNG A;  3F1A A;  5I12 A;  3LJZ A;  3EDZ A;  4WKE A;  1KAP P;  1R54 A;  2W13 A;  1J7N A;  3LE9 A;  1S4B P;  4DV8 A;  2OZR A;  1GO8 P;  1FBL A;  1G9K A;  2YB9 A;  3ZUK A;  1C8T A;  4WKI A;  5L7F A;  3AYK A;  3B8Z A;  4PKQ A;  1YQY A;  2JT5 A;  1QUA A;  2TCL A;  1OM6 A;  2RJP A;  1Q3A A;  4L63 A;  1KUK A;  2X3B A;  4PKS A;  1HFS A;  4I03 A;  2ERO A;  1R55 A;  1CK7 A; 
#chains in the Genus database with same CATH homology
 5L79 A;  2WO8 A;  3LEA A;  2V4B A;  3LIR A;  1SU3 A;  1XUC A;  2JNP A;  1GKD A;  1DMT A;  1IAA A;  1OS9 A;  5CXA A;  2MLS A;  2E2D A;  1XFU A;  3E8R A;  1G49 A;  1JAQ A;  1HFC A;  1PWP A;  1R1H A;  1QIB A;  5BOT A;  1K7I A;  4J4M A;  5B5O A;  3TVC A;  3SHI A;  1FM1 A;  1CGF A;  1BSW A;  456C A;  1SAT A;  3F17 A;  3LQ0 A;  1D7X A;  1IAD A;  4H84 A;  4EFS A;  3EDG A;  1D8M A;  4DF9 A;  2ERQ A;  830C A;  2YIG A;  1XFZ A;  3OHO A;  1QJI A;  4IN9 A;  3RTS A;  2DDF A;  1UMT A;  4CTH A;  1IAE A;  3F16 A;  4DD8 A;  3DWB A;  2OVZ A;  3TS4 A;  1BZS A;  3NX7 A;  3LKA A;  4G0D A;  1IAG A;  1KUI A;  1SLN A;  1XFW A;  2A8H A;  4XM6 A;  1CGL A;  5D7W A;  1GE6 A;  1MMB A;  4PKW A;  1AF0 A;  4WK7 A;  4JIJ A;  1C7K A;  1HY7 A;  1OO9 A;  1BKC E;  1BIW A;  1JAO A;  1ZVX A;  5I0L A;  2OXU A;  4JPA A;  1Z3J A;  1HV5 A;  2FV9 A;  2JIH A;  4A7B A;  1ND1 A;  2DDY A;  3UVC A;  2D1O A;  4AXQ A;  2YUF A;  2J83 A;  2POJ A;  5CZM A;  3LMC A;  2DW1 A;  3CKI A;  3ZXH A;  1UTZ A;  2OW2 A;  1G12 A;  2D1N A;  3LIK A;  3K7L A;  2FV5 A;  1GE7 A;  1ZTQ A;  3ZVS A;  2W15 A;  3HBV P;  1GKC A;  1AST A;  4PKV A;  2OVX A;  4ILW D;  2PJT A;  1ZXC A;  1O0T A;  5LAB A;  5D3C A;  2ERP A;  5I2Z A;  1QJJ A;  2DW0 A;  4Q1L A;  1Y0V A;  4GQL A;  4PKU A;  1XUD A;  1OMJ A;  1KUH A;  1SMP A;  3EHX A;  4GR8 A;  1A85 A;  4FU4 A;  3WV1 A;  4FXQ A;  5D1S A;  2QPJ A;  3P1V A;  5JMY A;  1QIC A;  1EUB A;  2O36 A;  5B5P A;  1EAK A;  1C3I A;  3EHY A;  4FVL A;  1Y8J A;  2JSD A;  1MMR A;  1WNI A;  2K2G A;  2JT6 A;  3AIG A;  3LUM A;  5I4O A;  2CLT A;  1BKC A;  966C A;  2KRJ A;  1R1I A;  3MA2 A;  2J0T A;  3DPF A;  4IJO A;  3EWJ A;  2SRT A;  1JKY A;  1UTT A;  1IAC A;  3ELM A;  3P24 A;  4XM8 A;  2XS4 A;  2OI0 A;  3O2X A;  3K7N A;  3DTE A;  1OM8 A;  2RJQ A;  1A86 A;  2MZH A;  1QIA A;  3DSL A;  2W0D A;  1CXV A;  1ROS A;  4JA1 A;  1I73 A;  4ZR5 A;  1Y93 A;  3EDI A;  3HB2 P;  4PKR A;  4H1Q A;  2WO9 A;  3LQB A;  4GWN A;  4JQG A;  1BQQ M;  1KUF A;  1SRP A;  2MZE A;  3OHL A;  3VI1 A;  3DTI A;  3LGP A;  3G5C A;  4XCT A;  1CAQ A;  1JH1 A;  1UMS A;  3BA0 A;  4R3V A;  1OS2 A;  4GWM A;  5BPA A;  3I7I A;  1L6J A;  2I47 A;  1G4K A;  1PWU A;  3KHI A;  4L7A A;  4JP4 A;  3KME A;  2W12 A;  2X7M A;  2X3C A;  4HX3 A;  4H3X A;  3V96 B;  3KEK A;  3HY9 A;  4WZV A;  1B3D A;  3Q2G A;  2AIG P;  2OW1 A;  1JJ9 A;  1JAN A;  1SLM A;  2MLR A;  2DW2 A;  3DTK A;  1MMQ A;  4A3W A;  3I7G A;  3B92 A;  1OM7 A;  1BQO A;  1ATL A;  3Q2H A;  3KEC A;  1YCM A;  2X3A A;  3HDB A;  2USN A;  1D8F A;  1I1I P;  2WOA A;  3HY7 A;  1HTD A;  4FXY P;  3HDA P;  2OW0 A;  4IUW A;  4WF6 A;  3TSK A;  1KBC A;  1D5J A;  3WV3 A;  2L0R A;  5BOY A;  1EB6 A;  4GR0 A;  3N2V A;  3G42 A;  1PWQ A;  4H30 A;  2OXW A;  2OY4 A;  1JIW P;  1JIZ A;  1JAP A;  1XFX A;  1I76 A;  3N2U A;  3O64 A;  4PKT A;  3L0V A;  3KMC A;  3HYG A;  3HBU P;  2Z2D A;  1ZS0 A;  3DPE A;  1XUR A;  2CKI A;  2HU6 A;  3LJG A;  1AYK A;  2Y6C A;  4H2E A;  1XFV A;  1AKL A;  2W14 A;  1PWW A;  1DTH A;  1CIZ A;  4L19 A;  1YOU A;  2OY2 A;  1BM6 A;  3DL1 A;  5D1U A;  3F18 A;  2O3E A;  1PWV A;  1IAB A;  3USN A;  3RTT A;  3F19 A;  4GF1 A;  4GR3 A;  1XFY A;  1B8Y A;  3WV2 A;  4L6T A;  3LIL A;  4H49 A;  4DPE A;  3KWV C;  2XS3 A;  3AYU A;  3F15 A;  3LJT A;  1GE5 A;  4XM7 A;  4I35 A;  4AYK A;  4AUO A;  3B2Z A;  3GBO A;  4GUY A;  1FLS A;  1CQR A;  2N8R A;  3VTG A;  3LUN A;  1KUG A;  5D1T A;  2OW9 A;  1BUV M;  2AYK A;  2K9C A;  4G9L A;  3U1R A;  1ZXV A;  1MNC A;  1JK3 A;  1G05 A;  1R1J A;  1GXD A;  3L0T A;  3EDH A;  2OXZ A;  3LK8 A;  1CGE A;  3TT4 A;  4QKZ A;  5D2B A;  3KRY A;  1USN A;  1MMP A;  2MZI A;  1RM8 A;  4ON1 A;  1K7Q A;  5H8X A;  4H76 A;  5I43 A;  1GO7 P;  1BKC I;  3KEJ A;  1O0Q A;  5I3M A;  1RMZ A;  4XBH A;  4AIG A;  1H71 P;  2Y6D A;  4H82 A;  1BUD A;  1K7G A;  1HOV A;  1YP1 A;  1ZP5 A;  1UEA A;  4HMA A;  2E3X A;  5CUH A;  3DNG A;  3F1A A;  5I12 A;  3LJZ A;  3EDZ A;  4WKE A;  1KAP P;  1R54 A;  2W13 A;  1J7N A;  3LE9 A;  1S4B P;  4DV8 A;  2OZR A;  1GO8 P;  1FBL A;  1G9K A;  2YB9 A;  3ZUK A;  1C8T A;  4WKI A;  5L7F A;  3AYK A;  3B8Z A;  4PKQ A;  1YQY A;  2JT5 A;  1QUA A;  2TCL A;  1OM6 A;  2RJP A;  1Q3A A;  4L63 A;  1KUK A;  2X3B A;  4PKS A;  1HFS A;  4I03 A;  2ERO A;  1R55 A;  1CK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...