5CUHA

Crystal structure mmp-9 complexes with a constrained hydroxamate based inhibitor lt4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrix metalloproteinase-9,Matrix metalloproteinase-9
publication title Discovery of a new selective inhibitor of A Disintegrin And Metalloprotease 10 (ADAM-10) able to reduce the shedding of NKG2D ligands in Hodgkin's lymphoma cell models.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5cuhA00
1JK3A 4JIJA 2AIGP 1XFVA 3E8RA 4FXQA 1JIWP 1ZVXA 3EHYA 3EDIA 1L6JA 3HDAP 1GXDA 1R1JA 3O64A 1GO7P 2K9CA 2Y6CA 1D7XA 3LMCA 3K7LA 1CQRA 1BKCE 2EROA 2I47A 1G05A 3WV3A 1GKDA 3G5CA 2JT5A 3I7GA 5D1SA 1HFSA 1PWUA 1ND1A 1K7IA 1S4BP 4A7BA 3RTTA 3F19A 4G0DA 4GR8A 3HB2P 3Q2HA 2W0DA 3AYKA 4H1QA 2POJA 1D8MA 1SLMA 4H76A 1KUIA 3HBVP 1CK7A 1BUVM 1JAQA 5D3CA 5LABA 2YIGA 2DW0A 4ON1A 3LILA 1K7QA 3LQ0A 1PWQA 3LJGA 4JQGA 2J83A 1BZSA 1MMPA 1Z3JA 1MMBA 2OI0A 5CZMA 1ZS0A 2V4BA 3KECA 1GKCA 1XUCA 2XS3A 3F15A 2XS4A 4H84A 2D1OA 1OM8A 4AIGA 1HTDA 1C8TA 4PKUA 1QUAA 1CGFA 1IADA 1R1IA 4HMAA 2FV5A 4XM6A 1AYKA 1OO9A 4IN9A 4JP4A 5B5OA 4FU4A 3OHOA 4AYKA 2MLRA 2X3CA 3LIKA 2OY2A 5I0LA 3KMEA 1JH1A 2AYKA 1UTZA 3O2XA 1BUDA 1PWPA 3ZVSA 5I43A 3LUNA 4H49A 2E2DA 1XFXA 3HBUP 1USNA 1EB6A 1YOUA 1OMJA 3EDGA 3EWJA 3DWBA 3VI1A 4H30A 3DPFA 2OW9A 3EHXA 5BPAA 1YCMA 4GR0A 1KUFA 3KEKA 1WNIA 1DTHA 1BKCA 2MZEA 2USNA 4WF6A 1B3DA 1CGLA 1J7NA 1SMPA 5JMYA 1OM6A 2MLSA 4R3VA 3KHIA 1G4KA 1BKCI 1IACA 3B92A 4Q1LA 3DL1A 3LGPA 5D1TA 1G49A 3AIGA 3F17A 2Y6DA 2JSDA 2X3BA 4L6TA 1GO8P 4AXQA 3F1AA 2RJQA 4H82A 1QICA 4DD8A 5D1UA 1GE7A 4EFSA 1IAGA 1RM8A 2QPJA 1C7KA 2ERPA 4H2EA 1YQYA 3LQBA 3L0TA 5I3MA 3KWVC 3P1VA 3L0VA 3LJTA 1QIAA 1ZTQA 1MMQA 1FBLA 3DSLA 3I7IA 1IABA 2J0TA 1EAKA 4WKEA 2OVZA 2O36A 1ATLA 4ILWD 1ZXCA 456CA 3HY9A 1SATA 5D7WA 1XFYA 1Y0VA 1R55A 2JT6A 830CA 2MZHA 4QKZA 2PJTA 1CAQA 2DW2A 5BOTA 3LKAA 1Y8JA 1K7GA 2MZIA 4DF9A 2W12A 5CUHA 4AUOA 1O0TA 2N8RA 1G12A 3LUMA 1D5JA 2YB9A 1CXVA 1CIZA 1OM7A 2OXZA 1EUBA 2FV9A 3P24A 4JPAA 4I03A 1HFCA 1XFUA 4FVLA 2JNPA 4PKVA 2A8HA 1XFWA 1MMRA 2W13A 2X7MA 2DW1A 1ZP5A 2OVXA 1UMTA 3KEJA 4PKTA 2Z2DA 1C3IA 2TCLA 4CTHA 1XUDA 2OW2A 3LE9A 3DNGA 2CKIA 1HY7A 4FXYP 2ERQA 3LJZA 1GE6A 2O3EA 1XURA 4GR3A 4XCTA 4XM8A 4PKQA 5CXAA 3B8ZA 5BOYA 1AF0A 1KUKA 4PKWA 4GWNA 1BIWA 1FLSA 1JKYA 3UVCA 1OS2A 2CLTA 1KUGA 3V96B 3NX7A 3GBOA 1YP1A 3HYGA 5D2BA 3LEAA 1JAPA 3VTGA 3G42A 3TS4A 1SRPA 1CGEA 3TSKA 1JAOA 1R1HA 2HU6A 1A85A 1I73A 1ASTA 2W15A 4L63A 1OS9A 1G9KA 2KRJA 1UTTA 1I1IP 1SLNA 4IJOA 4HX3A 1KUHA 1ROSA 1KBCA 3Q2GA 4PKSA 1JIZA 4I35A 3USNA 3TVCA 5I4OA 2JIHA 4XM7A 1KAPP 4PKRA 1IAEA 3TT4A 1I76A 3K7NA 4GWMA 1BQOA 3MA2A 1BQQM 1B8YA 1PWVA 3F18A 4XBHA 2OXUA 3EDHA 3HDBA 2OXWA 1O0QA 4GUYA 3U1RA 5I2ZA 1XFZA 1QIBA 3LK8A 3AYUA 3ZXHA 3WV2A 4DPEA 1AKLA 3DPEA 4L19A 3WV1A 2D1NA 3F16A 2DDYA 2OW1A 5L79A 3BA0A 2SRTA 2OZRA 4A3WA 4G9LA 1DMTA 3EDZA 3N2UA 1QJIA 4H3XA 4WK7A 2X3AA 2OW0A 3LIRA 4WZVA 3N2VA 1IAAA 3SHIA 2K2GA 1RMZA 4WKIA 3KRYA 1A86A 3CKIA 4JA1A 1BM6A 2WOAA 4GQLA 1MNCA 1Y93A 3RTSA 1HOVA 966CA 4IUWA 3ZUKA 1SU3A 4DV8A 2WO8A 1R54A 3HY7A 5H8XA 1QJJA 1D8FA 1UEAA 2L0RA 2RJPA 4GF1A 1HV5A 3B2ZA 3ELMA 5B5PA 5L7FA 2W14A 3KMCA 1H71P 4ZR5A 5I12A 1JANA 2E3XA 3OHLA 4J4MA 1PWWA 1GE5A 1FM1A 1Q3AA 1BSWA 2DDFA 2OY4A 2WO9A 1ZXVA 1JJ9A 1UMSA
chains in the Genus database with same CATH superfamily
1JK3A 4JIJA 2AIGP 1XFVA 3E8RA 4FXQA 1JIWP 1ZVXA 3EHYA 3EDIA 1L6JA 3HDAP 1GXDA 1R1JA 3O64A 1GO7P 2K9CA 2Y6CA 1D7XA 3LMCA 3K7LA 1CQRA 3DTEA 1BKCE 2EROA 2I47A 1G05A 3WV3A 1GKDA 3G5CA 2JT5A 3I7GA 5D1SA 1HFSA 1PWUA 1ND1A 1K7IA 1S4BP 4A7BA 1XM5A 3RTTA 3F19A 4G0DA 4GR8A 3HB2P 3Q2HA 2W0DA 3AYKA 4H1QA 2POJA 1D8MA 1SLMA 4H76A 1KUIA 3HBVP 1CK7A 1BUVM 1JAQA 5D3CA 5LABA 2YIGA 2DW0A 4ON1A 3LILA 1K7QA 3LQ0A 1PWQA 3LJGA 4JQGA 2J83A 1BZSA 1MMPA 1Z3JA 1MMBA 2OI0A 5CZMA 1ZS0A 2V4BA 3KECA 1GKCA 1XUCA 2XS3A 3F15A 2XS4A 4H84A 2D1OA 1OM8A 4AIGA 1HTDA 1C8TA 4PKUA 1QUAA 1CGFA 1IADA 1R1IA 4HMAA 2FV5A 4XM6A 1AYKA 1OO9A 4IN9A 4JP4A 5B5OA 4FU4A 3OHOA 4AYKA 2MLRA 2X3CA 3LIKA 2OY2A 5I0LA 3KMEA 1JH1A 2AYKA 1UTZA 3O2XA 1BUDA 1PWPA 3ZVSA 5I43A 3LUNA 4H49A 2E2DA 1XFXA 3HBUP 1USNA 1EB6A 1YOUA 1OMJA 3EDGA 1TVIA 3EWJA 3DWBA 3VI1A 4H30A 3DPFA 2OW9A 3EHXA 5BPAA 1YCMA 4GR0A 1KUFA 3KEKA 1WNIA 1DTHA 1BKCA 2MZEA 2USNA 4WF6A 1B3DA 1CGLA 1J7NA 1SMPA 5JMYA 1OM6A 2MLSA 4R3VA 3KHIA 1G4KA 1BKCI 1IACA 3B92A 4Q1LA 3DL1A 3LGPA 5D1TA 1G49A 3AIGA 3F17A 2Y6DA 2JSDA 2X3BA 4L6TA 1GO8P 4AXQA 3F1AA 2RJQA 4H82A 1QICA 4DD8A 5D1UA 1GE7A 4EFSA 4L7AA 1IAGA 1RM8A 2QPJA 1C7KA 2ERPA 4H2EA 1YQYA 2YUFA 3LQBA 3L0TA 5I3MA 3KWVC 3P1VA 3L0VA 3LJTA 1QIAA 1ZTQA 1MMQA 1FBLA 3DSLA 3I7IA 1IABA 2J0TA 1EAKA 4WKEA 2OVZA 2O36A 1ATLA 1XAXA 4ILWD 1ZXCA 456CA 3HY9A 1SATA 5D7WA 1XFYA 1Y0VA 1R55A 2JT6A 830CA 2MZHA 4QKZA 2PJTA 1CAQA 2DW2A 5BOTA 3LKAA 1Y8JA 1K7GA 2MZIA 4DF9A 2W12A 5CUHA 4AUOA 1O0TA 2N8RA 1G12A 3LUMA 1D5JA 3DTKA 2YB9A 1CXVA 1CIZA 1OM7A 2OXZA 1EUBA 2FV9A 3P24A 4JPAA 4I03A 1HFCA 1XFUA 4FVLA 2JNPA 4PKVA 2A8HA 1XFWA 1MMRA 2W13A 2X7MA 2DW1A 1ZP5A 2OVXA 1UMTA 3KEJA 4PKTA 2Z2DA 1C3IA 2TCLA 4CTHA 1XUDA 2OW2A 3LE9A 3DNGA 2CKIA 1HY7A 4FXYP 2ERQA 3LJZA 1GE6A 2O3EA 1XURA 4GR3A 4XCTA 4XM8A 4PKQA 5CXAA 3B8ZA 5BOYA 1AF0A 1KUKA 4PKWA 4GWNA 1BIWA 1FLSA 1JKYA 3UVCA 1OS2A 2CLTA 1KUGA 3V96B 3NX7A 3GBOA 1YP1A 3HYGA 5D2BA 3LEAA 1JAPA 3VTGA 3G42A 3TS4A 1SRPA 1CGEA 3TSKA 1JAOA 1R1HA 2HU6A 1A85A 1I73A 1ASTA 2W15A 4L63A 1OS9A 1G9KA 2KRJA 1UTTA 1I1IP 1SLNA 4IJOA 4HX3A 1KUHA 1ROSA 1KBCA 3Q2GA 4PKSA 1JIZA 4I35A 3USNA 3TVCA 5I4OA 2JIHA 4XM7A 1KAPP 4PKRA 1IAEA 3TT4A 1I76A 3K7NA 4GWMA 1BQOA 3MA2A 1BQQM 1B8YA 1PWVA 3F18A 4XBHA 2OXUA 3EDHA 3HDBA 2OXWA 1O0QA 4GUYA 3U1RA 5I2ZA 1XFZA 1QIBA 3LK8A 3AYUA 3ZXHA 3WV2A 4DPEA 1AKLA 3DPEA 4L19A 3WV1A 2D1NA 3F16A 2DDYA 2OW1A 5L79A 3BA0A 2SRTA 2OZRA 4A3WA 4G9LA 1DMTA 3EDZA 3N2UA 1QJIA 4H3XA 4WK7A 2X3AA 2OW0A 3LIRA 4WZVA 3N2VA 3DTIA 1IAAA 3SHIA 2K2GA 1RMZA 4WKIA 3KRYA 1OZ9A 1A86A 3CKIA 4JA1A 1BM6A 2WOAA 4GQLA 1MNCA 1Y93A 3RTSA 1HOVA 966CA 4IUWA 3ZUKA 1SU3A 4DV8A 2WO8A 1R54A 3HY7A 5H8XA 1QJJA 1D8FA 1UEAA 2L0RA 2RJPA 4GF1A 1HV5A 3B2ZA 3ELMA 5B5PA 5L7FA 2W14A 3KMCA 1H71P 4ZR5A 5I12A 1JANA 2E3XA 3OHLA 4J4MA 1PWWA 1GE5A 1FM1A 1Q3AA 1BSWA 2DDFA 2OY4A 2WO9A 1ZXVA 1JJ9A 1UMSA
chains in the Genus database with same CATH topology
1JK3A 4JIJA 2AIGP 1XFVA 3E8RA 4FXQA 1JIWP 1ZVXA 3EHYA 3EDIA 1L6JA 3HDAP 1GXDA 1R1JA 3O64A 1GO7P 2K9CA 2Y6CA 1D7XA 3LMCA 3K7LA 1CQRA 3DTEA 1BKCE 2EROA 2I47A 1G05A 3WV3A 1GKDA 3G5CA 2JT5A 3I7GA 5D1SA 1HFSA 1PWUA 1ND1A 1K7IA 1S4BP 4A7BA 3RTTA 3F19A 4G0DA 4GR8A 3HB2P 3Q2HA 2W0DA 3AYKA 4H1QA 2POJA 1D8MA 1SLMA 4H76A 1KUIA 3HBVP 1CK7A 1BUVM 1JAQA 5D3CA 5LABA 2YIGA 2DW0A 4ON1A 3LILA 1K7QA 3LQ0A 1PWQA 3LJGA 4JQGA 2J83A 1BZSA 1MMPA 1Z3JA 1MMBA 2OI0A 5CZMA 1ZS0A 2V4BA 3KECA 1GKCA 1XUCA 2XS3A 3F15A 2XS4A 4H84A 2D1OA 1OM8A 4AIGA 1HTDA 1C8TA 4PKUA 1QUAA 1CGFA 1IADA 1R1IA 4HMAA 2FV5A 4XM6A 1AYKA 1OO9A 4IN9A 4JP4A 5B5OA 4FU4A 3OHOA 4AYKA 2MLRA 2X3CA 3LIKA 2OY2A 5I0LA 3KMEA 1JH1A 2AYKA 1UTZA 3O2XA 1BUDA 1PWPA 3ZVSA 5I43A 3LUNA 4H49A 2E2DA 1XFXA 3HBUP 1USNA 1EB6A 1YOUA 1OMJA 3EDGA 3EWJA 3DWBA 3VI1A 4H30A 3DPFA 2OW9A 3EHXA 5BPAA 1YCMA 4GR0A 1KUFA 3KEKA 1WNIA 1DTHA 1BKCA 2MZEA 2USNA 4WF6A 1B3DA 1CGLA 1J7NA 1SMPA 5JMYA 1OM6A 2MLSA 4R3VA 3KHIA 1G4KA 1BKCI 1IACA 3B92A 4Q1LA 3DL1A 3LGPA 5D1TA 1G49A 3AIGA 3F17A 2Y6DA 2JSDA 2X3BA 4L6TA 1GO8P 4AXQA 3F1AA 2RJQA 4H82A 1QICA 4DD8A 5D1UA 1GE7A 4EFSA 4L7AA 1IAGA 1RM8A 2QPJA 1C7KA 2ERPA 4H2EA 1YQYA 2YUFA 3LQBA 3L0TA 5I3MA 3KWVC 3P1VA 3L0VA 3LJTA 1QIAA 1ZTQA 1MMQA 1FBLA 3DSLA 3I7IA 1IABA 2J0TA 1EAKA 4WKEA 2OVZA 2O36A 1ATLA 4ILWD 1ZXCA 456CA 3HY9A 1SATA 5D7WA 1XFYA 1Y0VA 1R55A 2JT6A 830CA 2MZHA 4QKZA 2PJTA 1CAQA 2DW2A 5BOTA 3LKAA 1Y8JA 1K7GA 2MZIA 4DF9A 2W12A 5CUHA 4AUOA 1O0TA 2N8RA 1G12A 3LUMA 1D5JA 3DTKA 2YB9A 1CXVA 1CIZA 1OM7A 2OXZA 1EUBA 2FV9A 3P24A 4JPAA 4I03A 1HFCA 1XFUA 4FVLA 2JNPA 4PKVA 2A8HA 1XFWA 1MMRA 2W13A 2X7MA 2DW1A 1ZP5A 2OVXA 1UMTA 3KEJA 4PKTA 2Z2DA 1C3IA 2TCLA 4CTHA 1XUDA 2OW2A 3LE9A 3DNGA 2CKIA 1HY7A 4FXYP 2ERQA 3LJZA 1GE6A 2O3EA 1XURA 4GR3A 4XCTA 4XM8A 4PKQA 5CXAA 3B8ZA 5BOYA 1AF0A 1KUKA 4PKWA 4GWNA 1BIWA 1FLSA 1JKYA 3UVCA 1OS2A 2CLTA 1KUGA 3V96B 3NX7A 3GBOA 1YP1A 3HYGA 5D2BA 3LEAA 1JAPA 3VTGA 3G42A 3TS4A 1SRPA 1CGEA 3TSKA 1JAOA 1R1HA 2HU6A 1A85A 1I73A 1ASTA 2W15A 4L63A 1OS9A 1G9KA 2KRJA 1UTTA 1I1IP 1SLNA 4IJOA 4HX3A 1KUHA 1ROSA 1KBCA 3Q2GA 4PKSA 1JIZA 4I35A 3USNA 3TVCA 5I4OA 2JIHA 4XM7A 1KAPP 4PKRA 1IAEA 3TT4A 1I76A 3K7NA 4GWMA 1BQOA 3MA2A 1BQQM 1B8YA 1PWVA 3F18A 4XBHA 2OXUA 3EDHA 3HDBA 2OXWA 1O0QA 4GUYA 3U1RA 5I2ZA 1XFZA 1QIBA 3LK8A 3AYUA 3ZXHA 3WV2A 4DPEA 1AKLA 3DPEA 4L19A 3WV1A 2D1NA 3F16A 2DDYA 2OW1A 5L79A 3BA0A 2SRTA 2OZRA 4A3WA 4G9LA 1DMTA 3EDZA 3N2UA 1QJIA 4H3XA 4WK7A 2X3AA 2OW0A 3LIRA 4WZVA 3N2VA 3DTIA 1IAAA 3SHIA 2K2GA 1RMZA 4WKIA 3KRYA 1A86A 3CKIA 4JA1A 1BM6A 2WOAA 4GQLA 1MNCA 1Y93A 3RTSA 1HOVA 966CA 4IUWA 3ZUKA 1SU3A 4DV8A 2WO8A 1R54A 3HY7A 5H8XA 1QJJA 1D8FA 1UEAA 2L0RA 2RJPA 4GF1A 1HV5A 3B2ZA 3ELMA 5B5PA 5L7FA 2W14A 3KMCA 1H71P 4ZR5A 5I12A 1JANA 2E3XA 3OHLA 4J4MA 1PWWA 1GE5A 1FM1A 1Q3AA 1BSWA 2DDFA 2OY4A 2WO9A 1ZXVA 1JJ9A 1UMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK3 A;  4JIJ A;  2AIG P;  1XFV A;  3E8R A;  4FXQ A;  1JIW P;  1ZVX A;  3EHY A;  3EDI A;  1L6J A;  3HDA P;  1GXD A;  1R1J A;  3O64 A;  1GO7 P;  2K9C A;  2Y6C A;  1D7X A;  3LMC A;  3K7L A;  1CQR A;  1BKC E;  2ERO A;  2I47 A;  1G05 A;  3WV3 A;  1GKD A;  3G5C A;  2JT5 A;  3I7G A;  5D1S A;  1HFS A;  1PWU A;  1ND1 A;  1K7I A;  1S4B P;  4A7B A;  3RTT A;  3F19 A;  4G0D A;  4GR8 A;  3HB2 P;  3Q2H A;  2W0D A;  3AYK A;  4H1Q A;  2POJ A;  1D8M A;  1SLM A;  4H76 A;  1KUI A;  3HBV P;  1CK7 A;  1BUV M;  1JAQ A;  5D3C A;  5LAB A;  2YIG A;  2DW0 A;  4ON1 A;  3LIL A;  1K7Q A;  3LQ0 A;  1PWQ A;  3LJG A;  4JQG A;  2J83 A;  1BZS A;  1MMP A;  1Z3J A;  1MMB A;  2OI0 A;  5CZM A;  1ZS0 A;  2V4B A;  3KEC A;  1GKC A;  1XUC A;  2XS3 A;  3F15 A;  2XS4 A;  4H84 A;  2D1O A;  1OM8 A;  4AIG A;  1HTD A;  1C8T A;  4PKU A;  1QUA A;  1CGF A;  1IAD A;  1R1I A;  4HMA A;  2FV5 A;  4XM6 A;  1AYK A;  1OO9 A;  4IN9 A;  4JP4 A;  5B5O A;  4FU4 A;  3OHO A;  4AYK A;  2MLR A;  2X3C A;  3LIK A;  2OY2 A;  5I0L A;  3KME A;  1JH1 A;  2AYK A;  1UTZ A;  3O2X A;  1BUD A;  1PWP A;  3ZVS A;  5I43 A;  3LUN A;  4H49 A;  2E2D A;  1XFX A;  3HBU P;  1USN A;  1EB6 A;  1YOU A;  1OMJ A;  3EDG A;  3EWJ A;  3DWB A;  3VI1 A;  4H30 A;  3DPF A;  2OW9 A;  3EHX A;  5BPA A;  1YCM A;  4GR0 A;  1KUF A;  3KEK A;  1WNI A;  1DTH A;  1BKC A;  2MZE A;  2USN A;  4WF6 A;  1B3D A;  1CGL A;  1J7N A;  1SMP A;  5JMY A;  1OM6 A;  2MLS A;  4R3V A;  3KHI A;  1G4K A;  1BKC I;  1IAC A;  3B92 A;  4Q1L A;  3DL1 A;  3LGP A;  5D1T A;  1G49 A;  3AIG A;  3F17 A;  2Y6D A;  2JSD A;  2X3B A;  4L6T A;  1GO8 P;  4AXQ A;  3F1A A;  2RJQ A;  4H82 A;  1QIC A;  4DD8 A;  5D1U A;  1GE7 A;  4EFS A;  1IAG A;  1RM8 A;  2QPJ A;  1C7K A;  2ERP A;  4H2E A;  1YQY A;  3LQB A;  3L0T A;  5I3M A;  3KWV C;  3P1V A;  3L0V A;  3LJT A;  1QIA A;  1ZTQ A;  1MMQ A;  1FBL A;  3DSL A;  3I7I A;  1IAB A;  2J0T A;  1EAK A;  4WKE A;  2OVZ A;  2O36 A;  1ATL A;  4ILW D;  1ZXC A;  456C A;  3HY9 A;  1SAT A;  5D7W A;  1XFY A;  1Y0V A;  1R55 A;  2JT6 A;  830C A;  2MZH A;  4QKZ A;  2PJT A;  1CAQ A;  2DW2 A;  5BOT A;  3LKA A;  1Y8J A;  1K7G A;  2MZI A;  4DF9 A;  2W12 A;  5CUH A;  4AUO A;  1O0T A;  2N8R A;  1G12 A;  3LUM A;  1D5J A;  2YB9 A;  1CXV A;  1CIZ A;  1OM7 A;  2OXZ A;  1EUB A;  2FV9 A;  3P24 A;  4JPA A;  4I03 A;  1HFC A;  1XFU A;  4FVL A;  2JNP A;  4PKV A;  2A8H A;  1XFW A;  1MMR A;  2W13 A;  2X7M A;  2DW1 A;  1ZP5 A;  2OVX A;  1UMT A;  3KEJ A;  4PKT A;  2Z2D A;  1C3I A;  2TCL A;  4CTH A;  1XUD A;  2OW2 A;  3LE9 A;  3DNG A;  2CKI A;  1HY7 A;  4FXY P;  2ERQ A;  3LJZ A;  1GE6 A;  2O3E A;  1XUR A;  4GR3 A;  4XCT A;  4XM8 A;  4PKQ A;  5CXA A;  3B8Z A;  5BOY A;  1AF0 A;  1KUK A;  4PKW A;  4GWN A;  1BIW A;  1FLS A;  1JKY A;  3UVC A;  1OS2 A;  2CLT A;  1KUG A;  3V96 B;  3NX7 A;  3GBO A;  1YP1 A;  3HYG A;  5D2B A;  3LEA A;  1JAP A;  3VTG A;  3G42 A;  3TS4 A;  1SRP A;  1CGE A;  3TSK A;  1JAO A;  1R1H A;  2HU6 A;  1A85 A;  1I73 A;  1AST A;  2W15 A;  4L63 A;  1OS9 A;  1G9K A;  2KRJ A;  1UTT A;  1I1I P;  1SLN A;  4IJO A;  4HX3 A;  1KUH A;  1ROS A;  1KBC A;  3Q2G A;  4PKS A;  1JIZ A;  4I35 A;  3USN A;  3TVC A;  5I4O A;  2JIH A;  4XM7 A;  1KAP P;  4PKR A;  1IAE A;  3TT4 A;  1I76 A;  3K7N A;  4GWM A;  1BQO A;  3MA2 A;  1BQQ M;  1B8Y A;  1PWV A;  3F18 A;  4XBH A;  2OXU A;  3EDH A;  3HDB A;  2OXW A;  1O0Q A;  4GUY A;  3U1R A;  5I2Z A;  1XFZ A;  1QIB A;  3LK8 A;  3AYU A;  3ZXH A;  3WV2 A;  4DPE A;  1AKL A;  3DPE A;  4L19 A;  3WV1 A;  2D1N A;  3F16 A;  2DDY A;  2OW1 A;  5L79 A;  3BA0 A;  2SRT A;  2OZR A;  4A3W A;  4G9L A;  1DMT A;  3EDZ A;  3N2U A;  1QJI A;  4H3X A;  4WK7 A;  2X3A A;  2OW0 A;  3LIR A;  4WZV A;  3N2V A;  1IAA A;  3SHI A;  2K2G A;  1RMZ A;  4WKI A;  3KRY A;  1A86 A;  3CKI A;  4JA1 A;  1BM6 A;  2WOA A;  4GQL A;  1MNC A;  1Y93 A;  3RTS A;  1HOV A;  966C A;  4IUW A;  3ZUK A;  1SU3 A;  4DV8 A;  2WO8 A;  1R54 A;  3HY7 A;  5H8X A;  1QJJ A;  1D8F A;  1UEA A;  2L0R A;  2RJP A;  4GF1 A;  1HV5 A;  3B2Z A;  3ELM A;  5B5P A;  5L7F A;  2W14 A;  3KMC A;  1H71 P;  4ZR5 A;  5I12 A;  1JAN A;  2E3X A;  3OHL A;  4J4M A;  1PWW A;  1GE5 A;  1FM1 A;  1Q3A A;  1BSW A;  2DDF A;  2OY4 A;  2WO9 A;  1ZXV A;  1JJ9 A;  1UMS A; 
#chains in the Genus database with same CATH topology
 1JK3 A;  4JIJ A;  2AIG P;  1XFV A;  3E8R A;  4FXQ A;  1JIW P;  1ZVX A;  3EHY A;  3EDI A;  1L6J A;  3HDA P;  1GXD A;  1R1J A;  3O64 A;  1GO7 P;  2K9C A;  2Y6C A;  1D7X A;  3LMC A;  3K7L A;  1CQR A;  3DTE A;  1BKC E;  2ERO A;  2I47 A;  1G05 A;  3WV3 A;  1GKD A;  3G5C A;  2JT5 A;  3I7G A;  5D1S A;  1HFS A;  1PWU A;  1ND1 A;  1K7I A;  1S4B P;  4A7B A;  1XM5 A;  3RTT A;  3F19 A;  4G0D A;  4GR8 A;  3HB2 P;  3Q2H A;  2W0D A;  3AYK A;  4H1Q A;  2POJ A;  1D8M A;  1SLM A;  4H76 A;  1KUI A;  3HBV P;  1CK7 A;  1BUV M;  1JAQ A;  5D3C A;  5LAB A;  2YIG A;  2DW0 A;  4ON1 A;  3LIL A;  1K7Q A;  3LQ0 A;  1PWQ A;  3LJG A;  4JQG A;  2J83 A;  1BZS A;  1MMP A;  1Z3J A;  1MMB A;  2OI0 A;  5CZM A;  1ZS0 A;  2V4B A;  3KEC A;  1GKC A;  1XUC A;  2XS3 A;  3F15 A;  2XS4 A;  4H84 A;  2D1O A;  1OM8 A;  4AIG A;  1HTD A;  1C8T A;  4PKU A;  1QUA A;  1CGF A;  1IAD A;  1R1I A;  4HMA A;  2FV5 A;  4XM6 A;  1AYK A;  1OO9 A;  4IN9 A;  4JP4 A;  5B5O A;  4FU4 A;  3OHO A;  4AYK A;  2MLR A;  2X3C A;  3LIK A;  2OY2 A;  5I0L A;  3KME A;  1JH1 A;  2AYK A;  1UTZ A;  3O2X A;  1BUD A;  1PWP A;  3ZVS A;  5I43 A;  3LUN A;  4H49 A;  2E2D A;  1XFX A;  3HBU P;  1USN A;  1EB6 A;  1YOU A;  1OMJ A;  3EDG A;  1TVI A;  3EWJ A;  3DWB A;  3VI1 A;  4H30 A;  3DPF A;  2OW9 A;  3EHX A;  5BPA A;  1YCM A;  4GR0 A;  1KUF A;  3KEK A;  1WNI A;  1DTH A;  1BKC A;  2MZE A;  2USN A;  4WF6 A;  1B3D A;  1CGL A;  1J7N A;  1SMP A;  5JMY A;  1OM6 A;  2MLS A;  4R3V A;  3KHI A;  1G4K A;  1BKC I;  1IAC A;  3B92 A;  4Q1L A;  3DL1 A;  3LGP A;  5D1T A;  1G49 A;  3AIG A;  3F17 A;  2Y6D A;  2JSD A;  2X3B A;  4L6T A;  1GO8 P;  4AXQ A;  3F1A A;  2RJQ A;  4H82 A;  1QIC A;  4DD8 A;  5D1U A;  1GE7 A;  4EFS A;  4L7A A;  1IAG A;  1RM8 A;  2QPJ A;  1C7K A;  2ERP A;  4H2E A;  1YQY A;  2YUF A;  3LQB A;  3L0T A;  5I3M A;  3KWV C;  3P1V A;  3L0V A;  3LJT A;  1QIA A;  1ZTQ A;  1MMQ A;  1FBL A;  3DSL A;  3I7I A;  1IAB A;  2J0T A;  1EAK A;  4WKE A;  2OVZ A;  2O36 A;  1ATL A;  1XAX A;  4ILW D;  1ZXC A;  456C A;  3HY9 A;  1SAT A;  5D7W A;  1XFY A;  1Y0V A;  1R55 A;  2JT6 A;  830C A;  2MZH A;  4QKZ A;  2PJT A;  1CAQ A;  2DW2 A;  5BOT A;  3LKA A;  1Y8J A;  1K7G A;  2MZI A;  4DF9 A;  2W12 A;  5CUH A;  4AUO A;  1O0T A;  2N8R A;  1G12 A;  3LUM A;  1D5J A;  3DTK A;  2YB9 A;  1CXV A;  1CIZ A;  1OM7 A;  2OXZ A;  1EUB A;  2FV9 A;  3P24 A;  4JPA A;  4I03 A;  1HFC A;  1XFU A;  4FVL A;  2JNP A;  4PKV A;  2A8H A;  1XFW A;  1MMR A;  2W13 A;  2X7M A;  2DW1 A;  1ZP5 A;  2OVX A;  1UMT A;  3KEJ A;  4PKT A;  2Z2D A;  1C3I A;  2TCL A;  4CTH A;  1XUD A;  2OW2 A;  3LE9 A;  3DNG A;  2CKI A;  1HY7 A;  4FXY P;  2ERQ A;  3LJZ A;  1GE6 A;  2O3E A;  1XUR A;  4GR3 A;  4XCT A;  4XM8 A;  4PKQ A;  5CXA A;  3B8Z A;  5BOY A;  1AF0 A;  1KUK A;  4PKW A;  4GWN A;  1BIW A;  1FLS A;  1JKY A;  3UVC A;  1OS2 A;  2CLT A;  1KUG A;  3V96 B;  3NX7 A;  3GBO A;  1YP1 A;  3HYG A;  5D2B A;  3LEA A;  1JAP A;  3VTG A;  3G42 A;  3TS4 A;  1SRP A;  1CGE A;  3TSK A;  1JAO A;  1R1H A;  2HU6 A;  1A85 A;  1I73 A;  1AST A;  2W15 A;  4L63 A;  1OS9 A;  1G9K A;  2KRJ A;  1UTT A;  1I1I P;  1SLN A;  4IJO A;  4HX3 A;  1KUH A;  1ROS A;  1KBC A;  3Q2G A;  4PKS A;  1JIZ A;  4I35 A;  3USN A;  3TVC A;  5I4O A;  2JIH A;  4XM7 A;  1KAP P;  4PKR A;  1IAE A;  3TT4 A;  1I76 A;  3K7N A;  4GWM A;  1BQO A;  3MA2 A;  1BQQ M;  1B8Y A;  1PWV A;  3F18 A;  4XBH A;  2OXU A;  3EDH A;  3HDB A;  2OXW A;  1O0Q A;  4GUY A;  3U1R A;  5I2Z A;  1XFZ A;  1QIB A;  3LK8 A;  3AYU A;  3ZXH A;  3WV2 A;  4DPE A;  1AKL A;  3DPE A;  4L19 A;  3WV1 A;  2D1N A;  3F16 A;  2DDY A;  2OW1 A;  5L79 A;  3BA0 A;  2SRT A;  2OZR A;  4A3W A;  4G9L A;  1DMT A;  3EDZ A;  3N2U A;  1QJI A;  4H3X A;  4WK7 A;  2X3A A;  2OW0 A;  3LIR A;  4WZV A;  3N2V A;  3DTI A;  1IAA A;  3SHI A;  2K2G A;  1RMZ A;  4WKI A;  3KRY A;  1OZ9 A;  1A86 A;  3CKI A;  4JA1 A;  1BM6 A;  2WOA A;  4GQL A;  1MNC A;  1Y93 A;  3RTS A;  1HOV A;  966C A;  4IUW A;  3ZUK A;  1SU3 A;  4DV8 A;  2WO8 A;  1R54 A;  3HY7 A;  5H8X A;  1QJJ A;  1D8F A;  1UEA A;  2L0R A;  2RJP A;  4GF1 A;  1HV5 A;  3B2Z A;  3ELM A;  5B5P A;  5L7F A;  2W14 A;  3KMC A;  1H71 P;  4ZR5 A;  5I12 A;  1JAN A;  2E3X A;  3OHL A;  4J4M A;  1PWW A;  1GE5 A;  1FM1 A;  1Q3A A;  1BSW A;  2DDF A;  2OY4 A;  2WO9 A;  1ZXV A;  1JJ9 A;  1UMS A; 
#chains in the Genus database with same CATH homology
 1JK3 A;  4JIJ A;  2AIG P;  1XFV A;  3E8R A;  4FXQ A;  1JIW P;  1ZVX A;  3EHY A;  3EDI A;  1L6J A;  3HDA P;  1GXD A;  1R1J A;  3O64 A;  1GO7 P;  2K9C A;  2Y6C A;  1D7X A;  3LMC A;  3K7L A;  1CQR A;  3DTE A;  1BKC E;  2ERO A;  2I47 A;  1G05 A;  3WV3 A;  1GKD A;  3G5C A;  2JT5 A;  3I7G A;  5D1S A;  1HFS A;  1PWU A;  1ND1 A;  1K7I A;  1S4B P;  4A7B A;  3RTT A;  3F19 A;  4G0D A;  4GR8 A;  3HB2 P;  3Q2H A;  2W0D A;  3AYK A;  4H1Q A;  2POJ A;  1D8M A;  1SLM A;  4H76 A;  1KUI A;  3HBV P;  1CK7 A;  1BUV M;  1JAQ A;  5D3C A;  5LAB A;  2YIG A;  2DW0 A;  4ON1 A;  3LIL A;  1K7Q A;  3LQ0 A;  1PWQ A;  3LJG A;  4JQG A;  2J83 A;  1BZS A;  1MMP A;  1Z3J A;  1MMB A;  2OI0 A;  5CZM A;  1ZS0 A;  2V4B A;  3KEC A;  1GKC A;  1XUC A;  2XS3 A;  3F15 A;  2XS4 A;  4H84 A;  2D1O A;  1OM8 A;  4AIG A;  1HTD A;  1C8T A;  4PKU A;  1QUA A;  1CGF A;  1IAD A;  1R1I A;  4HMA A;  2FV5 A;  4XM6 A;  1AYK A;  1OO9 A;  4IN9 A;  4JP4 A;  5B5O A;  4FU4 A;  3OHO A;  4AYK A;  2MLR A;  2X3C A;  3LIK A;  2OY2 A;  5I0L A;  3KME A;  1JH1 A;  2AYK A;  1UTZ A;  3O2X A;  1BUD A;  1PWP A;  3ZVS A;  5I43 A;  3LUN A;  4H49 A;  2E2D A;  1XFX A;  3HBU P;  1USN A;  1EB6 A;  1YOU A;  1OMJ A;  3EDG A;  3EWJ A;  3DWB A;  3VI1 A;  4H30 A;  3DPF A;  2OW9 A;  3EHX A;  5BPA A;  1YCM A;  4GR0 A;  1KUF A;  3KEK A;  1WNI A;  1DTH A;  1BKC A;  2MZE A;  2USN A;  4WF6 A;  1B3D A;  1CGL A;  1J7N A;  1SMP A;  5JMY A;  1OM6 A;  2MLS A;  4R3V A;  3KHI A;  1G4K A;  1BKC I;  1IAC A;  3B92 A;  4Q1L A;  3DL1 A;  3LGP A;  5D1T A;  1G49 A;  3AIG A;  3F17 A;  2Y6D A;  2JSD A;  2X3B A;  4L6T A;  1GO8 P;  4AXQ A;  3F1A A;  2RJQ A;  4H82 A;  1QIC A;  4DD8 A;  5D1U A;  1GE7 A;  4EFS A;  4L7A A;  1IAG A;  1RM8 A;  2QPJ A;  1C7K A;  2ERP A;  4H2E A;  1YQY A;  2YUF A;  3LQB A;  3L0T A;  5I3M A;  3KWV C;  3P1V A;  3L0V A;  3LJT A;  1QIA A;  1ZTQ A;  1MMQ A;  1FBL A;  3DSL A;  3I7I A;  1IAB A;  2J0T A;  1EAK A;  4WKE A;  2OVZ A;  2O36 A;  1ATL A;  4ILW D;  1ZXC A;  456C A;  3HY9 A;  1SAT A;  5D7W A;  1XFY A;  1Y0V A;  1R55 A;  2JT6 A;  830C A;  2MZH A;  4QKZ A;  2PJT A;  1CAQ A;  2DW2 A;  5BOT A;  3LKA A;  1Y8J A;  1K7G A;  2MZI A;  4DF9 A;  2W12 A;  5CUH A;  4AUO A;  1O0T A;  2N8R A;  1G12 A;  3LUM A;  1D5J A;  3DTK A;  2YB9 A;  1CXV A;  1CIZ A;  1OM7 A;  2OXZ A;  1EUB A;  2FV9 A;  3P24 A;  4JPA A;  4I03 A;  1HFC A;  1XFU A;  4FVL A;  2JNP A;  4PKV A;  2A8H A;  1XFW A;  1MMR A;  2W13 A;  2X7M A;  2DW1 A;  1ZP5 A;  2OVX A;  1UMT A;  3KEJ A;  4PKT A;  2Z2D A;  1C3I A;  2TCL A;  4CTH A;  1XUD A;  2OW2 A;  3LE9 A;  3DNG A;  2CKI A;  1HY7 A;  4FXY P;  2ERQ A;  3LJZ A;  1GE6 A;  2O3E A;  1XUR A;  4GR3 A;  4XCT A;  4XM8 A;  4PKQ A;  5CXA A;  3B8Z A;  5BOY A;  1AF0 A;  1KUK A;  4PKW A;  4GWN A;  1BIW A;  1FLS A;  1JKY A;  3UVC A;  1OS2 A;  2CLT A;  1KUG A;  3V96 B;  3NX7 A;  3GBO A;  1YP1 A;  3HYG A;  5D2B A;  3LEA A;  1JAP A;  3VTG A;  3G42 A;  3TS4 A;  1SRP A;  1CGE A;  3TSK A;  1JAO A;  1R1H A;  2HU6 A;  1A85 A;  1I73 A;  1AST A;  2W15 A;  4L63 A;  1OS9 A;  1G9K A;  2KRJ A;  1UTT A;  1I1I P;  1SLN A;  4IJO A;  4HX3 A;  1KUH A;  1ROS A;  1KBC A;  3Q2G A;  4PKS A;  1JIZ A;  4I35 A;  3USN A;  3TVC A;  5I4O A;  2JIH A;  4XM7 A;  1KAP P;  4PKR A;  1IAE A;  3TT4 A;  1I76 A;  3K7N A;  4GWM A;  1BQO A;  3MA2 A;  1BQQ M;  1B8Y A;  1PWV A;  3F18 A;  4XBH A;  2OXU A;  3EDH A;  3HDB A;  2OXW A;  1O0Q A;  4GUY A;  3U1R A;  5I2Z A;  1XFZ A;  1QIB A;  3LK8 A;  3AYU A;  3ZXH A;  3WV2 A;  4DPE A;  1AKL A;  3DPE A;  4L19 A;  3WV1 A;  2D1N A;  3F16 A;  2DDY A;  2OW1 A;  5L79 A;  3BA0 A;  2SRT A;  2OZR A;  4A3W A;  4G9L A;  1DMT A;  3EDZ A;  3N2U A;  1QJI A;  4H3X A;  4WK7 A;  2X3A A;  2OW0 A;  3LIR A;  4WZV A;  3N2V A;  3DTI A;  1IAA A;  3SHI A;  2K2G A;  1RMZ A;  4WKI A;  3KRY A;  1A86 A;  3CKI A;  4JA1 A;  1BM6 A;  2WOA A;  4GQL A;  1MNC A;  1Y93 A;  3RTS A;  1HOV A;  966C A;  4IUW A;  3ZUK A;  1SU3 A;  4DV8 A;  2WO8 A;  1R54 A;  3HY7 A;  5H8X A;  1QJJ A;  1D8F A;  1UEA A;  2L0R A;  2RJP A;  4GF1 A;  1HV5 A;  3B2Z A;  3ELM A;  5B5P A;  5L7F A;  2W14 A;  3KMC A;  1H71 P;  4ZR5 A;  5I12 A;  1JAN A;  2E3X A;  3OHL A;  4J4M A;  1PWW A;  1GE5 A;  1FM1 A;  1Q3A A;  1BSW A;  2DDF A;  2OY4 A;  2WO9 A;  1ZXV A;  1JJ9 A;  1UMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...